5HGMA

Hexameric hiv-1 ca in complex with datp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
202
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 70
structure length 202
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgmA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgmA02
2M8PA 3G1IA 3G1GA 4U0FA 4XFZA 2X83A 1EOQA 3LRYA 2XGVA 2JO0A 1D1DA 2X2DD 3P05A 1BAJA 2KODA 2EIAA 1EM9A 5HGKA 2PWOA 1M9XC 2V4XA 3DTJA 5DCKA 3G28A 3DS3A 2LF4A 1G03A 4PH0A 1AFVA 2XDEA 4B4NA 2KGFA 4COPA 1M9FC 1A8OA 4U0DA 1QRJA 3DS2A 2PXRC 1E6JP 4INBA 4U0EA 1M9DC 1GWPA 1A43A 1M9CC 4XROA 2JYGA 2Y4ZA 3G26A 3H47A 2PWMA 4PH2A 2XGYA 3DS5A 2M8LA 3H4EA 3G29A 1P7NA 5I4TG 1M9YC 3MGEA 2BUOA 3DS4A 4PH1A 5HGOA 4U0BA 2WLVA 4XFYA 2X82A 4M0IA 3NTEA 4XRQA 3DPHA 1AK4C 2GOLB 4IPYA 5HGLA 4HTWA 2XV6A 4PH3A 4U0CA 4U0AA 2GONA 3G21A 3G0VA 2M8NA 4E91A 2WLVB 4DGAC 3DS1A 1L6NA 4LQWC 3DS0A 5HGNA 5HGMA 2XGUA 2L6EA 1U7KA 4QNBA 2XXMA 3VRLC 4DGEC 4XFXA 5JPAA 3BP9A 2ONTA 4COCA 4J93A 2XT1A 4NX4C 4WYMA 1AUMA 4E92A 1EIAA 2JPRA 2JYLA 1M9EC
chains in the Genus database with same CATH superfamily
3B4QA 1ZMBA 3G1GA 1UJZA 2K0YA 5KP6B 4XFZA 1EOQA 1K9MQ 2GZIA 1VQ4P 2XGVA 4H2WC 1D1DA 2PEQA 2QNWA 2X2DD 4IZ6A 2GZEA 2Z44A 1BAJA 2PWOA 1M9XC 4PXHB 2LKIA 3CCJP 4BPHA 1VQ5P 1VQKP 2AFDA 2PNGA 3G28A 3DS3A 1IUQA 2EFJA 2JAZA 2CG5B 3DS2A 3G71P 2FVFA 2PXRC 1ACPA 2CNRA 2CWOA 2K93A 1A43A 1JJ2O 2Y4ZA 3H47A 2PWMA 3RG2A 1Q86Q 5F2KA 2KOOA 1KD1Q 5F2NA 2KOQA 1ZNVA 2K2QA 1YI2P 3CMAP 2KG9A 1M74A 1M9YC 3DS4A 3CCLP 1AYIA 2X82A 1L0IA 3RG6C 2GOLB 2LPKA 4HTWA 1VQ8P 1FR2A 2K0XA 1K30A 3G21A 1K8AQ 1UNKA 2OARA 1N8RQ 2GDYA 2K92A 1L6NA 3CD6P 4LQWC 3B5IA 4PWVB 1VQNP 5HGNA 5HGMA 1U7KA 2XXMA 1MZ8A 1X3OA 1Z6MA 2PENA 4J93A 2FHSC 3CCMP 1M1KQ 1IMPA 1AUMA 4E92A 2JPRA 2JYLA 3GZLA 2PEOA 3G1IA 1VQ7P 3U43A 2VSQA 1RO2A 1K73Q 3GKLC 1QVFO 2N5HA 1GPJA 2DGYA 2BHVA 1Q7YQ 2K94A 2K5XA 2KOSA 3P05A 2KODA 5F2OA 2VLNA 1VQOP 2JGPA 3DTJA 4GR6A 1YJWP 2LIUA 1KLPA 3HZQA 3CC4P 2JU1A 2KGEA 1G03A 2KGCA 2XDEA 1A8OA 1KQSO 2GZJA 3GJNA 3CC2P 3OW2O 1M9DC 