5HGMA

Hexameric hiv-1 ca in complex with datp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
202
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein P24
total genus 70
structure length 202
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgmA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgmA02
2GOLB 4XFZA 3G29A 3H47A 2XDEA 1BAJA 2JO0A 3DTJA 2JPRA 5I4TG 1QRJA 4E92A 2M8NA 4DGAC 1M9FC 4HTWA 2XT1A 2WLVA 2X83A 5DCKA 3LRYA 3MGEA 2XGUA 3DS0A 4B4NA 2BUOA 5HGLA 4XROA 4NX4C 4U0BA 2ONTA 4U0FA 1AFVA 2V4XA 1EIAA 3NTEA 4U0EA 4E91A 3DS2A 2PXRC 4U0AA 3DS5A 4IPYA 1A43A 4DGEC 2KODA 4LQWC 4PH0A 5HGKA 2M8LA 4XFXA 2WLVB 4PH2A 4J93A 1GWPA 1AUMA 3DS3A 2GONA 2KGFA 3P05A 4COCA 3G26A 5HGMA 4XFYA 2EIAA 1P7NA 1A8OA 2JYLA 3G0VA 1M9XC 4M0IA 4WYMA 1M9YC 2XXMA 5HGNA 4QNBA 3DS4A 3G21A 4U0DA 3DPHA 3VRLC 4U0CA 5JPAA 3DS1A 1EOQA 1G03A 4INBA 4XRQA 1EM9A 1U7KA 4PH1A 4COPA 1M9EC 2XGVA 2XV6A 2L6EA 2PWOA 5HGOA 2X82A 2Y4ZA 1E6JP 2PWMA 2M8PA 2JYGA 3G1GA 4PH3A 1L6NA 1M9CC 1M9DC 2LF4A 3G1IA 2XGYA 3H4EA 1AK4C 1D1DA 3G28A 2X2DD 3BP9A
chains in the Genus database with same CATH superfamily
4XFZA 3CCSP 3Q20A 2JPRA 4MRTC 4E92A 2P9XA 1M9FC 2AF8A 2MD9A 4CA3A 2K92A 2X83A 1Z6MA 2JU1A 2XGUA 1YIJP 2BUOA 4U0BA 1EIAA 3NTEA 2PXRC 2KGEA 2CQ8A 2LOLA 2KG6A 2GDYA 4PH0A 2M8LA 4XFXA 1ZNVA 4DG9A 2KORA 1MZ8A 2KGFA 1VQMP 4UHPB 3CMAP 2KOOA 3G6EP 5HVCA 1P7NA 1RO2A 1A8OA 3CC7P 2JYLA 5KP7B 2K0DX 3CC4P 3GZLA 1M9XC 1M9YC 2PNGA 2FQ0A 3E2DA 2FHSC 1Q86Q 3DS4A 2KG9A 2KW2A 2K94A 1HY8A 3CCJP 1VQ9P 2KOSA 1EOQA 1G03A 2GYKA 1KD1Q 2FVEA 4PH1A 2MR8A 1IMPA 2K93A 2JBGA 1E6JP 2E1MA 5KP6B 2JYGA 1ACPA 2N6ZA 1M9CC 1M9DC 5CZDB 2LF4A 1Q7YQ 2PEKA 4PXHB 3G1IA 4H2WC 2XGYA 2GZEA 2FVFA 1AK4C 2N5IA 1M6NA 3G28A 2DGYA 1X3OA 2ERHA 4IZ6A 1RNIA 3M1MA 2JO0A 3DTJA 1E0HA 2M8NA 3CCLP 2WPTA 3CCMP 1F80D 3CE7A 4H2YC 3LRYA 1NQ4A 3LMOA 4QKOA 5EJDA 3RG2A 2MY5A 1AFVA 2K2QA 2V4XA 2JAZA 4U0EA 4E91A 2GZJA 3G71P 1GPJA 2JQ4A 1VQNP 4DGEC 2KODA 4LQWC 1GXGA 1GWPA 4HKGA 1BXIA 2K0YA 1VQ7P 5BS1A 2PEOA 2GDXA 4COCA 1VQOP 1QVFO 1VHNA 2CGQA 1VQPP 1YITP 2CG5B 3G0VA 4M0IA 2GZFA 2GDWA 3GJNA 1Q82Q 2LTEA 2MF4A 2QNWA 3H0DA 4U0DA 3DPHA 1AF8A 3OW2O 2EG5A 2FQ2A 1VQ4P 2PY8A 2FAEA 3U43A 1ZMBA 2XV6A 3EJBA 2Y4ZA 1RO0A 2M8PA 1AYIA 1VQKP 1M6EX 1JJ2O 1UNKA 2KGDA 2MR7A 1K9MQ 2MVVA 4F37A 3H4EA 1VQ5P 1D1DA 5F2OA 2OARA 2EHTA 2KWLA 2VLQA 2X2DD 3BP9A 2Z46A 2FVAA 1CEIA 3H47A 2LPKA 1VQ6P 2KGCA 2KOQA 2GZIA 2Z44A 4DGAC 2LKIA 2M5RA 2CNRA 2FADA 4BPFA 2XT1A 2WLVA 2VLPA 2CWOA 2XZ0D 2BHVA 3DS0A 2JB0A 2L4BA 4XROA 4NX4C 2ONTA 3CMEP 2GZGA 2FQ1A 4U0AA 4IPYA 1A43A 1IUQA 2FACA 5HGKA 1UJZA 3I56P 2PENA 2WLVB 2KG8A 4PH2A 2AVAA 2PEJA 2GONA 3CXCO 3B4QA 2QEXP 2XZ1C 2QA4P 2OTJP 1N8RQ 1NJIQ 3GKLC 1YI2P 2VSQA 4XFYA 3G4SP 3HYBA 1YJWP 4WYMA 1K8AQ 2XXMA 2PEQA 4QNBA 5KP8B 3G21A 3VRLC 4U0CA 5JPAA 3DS1A 2MVUA 4INBA 2KGAA 4XRQA 2LL8A 2K0XA 1OR5A 1EM9A 5HV8A 3CCQP 5F2KA 7CEIA 4COPA 2XGVA 1Q81Q 1YJ9P 1K73Q 2L22A 2PWMA 2X2BA 2JGPA 3G1GA 3B5IA 3EJDA 4H2XC 1IMQA 1YHQP 1L0IA 2L0QA 2Z45A 2GOLB 2L9FA 2N50A 3G29A 1HQBA 2XDEA 1BAJA 1M1KQ 4NEOA 5I4TG 1QRJA 1YJNP 1FR2A 4HTWA 1DNYA 3CPWO 1EMVA 5DCKA 3MGEA 2N6YA 4B4NA 1S72P 5HGLA 2N5HA 2NO8A 3CCUP 4U0FA 1K30A 2K5XA 2LMLA 1QVGO 3GZMA 3DS2A 2LIUA 3CCVP 3DS5A 5BS2A 4GR6A 2AFDA 4J93A 2PEMA 1AUMA 3WBHA 3DS3A 4PWVB 2AFEA 2OTLP 1T8KA 3CCEP 3P05A 2PEIA 3G26A 4R0MA 5HGMA 1L0HA 2EIAA 2VLOA 2LIWA 3CD6P 3I55P 5F2NA 1M74A 2EFJA 3EJEA 5HGNA 2VLNA 3HZQA 3CC2P 4BPHA 2KOPA 1W2BO 2N98A 1M90Q 1U7KA 1VQLP 2ROQA 1M9EC 4BPGA 2L6EA 1VKUA 2PWOA 5HGOA 2X82A 1VQ8P 3NY7B 4GR2A 2JU2A 4PH3A 1KLPA 1L6NA 2KR5A 3RG6C 2DNWA 2EHSA 1GXHA 5EW5E 3CCRP 1KC8Q 1KQSO 1DV5A
chains in the Genus database with same CATH topology
2GOLB 4XFZA 3G29A 1RNIA 3H47A 3CCSP 3M1MA 2XDEA 1BAJA 2JO0A 1M1KQ 3DTJA 1VQ6P 3Q20A 2JPRA 5I4TG 1QRJA 4E92A 2M8NA 2Z44A 4DGAC 2P9XA 1YJNP 3CCLP 1M9FC 3CCMP 4HTWA 2XT1A 2WLVA 3CPWO 2X83A 5DCKA 2CWOA 2BHVA 3LRYA 3MGEA 2XGUA 3DS0A 4B4NA 1YIJP 1S72P 2BUOA 5HGLA 4XROA 4NX4C 4U0BA 2ONTA 3CCUP 4U0FA 3CMEP 1AFVA 1K30A 2V4XA 1EIAA 1QVGO 3NTEA 4U0EA 4E91A 3DS2A 2PXRC 3G71P 3CCVP 4U0AA 3DS5A 4IPYA 1VQNP 1A43A 