1GWPA 2E1MA 2CQ8A 3CCRP 2FQ0A 4GR2A 2EG5A 3GZMA 3G26A 3DS5A 4H2YC 3G29A 1P7NA 2MR7A 1VKUA 2BUOA 2MVUA 4PH1A 2DNWA 2PEKA 4U0BA 1CEIA 4M0IA 1VQ6P 5HVCA 1YIJP 1AK4C 3EJDA 2FVAA 1YHQP 3NY7B 4PH3A 2AVAA 3CXCO 2GONA 5CZDB 4E91A 3WBHA 3DS1A 1E0HA 1KC8Q 2XZ0D 3DS0A 2MF4A 2LTEA 2Z45A 1EMVA 1RO0A 3VRLC 4DGEC 3I56P 2K0DX 3HYBA 3BP9A 2MY5A 3I55P 2KR5A 4BPFA 2LOLA 4NX4C 3CC7P 2KORA 1DV5A 3CPWO 2KGDA 2L0QA 1VQLP 2Z46A 2X83A 1QVGO 5HV8A 1M6NA 2KG6A 2QEXP 5HGKA 1M90Q 2JQ4A 7CEIA 1IMQA 2L9FA 2LF4A 2PEMA 4PH0A 2KGFA 1OR5A 2KGAA 2GZFA 2GYKA 1QRJA 3H0DA 2WPTA 1GXGA 2FVEA 2QA4P 2JYGA 3CE7A 3CCSP 2M8LA 3H4EA 2PY8A 1BXIA 1T8KA 2L22A 1M6EX 5BS2A 2JBGA 5BS1A 2XZ1C 3CCQP 1VHNA 1NJIQ 2LMLA 4BPGA 3NTEA 4R0MA 3CCVP 1YITP 2OTLP 4XRQA 1W2BO 3CMEP 4IPYA 2VLOA 2FADA 2XV6A 3CCUP 2LIWA 2N6YA 1Q82Q 3G0VA 2M8NA 2WLVB 4DGAC 2XGUA 2L6EA 4QNBA 1AF8A 2JB0A 2ROQA 1YJ9P 4QKOA 2FQ2A 2ONTA 4NEOA 4F37A 2MD9A 2M5RA 5EW5E 4CA3A 1NQ4A 2N5IA 1EIAA 2OTJP 2P9XA 2KW2A 1M9EC 2M8PA 4U0FA 3CCEP 2EHTA 4DG9A 4HKGA 1GXHA 3LRYA 2FQ1A 2JO0A 1Q81Q 2X2BA 2N98A 5KP8B 2VLQA 2NO8A 2EIAA 1EM9A 2GDXA 2PEJA 4MRTC 2FAEA 2V4XA 2ERHA 5DCKA 5KP7B 3EJEA 2PEIA 3LMOA 4UHPB 1AFVA 4B4NA 2CGQA 4COPA 1M9FC 4U0DA 1E6JP 4INBA 4U0EA 1M9CC 4XROA 1HY8A 2KWLA 1F80D 4PH2A 2XGYA 2GZGA 1VQPP 2VLPA 2N50A 5I4TG 3MGEA 5HGOA 2WLVA 2EHSA 4XFYA 1HQBA 2AFEA 3DPHA 2AF8A 1YJNP 1S72P 5HGLA 2GDWA 3Q20A 1VQMP 3E2DA 4U0CA 2MR8A 4U0AA 2FACA 2L4BA 4H2XC 2N6ZA 1DNYA 2LL8A 1RNIA 4XFXA 5JPAA 4COCA 1L0HA 1VQ9P 3G4SP 2MVVA 3EJBA 2XT1A 3G6EP 4WYMA 2KOPA 2KG8A 5EJDA 3M1MA 2JU2A
chains in the Genus database with same CATH topology
2PEOA 1ZMBA 2M8PA 3G1IA 1VQ7P 1RO2A 3G1GA 4U0FA 1VQLP 1K73Q 2Z46A 3CCEP 1QVFO 4XFZA 2X83A 1EOQA 3LRYA 1K9MQ 2DGYA 1VQ4P 2XGVA 2BHVA 1Q7YQ 2JO0A 1QVGO 1D1DA 1Q81Q 2PEQA 1M6NA 2X2DD 2QEXP 3P05A 2Z44A 1BAJA 2KODA 2EIAA 1EM9A 5HGKA 5F2OA 1M90Q 2PWOA 2PEJA 1VQOP 1M9XC 2V4XA 3DTJA 4GR6A 5DCKA 1YJWP 2PEIA 3CCJP 1VQ5P 1VQKP 3G28A 3HZQA 3CC4P 3DS3A 1IUQA 2LF4A 1G03A 4PH0A 2PEMA 1AFVA 2EFJA 2XDEA 4B4NA 2KGFA 4COPA 1M9FC 1A8OA 