5BS2A 4DGEC 2KODA 4LQWC 4PH0A 1IUQA 5HGKA 2M8LA 3I56P 2PENA 4XFXA 2WLVB 4GR6A 4PH2A 4J93A 1GWPA 1AUMA 2PEMA 3WBHA 3DS3A 2PEJA 2GONA 3CXCO 1VQ7P 5BS1A 2OTLP 2QEXP 2QA4P 2OTJP 3CCEP 2KGFA 3P05A 2PEIA 2PEOA 1VQMP 1NJIQ 3CMAP 1N8RQ 4COCA 1VQOP 1QVFO 3G26A 1YI2P 5HGMA 3G6EP 1VQPP 4XFYA 2EIAA 1YITP 1P7NA 1RO2A 1A8OA 3CC7P 2JYLA 3CD6P 3I55P 3CC4P 3G0VA 3G4SP 5F2NA 1M9XC 3HYBA 4M0IA 1YJWP 4WYMA 1M9YC 1M74A 2EFJA 1K8AQ 2XXMA 3E2DA 2PEQA 1Q86Q 5HGNA 1Q82Q 4QNBA 3DS4A 3H0DA 3G21A 4U0DA 3CCJP 3DPHA 3VRLC 1VQ9P 4U0CA 5JPAA 3DS1A 3HZQA 1EOQA 1G03A 3OW2O 4INBA 4XRQA 1KD1Q 3CC2P 1W2BO 2EG5A 1M90Q 1EM9A 1U7KA 2PY8A 3CCQP 1VQ4P 1VQLP 5F2KA 4PH1A 4COPA 1M9EC 2XGVA 1ZMBA 2XV6A 2L6EA 1Q81Q 2PWOA 5HGOA 2X82A 1VQ8P 2Y4ZA 1E6JP 1YJ9P 2E1MA 1K73Q 2PWMA 1RO0A 2M8PA 2JYGA 4GR2A 3G1GA 4PH3A 3B5IA 1L6NA 1M9CC 1M9DC 1VQKP 2LF4A 1Q7YQ 1M6EX 2PEKA 3RG6C 3G1IA 1JJ2O 1K9MQ 2XGYA 1YHQP 3H4EA 3CCRP 1AK4C 1VQ5P 1M6NA 1D1DA 3G28A 5F2OA 1KC8Q 2OARA 1KQSO 2DGYA 2Z45A 2X2DD 3BP9A 2Z46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOL B;  4XFZ A;  3G29 A;  3H47 A;  2XDE A;  1BAJ A;  2JO0 A;  3DTJ A;  2JPR A;  5I4T G;  1QRJ A;  4E92 A;  2M8N A;  4DGA C;  1M9F C;  4HTW A;  2XT1 A;  2WLV A;  2X83 A;  5DCK A;  3LRY A;  3MGE A;  2XGU A;  3DS0 A;  4B4N A;  2BUO A;  5HGL A;  4XRO A;  4NX4 C;  4U0B A;  2ONT A;  4U0F A;  1AFV A;  2V4X A;  1EIA A;  3NTE A;  4U0E A;  4E91 A;  3DS2 A;  2PXR C;  4U0A A;  3DS5 A;  4IPY A;  1A43 A;  4DGE C;  2KOD A;  4LQW C;  4PH0 A;  5HGK A;  2M8L A;  4XFX A;  2WLV B;  4PH2 A;  4J93 A;  1GWP A;  1AUM A;  3DS3 A;  2GON A;  2KGF A;  3P05 A;  4COC A;  3G26 A;  5HGM A;  4XFY A;  2EIA A;  1P7N A;  1A8O A;  2JYL A;  3G0V A;  1M9X C;  4M0I A;  4WYM A;  1M9Y C;  2XXM A;  5HGN A;  4QNB A;  3DS4 A;  3G21 A;  4U0D A;  3DPH A;  3VRL C;  4U0C A;  5JPA A;  3DS1 A;  1EOQ A;  1G03 A;  4INB A;  4XRQ A;  1EM9 A;  1U7K A;  4PH1 A;  4COP A;  1M9E C;  2XGV A;  2XV6 A;  2L6E A;  2PWO A;  5HGO A;  2X82 A;  2Y4Z A;  1E6J P;  2PWM A;  2M8P A;  2JYG A;  3G1G A;  4PH3 A;  1L6N A;  1M9C C;  1M9D C;  2LF4 A;  3G1I A;  2XGY A;  3H4E A;  1AK4 C;  1D1D A;  3G28 A;  2X2D D;  3BP9 A; 