4U0DA 1QRJA 3DS2A 3H0DA 3G71P 1KQSO 2PXRC 1E6JP 4INBA 3CC2P 4U0EA 3OW2O 2CWOA 1M9DC 1GWPA 1A43A 2E1MA 3CCRP 4GR2A 2QA4P 1M9CC 4XROA 2EG5A 1JJ2O 2JYGA 2Y4ZA 3G26A 3H47A 2PWMA 3CCSP 4PH2A 2XGYA 1Q86Q 3DS5A 2M8LA 3H4EA 2PY8A 5F2KA 1KD1Q 5F2NA 1M6EX 3G29A 1VQPP 5BS2A 1P7NA 1YI2P 5I4TG 3CMAP 1M74A 1M9YC 3MGEA 2BUOA 3DS4A 4PH1A 3CCLP 5HGOA 2PEKA 5BS1A 4U0BA 2WLVA 3CCQP 4XFYA 2X82A 1NJIQ 3CCVP 4M0IA 3NTEA 1VQ6P 1YITP 2OTLP 1YIJP 4XRQA 3DPHA 1AK4C 3RG6C 1W2BO 1YJNP 1S72P 2GOLB 3CMEP 1YHQP 4IPYA 5HGLA 4HTWA 1VQ8P 3Q20A 1VQMP 2XV6A 3CCUP 3E2DA 4PH3A 4U0CA 4U0AA 1K30A 3CXCO 2GONA 1Q82Q 3G21A 3G0VA 2M8NA 1K8AQ 4E91A 3WBHA 2WLVB 2OARA 4DGAC 1N8RQ 3DS1A 1KC8Q 1L6NA 3CD6P 4LQWC 3B5IA 3DS0A 1VQNP 5HGNA 5HGMA 2XGUA 2L6EA 1U7KA 4QNBA 2XXMA 2Z45A 1RNIA 1RO0A 3VRLC 4DGEC 3I56P 4XFXA 5JPAA 1YJ9P 3HYBA 3BP9A 2ONTA 4COCA 1VQ9P 3G4SP 3I55P 2PENA 4J93A 2XT1A 4NX4C 3CCMP 1M1KQ 3CC7P 3G6EP 4WYMA 1AUMA 4E92A 1EIAA 3CPWO 2JPRA 2JYLA 2OTJP 3M1MA 2P9XA 1M9EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8P A;  3G1I A;  3G1G A;  4U0F A;  4XFZ A;  2X83 A;  1EOQ A;  3LRY A;  2XGV A;  2JO0 A;  1D1D A;  2X2D D;  3P05 A;  1BAJ A;  2KOD A;  2EIA A;  1EM9 A;  5HGK A;  2PWO A;  1M9X C;  2V4X A;  3DTJ A;  5DCK A;  3G28 A;  3DS3 A;  2LF4 A;  1G03 A;  4PH0 A;  1AFV A;  2XDE A;  4B4N A;  2KGF A;  4COP A;  1M9F C;  1A8O A;  4U0D A;  1QRJ A;  3DS2 A;  2PXR C;  1E6J P;  4INB A;  4U0E A;  1M9D C;  1GWP A;  1A43 A;  1M9C C;  4XRO A;  2JYG A;  2Y4Z A;  3G26 A;  3H47 A;  2PWM A;  4PH2 A;  2XGY A;  3DS5 A;  2M8L A;  3H4E A;  3G29 A;  1P7N A;  5I4T G;  1M9Y C;  3MGE A;  2BUO A;  3DS4 A;  4PH1 A;  5HGO A;  4U0B A;  2WLV A;  4XFY A;  2X82 A;  4M0I A;  3NTE A;  4XRQ A;  3DPH A;  1AK4 C;  2GOL B;  4IPY A;  5HGL A;  4HTW A;  2XV6 A;  4PH3 A;  4U0C A;  4U0A A;  2GON A;  3G21 A;  3G0V A;  2M8N A;  4E91 A;  2WLV B;  4DGA C;  3DS1 A;  1L6N A;  4LQW C;  3DS0 A;  5HGN A;  5HGM A;  2XGU A;  2L6E A;  1U7K A;  4QNB A;  2XXM A;  3VRL C;  4DGE C;  4XFX A;  5JPA A;  3BP9 A;  2ONT A;  4COC A;  4J93 A;  2XT1 A;  4NX4 C;  4WYM A;  1AUM A;  4E92 A;  1EIA A;  2JPR A;  2JYL A;  1M9E C; 
#chains in the Genus database with same CATH topology
 3B4Q A;  1ZMB A;  3G1G A;  1UJZ A;  2K0Y A;  5KP6 B;  4XFZ A;  1EOQ A;  1K9M Q;  2GZI A;  1VQ4 P;  2XGV A;  4H2W C;  1D1D A;  2PEQ A;  2QNW A;  2X2D D;  4IZ6 A;  2GZE A;  2Z44 A;  1BAJ A;  2PWO A;  1M9X C;  4PXH B;  2LKI A;  3CCJ P;  4BPH A;  1VQ5 P;  1VQK P;  2AFD A;  2PNG A;  3G28 A;  3DS3 A;  1IUQ A;  2EFJ A;  2JAZ A;  2CG5 B;  3DS2 A;  3G71 P;  2FVF A;  2PXR C;  1ACP A;  2CNR A;  2CWO A;  2K93 A;  1A43 A;  1JJ2 O;  2Y4Z A;  3H47 A;  2PWM A;  3RG2 A;  1Q86 Q;  5F2K A;  2KOO A;  1KD1 Q;  5F2N A;  2KOQ A;  1ZNV A;  2K2Q A;  1YI2 P;  3CMA P;  2KG9 A;  1M74 A;  1M9Y C;  3DS4 A;  3CCL P;  1AYI A;  2X82 A;  1L0I A;  3RG6 C;  2GOL B;  2LPK A;  4HTW A;  1VQ8 P;  1FR2 A;  2K0X A;  1K30 A;  3G21 A;  1K8A Q;  1UNK A;  2OAR A;  1N8R Q;  2GDY A;  2K92 A;  1L6N A;  3CD6 P;  4LQW C;  3B5I A;  4PWV B;  1VQN P;  5HGN A;  5HGM A;  1U7K A;  2XXM A;  1MZ8 A;  1X3O A;  1Z6M A;  2PEN A;  4J93 A;  2FHS C;  3CCM P;  1M1K Q;  1IMP A;  1AUM A;  4E92 A;  2JPR A;  2JYL A;  3GZL A;  2PEO A;  3G1I A;  1VQ7 P;  3U43 A;  2VSQ A;  1RO2 A;  1K73 Q;  3GKL C;  1QVF O;  2N5H A;  1GPJ A;  2DGY A;  2BHV A;  1Q7Y Q;  2K94 A;  2K5X A;  2KOS A;  3P05 A;  2KOD A;  5F2O A;  2VLN A;  1VQO P;  2JGP A;  3DTJ A;  4GR6 A;  1YJW P;  2LIU A;  1KLP A;  3HZQ A;  3CC4 P;  2JU1 A;  2KGE A;  1G03 A;  2KGC A;  2XDE A;  1A8O A;  1KQS O;  2GZJ A;  3GJN A;  3CC2 P;  3OW2 O;  1M9D C;  1GWP A;  2E1M A;  2CQ8 A;  3CCR P;  2FQ0 A;  4GR2 A;  2EG5 A;  3GZM A;  3G26 A;  3DS5 A;  4H2Y C;  3G29 A;  1P7N A;  2MR7 A;  1VKU A;  2BUO A;  2MVU A;  4PH1 A;  2DNW A;  2PEK A;  4U0B A;  1CEI A;  4M0I A;  1VQ6 P;  5HVC A;  1YIJ P;  1AK4 C;  3EJD A;  2FVA A;  1YHQ P;  3NY7 B;  4PH3 A;  2AVA A;  3CXC O;  2GON A;  5CZD B;  4E91 A;  3WBH A;  3DS1 A;  1E0H A;  1KC8 Q;  2XZ0 D;  3DS0 A;  2MF4 A;  2LTE A;  2Z45 A;  1EMV A;  1RO0 A;  3VRL C;  4DGE C;  3I56 P;  2K0D