#chains in the Genus database with same CATH topology
 4XFZ A;  3CCS P;  3Q20 A;  2JPR A;  4MRT C;  4E92 A;  2P9X A;  1M9F C;  2AF8 A;  2MD9 A;  4CA3 A;  2K92 A;  2X83 A;  1Z6M A;  2JU1 A;  2XGU A;  1YIJ P;  2BUO A;  4U0B A;  1EIA A;  3NTE A;  2PXR C;  2KGE A;  2CQ8 A;  2LOL A;  2KG6 A;  2GDY A;  4PH0 A;  2M8L A;  4XFX A;  1ZNV A;  4DG9 A;  2KOR A;  1MZ8 A;  2KGF A;  1VQM P;  4UHP B;  3CMA P;  2KOO A;  3G6E P;  5HVC A;  1P7N A;  1RO2 A;  1A8O A;  3CC7 P;  2JYL A;  5KP7 B;  2K0D X;  3CC4 P;  3GZL A;  1M9X C;  1M9Y C;  2PNG A;  2FQ0 A;  3E2D A;  2FHS C;  1Q86 Q;  3DS4 A;  2KG9 A;  2KW2 A;  2K94 A;  1HY8 A;  3CCJ P;  1VQ9 P;  2KOS A;  1EOQ A;  1G03 A;  2GYK A;  1KD1 Q;  2FVE A;  4PH1 A;  2MR8 A;  1IMP A;  2K93 A;  2JBG A;  1E6J P;  2E1M A;  5KP6 B;  2JYG A;  1ACP A;  2N6Z A;  1M9C C;  1M9D C;  5CZD B;  2LF4 A;  1Q7Y Q;  2PEK A;  4PXH B;  3G1I A;  4H2W C;  2XGY A;  2GZE A;  2FVF A;  1AK4 C;  2N5I A;  1M6N A;  3G28 A;  2DGY A;  1X3O A;  2ERH A;  4IZ6 A;  1RNI A;  3M1M A;  2JO0 A;  3DTJ A;  1E0H A;  2M8N A;  3CCL P;  2WPT A;  3CCM P;  1F80 D;  3CE7 A;  4H2Y C;  3LRY A;  1NQ4 A;  3LMO A;  4QKO A;  5EJD A;  3RG2 A;  2MY5 A;  1AFV A;  2K2Q A;  2V4X A;  2JAZ A;  4U0E A;  4E91 A;  2GZJ A;  3G71 P;  1GPJ A;  2JQ4 A;  1VQN P;  4DGE C;  2KOD A;  4LQW C;  1GXG A;  1GWP A;  4HKG A;  1BXI A;  2K0Y A;  1VQ7 P;  5BS1 A;  2PEO A;  2GDX A;  4COC A;  1VQO P;  1QVF O;  1VHN A;  2CGQ A;  1VQP P;  1YIT P;  2CG5 B;  3G0V A;  4M0I A;  2GZF A;  2GDW A;  3GJN A;  1Q82 Q;  2LTE A;  2MF4 A;  2QNW A;  3H0D A;  4U0D A;  3DPH A;  1AF8 A;  3OW2 O;  2EG5 A;  2FQ2 A;  1VQ4 P;  2PY8 A;  2FAE A;  3U43 A;  1ZMB A;  2XV6 A;  3EJB A;  2Y4Z A;  1RO0 A;  2M8P A;  1AYI A;  1VQK P;  1M6E X;  1JJ2 O;  1UNK A;  2KGD A;  2MR7 A;  1K9M Q;  2MVV A;  4F37 A;  3H4E A;  1VQ5 P;  1D1D A;  5F2O A;  2OAR A;  2EHT A;  2KWL A;  2VLQ A;  2X2D D;  3BP9 A;  2Z46 A;  2FVA A;  1CEI A;  3H47 A;  2LPK A;  1VQ6 P;  2KGC A;  2KOQ A;  2GZI A;  2Z44 A;  4DGA C;  2LKI A;  2M5R A;  2CNR A;  2FAD A;  4BPF A;  2XT1 A;  2WLV A;  2VLP A;  2CWO A;  2XZ0 D;  2BHV A;  3DS0 A;  2JB0 A;  2L4B A;  4XRO A;  4NX4 C;  2ONT A;  3CME P;  2GZG A;  2FQ1 A;  4U0A A;  4IPY A;  1A43 A;  1IUQ A;  2FAC A;  5HGK A;  1UJZ A;  3I56 P;  2PEN A;  2WLV B;  2KG8 A;  4PH2 A;  2AVA A;  2PEJ A;  2GON A;  3CXC O;  3B4Q A;  2QEX P;  2XZ1 C;  2QA4 P;  2OTJ P;  1N8R Q;  1NJI Q;  3GKL C;  1YI2 P;  2VSQ A;  4XFY A;  3G4S P;  3HYB A;  1YJW P;  4WYM A;  1K8A Q;  2XXM A;  2PEQ A;  4QNB A;  5KP8 B;  3G21 A;  3VRL C;  4U0C A;  5JPA A;  3DS1 A;  2MVU A;  4INB A;  2KGA A;  4XRQ A;  2LL8 A;  2K0X A;  1OR5 A;  1EM9 A;  5HV8 A;  3CCQ P;  5F2K A;  7CEI A;  4COP A;  2XGV A;  1Q81 Q;  1YJ9 P;  1K73 Q;  2L22 A;  2PWM A;  2X2B A;  2JGP A;  3G1G A;  3B5I A;  3EJD A;  4H2X C;  1IMQ A;  1YHQ P;  1L0I A;  2L0Q A;  2Z45 A;  2GOL B;  2L9F A;  2N50 A;  3G29 A;  1HQB A;  2XDE A;  1BAJ A;  1M1K Q;  4NEO A;  5I4T G;  1QRJ A;  1YJN P;  1FR2 A;  4HTW A;  1DNY A;  3CPW O;  1EMV A;  5DCK A;  3MGE A;  2N6Y A;  4B4N A;  1S72 P;  5HGL A;  2N5H A;  2NO8 A;  3CCU P;  4U0F A;  1K30 A;  2K5X A;  2LML A;  1QVG O;  3GZM A;  3DS2 A;  2LIU A;  3CCV P;  3DS5 A;  5BS2 A;  4GR6 A;  2AFD A;  4J93 A;  2PEM A;  1AUM A;  3WBH A;  3DS3 A;  4PWV B;  2AFE A;  2OTL P;  1T8K A;  3CCE P;  3P05 A;  2PEI A;  3G26 A;  4R0M A;  5HGM A;  1L0H A;  2EIA A;  2VLO A;  2LIW A;  3CD6 P;  3I55 P;  5F2N A;  1M74 A;  2EFJ A;  3EJE A;  5HGN A;  2VLN A;  3HZQ A;  3CC2 P;  4BPH A;  2KOP A;  1W2B O;  2N98 A;  1M90 Q;  1U7K A;  1VQL P;  2ROQ A;  1M9E C;  4BPG A;  2L6E A;  1VKU A;  2PWO A;  5HGO A;  2X82 A;  1VQ8 P;  3NY7 B;  4GR2 A;  2JU2 A;  4PH3 A;  1KLP A;  1L6N A;  2KR5 A;  3RG6 C;  2DNW A;  2EHS A;  1GXH A;  5EW5 E;  3CCR P;  1KC8 Q;  1KQS O;  1DV5 A; 
#chains in the Genus database with same CATH homology