X;  3HYB A;  3BP9 A;  2MY5 A;  3I55 P;  2KR5 A;  4BPF A;  2LOL A;  4NX4 C;  3CC7 P;  2KOR A;  1DV5 A;  3CPW O;  2KGD A;  2L0Q A;  1VQL P;  2Z46 A;  2X83 A;  1QVG O;  5HV8 A;  1M6N A;  2KG6 A;  2QEX P;  5HGK A;  1M90 Q;  2JQ4 A;  7CEI A;  1IMQ A;  2L9F A;  2LF4 A;  2PEM A;  4PH0 A;  2KGF A;  1OR5 A;  2KGA A;  2GZF A;  2GYK A;  1QRJ A;  3H0D A;  2WPT A;  1GXG A;  2FVE A;  2QA4 P;  2JYG A;  3CE7 A;  3CCS P;  2M8L A;  3H4E A;  2PY8 A;  1BXI A;  1T8K A;  2L22 A;  1M6E X;  5BS2 A;  2JBG A;  5BS1 A;  2XZ1 C;  3CCQ P;  1VHN A;  1NJI Q;  2LML A;  4BPG A;  3NTE A;  4R0M A;  3CCV P;  1YIT P;  2OTL P;  4XRQ A;  1W2B O;  3CME P;  4IPY A;  2VLO A;  2FAD A;  2XV6 A;  3CCU P;  2LIW A;  2N6Y A;  1Q82 Q;  3G0V A;  2M8N A;  2WLV B;  4DGA C;  2XGU A;  2L6E A;  4QNB A;  1AF8 A;  2JB0 A;  2ROQ A;  1YJ9 P;  4QKO A;  2FQ2 A;  2ONT A;  4NEO A;  4F37 A;  2MD9 A;  2M5R A;  5EW5 E;  4CA3 A;  1NQ4 A;  2N5I A;  1EIA A;  2OTJ P;  2P9X A;  2KW2 A;  1M9E C;  2M8P A;  4U0F A;  3CCE P;  2EHT A;  4DG9 A;  4HKG A;  1GXH A;  3LRY A;  2FQ1 A;  2JO0 A;  1Q81 Q;  2X2B A;  2N98 A;  5KP8 B;  2VLQ A;  2NO8 A;  2EIA A;  1EM9 A;  2GDX A;  2PEJ A;  4MRT C;  2FAE A;  2V4X A;  2ERH A;  5DCK A;  5KP7 B;  3EJE A;  2PEI A;  3LMO A;  4UHP B;  1AFV A;  4B4N A;  2CGQ A;  4COP A;  1M9F C;  4U0D A;  1E6J P;  4INB A;  4U0E A;  1M9C C;  4XRO A;  1HY8 A;  2KWL A;  1F80 D;  4PH2 A;  2XGY A;  2GZG A;  1VQP P;  2VLP A;  2N50 A;  5I4T G;  3MGE A;  5HGO A;  2WLV A;  2EHS A;  4XFY A;  1HQB A;  2AFE A;  3DPH A;  2AF8 A;  1YJN P;  1S72 P;  5HGL A;  2GDW A;  3Q20 A;  1VQM P;  3E2D A;  4U0C A;  2MR8 A;  4U0A A;  2FAC A;  2L4B A;  4H2X C;  2N6Z A;  1DNY A;  2LL8 A;  1RNI A;  4XFX A;  5JPA A;  4COC A;  1L0H A;  1VQ9 P;  3G4S P;  2MVV A;  3EJB A;  2XT1 A;  3G6E P;  4WYM A;  2KOP A;  2KG8 A;  5EJD A;  3M1M A;  2JU2 A; 
#chains in the Genus database with same CATH homology