 2GOL B;  4XFZ A;  3G29 A;  1RNI A;  3H47 A;  3CCS P;  3M1M A;  2XDE A;  1BAJ A;  2JO0 A;  1M1K Q;  3DTJ A;  1VQ6 P;  3Q20 A;  2JPR A;  5I4T G;  1QRJ A;  4E92 A;  2M8N A;  2Z44 A;  4DGA C;  2P9X A;  1YJN P;  3CCL P;  1M9F C;  3CCM P;  4HTW A;  2XT1 A;  2WLV A;  3CPW O;  2X83 A;  5DCK A;  2CWO A;  2BHV A;  3LRY A;  3MGE A;  2XGU A;  3DS0 A;  4B4N A;  1YIJ P;  1S72 P;  2BUO A;  5HGL A;  4XRO A;  4NX4 C;  4U0B A;  2ONT A;  3CCU P;  4U0F A;  3CME P;  1AFV A;  1K30 A;  2V4X A;  1EIA A;  1QVG O;  3NTE A;  4U0E A;  4E91 A;  3DS2 A;  2PXR C;  3G71 P;  3CCV P;  4U0A A;  3DS5 A;  4IPY A;  1VQN P;  1A43 A;  5BS2 A;  4DGE C;  2KOD A;  4LQW C;  4PH0 A;  1IUQ A;  5HGK A;  2M8L A;  3I56 P;  2PEN A;  4XFX A;  2WLV B;  4GR6 A;  4PH2 A;  4J93 A;  1GWP A;  1AUM A;  2PEM A;  3WBH A;  3DS3 A;  2PEJ A;  2GON A;  3CXC O;  1VQ7 P;  5BS1 A;  2OTL P;  2QEX P;  2QA4 P;  2OTJ P;  3CCE P;  2KGF A;  3P05 A;  2PEI A;  2PEO A;  1VQM P;  1NJI Q;  3CMA P;  1N8R Q;  4COC A;  1VQO P;  1QVF O;  3G26 A;  1YI2 P;  5HGM A;  3G6E P;  1VQP P;  4XFY A;  2EIA A;  1YIT P;  1P7N A;  1RO2 A;  1A8O A;  3CC7 P;  2JYL A;  3CD6 P;  3I55 P;  3CC4 P;  3G0V A;  3G4S P;  5F2N A;  1M9X C;  3HYB A;  4M0I A;  1YJW P;  4WYM A;  1M9Y C;  1M74 A;  2EFJ A;  1K8A Q;  2XXM A;  3E2D A;  2PEQ A;  1Q86 Q;  5HGN A;  1Q82 Q;  4QNB A;  3DS4 A;  3H0D A;  3G21 A;  4U0D A;  3CCJ P;  3DPH A;  3VRL C;  1VQ9 P;  4U0C A;  5JPA A;  3DS1 A;  3HZQ A;  1EOQ A;  1G03 A;  3OW2 O;  4INB A;  4XRQ A;  1KD1 Q;  3CC2 P;  1W2B O;  2EG5 A;  1M90 Q;  1EM9 A;  1U7K A;  2PY8 A;  3CCQ P;  1VQ4 P;  1VQL P;  5F2K A;  4PH1 A;  4COP A;  1M9E C;  2XGV A;  1ZMB A;  2XV6 A;  2L6E A;  1Q81 Q;  2PWO A;  5HGO A;  2X82 A;  1VQ8 P;  2Y4Z A;  1E6J P;  1YJ9 P;  2E1M A;  1K73 Q;  2PWM A;  1RO0 A;  2M8P A;  2JYG A;  4GR2 A;  3G1G A;  4PH3 A;  3B5I A;  1L6N A;  1M9C C;  1M9D C;  1VQK P;  2LF4 A;  1Q7Y Q;  1M6E X;  2PEK A;  3RG6 C;  3G1I A;  1JJ2 O;  1K9M Q;  2XGY A;  1YHQ P;  3H4E A;  3CCR P;  1AK4 C;  1VQ5 P;  1M6N A;  1D1D A;  3G28 A;  5F2O A;  1KC8 Q;  2OAR A;  1KQS O;  2DGY A;  2Z45 A;  2X2D D;  3BP9 A;  2Z46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...