 2PEO A;  1ZMB A;  2M8P A;  3G1I A;  1VQ7 P;  1RO2 A;  3G1G A;  4U0F A;  1VQL P;  1K73 Q;  2Z46 A;  3CCE P;  1QVF O;  4XFZ A;  2X83 A;  1EOQ A;  3LRY A;  1K9M Q;  2DGY A;  1VQ4 P;  2XGV A;  2BHV A;  1Q7Y Q;  2JO0 A;  1QVG O;  1D1D A;  1Q81 Q;  2PEQ A;  1M6N A;  2X2D D;  2QEX P;  3P05 A;  2Z44 A;  1BAJ A;  2KOD A;  2EIA A;  1EM9 A;  5HGK A;  5F2O A;  1M90 Q;  2PWO A;  2PEJ A;  1VQO P;  1M9X C;  2V4X A;  3DTJ A;  4GR6 A;  5DCK A;  1YJW P;  2PEI A;  3CCJ P;  1VQ5 P;  1VQK P;  3G28 A;  3HZQ A;  3CC4 P;  3DS3 A;  1IUQ A;  2LF4 A;  1G03 A;  4PH0 A;  2PEM A;  1AFV A;  2EFJ A;  2XDE A;  4B4N A;  2KGF A;  4COP A;  1M9F C;  1A8O A;  4U0D A;  1QRJ A;  3DS2 A;  3H0D A;  3G71 P;  1KQS O;  2PXR C;  1E6J P;  4INB A;  3CC2 P;  4U0E A;  3OW2 O;  2CWO A;  1M9D C;  1GWP A;  1A43 A;  2E1M A;  3CCR P;  4GR2 A;  2QA4 P;  1M9C C;  4XRO A;  2EG5 A;  1JJ2 O;  2JYG A;  2Y4Z A;  3G26 A;  3H47 A;  2PWM A;  3CCS P;  4PH2 A;  2XGY A;  1Q86 Q;  3DS5 A;  2M8L A;  3H4E A;  2PY8 A;  5F2K A;  1KD1 Q;  5F2N A;  1M6E X;  3G29 A;  1VQP P;  5BS2 A;  1P7N A;  1YI2 P;  5I4T G;  3CMA P;  1M74 A;  1M9Y C;  3MGE A;  2BUO A;  3DS4 A;  4PH1 A;  3CCL P;  5HGO A;  2PEK A;  5BS1 A;  4U0B A;  2WLV A;  3CCQ P;  4XFY A;  2X82 A;  1NJI Q;  3CCV P;  4M0I A;  3NTE A;  1VQ6 P;  1YIT P;  2OTL P;  1YIJ P;  4XRQ A;  3DPH A;  1AK4 C;  3RG6 C;  1W2B O;  1YJN P;  1S72 P;  2GOL B;  3CME P;  1YHQ P;  4IPY A;  5HGL A;  4HTW A;  1VQ8 P;  3Q20 A;  1VQM P;  2XV6 A;  3CCU P;  3E2D A;  4PH3 A;  4U0C A;  4U0A A;  1K30 A;  3CXC O;  2GON A;  1Q82 Q;  3G21 A;  3G0V A;  2M8N A;  1K8A Q;  4E91 A;  3WBH A;  2WLV B;  2OAR A;  4DGA C;  1N8R Q;  3DS1 A;  1KC8 Q;  1L6N A;  3CD6 P;  4LQW C;  3B5I A;  3DS0 A;  1VQN P;  5HGN A;  5HGM A;  2XGU A;  2L6E A;  1U7K A;  4QNB A;  2XXM A;  2Z45 A;  1RNI A;  1RO0 A;  3VRL C;  4DGE C;  3I56 P;  4XFX A;  5JPA A;  1YJ9 P;  3HYB A;  3BP9 A;  2ONT A;  4COC A;  1VQ9 P;  3G4S P;  3I55 P;  2PEN A;  4J93 A;  2XT1 A;  4NX4 C;  3CCM P;  1M1K Q;  3CC7 P;  3G6E P;  4WYM A;  1AUM A;  4E92 A;  1EIA A;  3CPW O;  2JPR A;  2JYL A;  2OTJ P;  3M1M A;  2P9X A;  1M9E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...