5HGMA

Hexameric hiv-1 ca in complex with datp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
202
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein P24
total genus 70
structure length 202
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgmA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgmA02
1EOQA 3G0VA 4PH2A 3H4EA 3DTJA 1G03A 4DGEC 1AFVA 5HGOA 2XT1A 1QRJA 1GWPA 3BP9A 4XRQA 4LQWC 4XFXA 4COPA 2EIAA 1D1DA 3VRLC 1AUMA 3NTEA 1EIAA 2L6EA 3DS5A 2XGVA 1U7KA 4U0CA 4B4NA 3DS1A 4NX4C 4HTWA 1E6JP 4QNBA 1EM9A 2JYLA 3LRYA 5HGLA 3P05A 2JO0A 3H47A 2GOLB 2WLVB 2X83A 1M9FC 4WYMA 2BUOA 4U0FA 5JPAA 4XROA 1L6NA 1BAJA 3DS3A 4M0IA 3DS0A 4IPYA 4U0BA 2JPRA 5HGNA 3MGEA 1A43A 1M9EC 1M9DC 2PXRC 2KGFA 4E91A 4XFZA 2M8NA 1AK4C 5I4TG 2M8LA 2ONTA 2XV6A 2XDEA 2WLVA 3G1IA 3G29A 2PWOA 4J93A 4PH0A 3G1GA 3G26A 2XXMA 2X82A 3DS2A 2KODA 2JYGA 4U0AA 1P7NA 4U0DA 2X2DD 4XFYA 2GONA 4DGAC 4COCA 2XGUA 1M9YC 2PWMA 3DS4A 5HGMA 1M9CC 3DPHA 2Y4ZA 1M9XC 4PH3A 5HGKA 2XGYA 4E92A 2M8PA 1A8OA 4PH1A 3G28A 3G21A 4INBA 2LF4A 5DCKA 2V4XA 4U0EA
chains in the Genus database with same CATH superfamily
2KWLA 1VQLP 2PENA 3E2DA 2KORA 2K92A 1YIJP 4H2YC 1KD1Q 3H4EA 2QA4P 2VLQA 2N6YA 5HGOA 1CEIA 2MR8A 2XT1A 2KG6A 3BP9A 2K2QA 4LQWC 3VRLC 1Q82Q 1Q81Q 3DS5A 2XGVA 4BPHA 1VQNP 2JBGA 2FVEA 2KR5A 3CCEP 2JQ4A 2L0QA 5KP6B 2KGCA 1E6JP 2FADA 1KLPA 2K0DX 1RO0A 2XZ0D 1AF8A 2JO0A 4DG9A 1K8AQ 2AVAA 4UHPB 4WYMA 7CEIA 4XROA 1L6NA 2QNWA 2KOOA 1UNKA 2EHSA 4IPYA 2CNRA 1ZNVA 1A43A 1W2BO 4E91A 3CCUP 2PEQA 5I4TG 2LTEA 1GXHA 2PWOA 4J93A 5HVCA 5BS1A 1Z6MA 1X3OA 2GDXA 2PNGA 2PY8A 2FQ0A 2VLOA 2GZFA 4COCA 1KC8Q 2XGUA 5HGMA 2BHVA 1KQSO 1M9CC 3DPHA 2Y4ZA 2QEXP 2KW2A 1VQ7P 2M8PA 4F37A 1QVFO 3G6EP 1VKUA 2KG8A 1MZ8A 1EOQA 2KOSA 3G0VA 4DGEC 3CXCO 5F2OA 2FAEA 3WBHA 2GZGA 1GWPA 1HY8A 2JU2A 3CC2P 5F2NA 1EIAA 2L6EA 3M1MA 1L0IA 2KGAA 2M5RA 2GZIA 3DS1A 1VQ6P 2K0XA 2K93A 3LRYA 1FR2A 2PEMA 3CMAP 2ROQA 2MD9A 1N8RQ 2GOLB 3CD6P 4BPGA 2X83A 2LL8A 1DNYA 1BAJA 4M0IA 1NQ4A 3U43A 2AFDA 4U0BA 1YI2P 2VSQA 1M9EC 1M9DC 1YITP 3EJBA 4HKGA 3G1IA 3G29A 2AF8A 2K94A 2FACA 2N5HA 1RO2A 2XXMA 3NY7B 4IZ6A 2X82A 5EJDA 3DS2A 1NJIQ 1GPJA 3CMEP 2JYGA 4U0AA 2EHTA 1S72P 4U0DA 4XFYA 4DGAC 2FVFA 2N5IA 1YJWP 1M9YC 2PWMA 3DS4A 3GJNA 1K30A 4PH3A 1M1KQ 1VHNA 3CPWO 1VQOP 1QVGO 4INBA 2LF4A 3LMOA 2L9FA 5DCKA 4U0EA 2E1MA 2MVUA 3G71P 3I55P 1JJ2O 1M6EX 3GKLC 3CCLP 3DTJA 2LMLA 1AFVA 3EJDA 2FQ1A 4XRQA 4H2XC 4XFXA 5EW5E 4COPA 2EIAA 1OR5A 2KGEA 1AUMA 1T8KA 1Q86Q 3NTEA 5HV8A 3B4QA 2WPTA 2MY5A 1GXGA 2GZJA 4U0CA 2JB0A 4HTWA 4QNBA 2PEJA 1EM9A 2FVAA 1L0HA 2JYLA 1YJ9P 3P05A 1M90Q 2CGQA 2OTLP 1M6NA 2MR7A 4U0FA 5JPAA 1Q7YQ 2XZ1C 2FHSC 2NO8A 1K73Q 2LKIA 1UJZA 2AFEA 2JPRA 5HGNA 1HQBA 2N6ZA 1VQKP 2KGFA 4XFZA 3Q20A 1AK4C 4GR2A 3CC7P 4GR6A 1YHQP 1VQ4P 2M8LA 1EMVA 2ONTA 2ERHA 2JU1A 2N98A 2XDEA 2VLPA 1VQPP 1IUQA 4QKOA 3G1GA 3G26A 4BPFA 2CWOA 3H0DA 2DNWA 5KP8B 2KODA 2P9XA 1P7NA 3CE7A 2X2DD 2GONA 1IMPA 2K5XA 1VQ5P 3RG2A 2LIWA 2KOPA 3CCMP 2CG5B 2EG5A 2GYKA 1M9XC 5HGKA 3HZQA 4R0MA 2XGYA 3CCRP 1A8OA 4PH1A 4CA3A 1IMQA 3G21A 3G4SP 2GDYA 3CCJP 4PH2A 2MF4A 4H2WC 1G03A 2FQ2A 1YJNP 2VLNA 2GDWA 2DGYA 1QRJA 3EJEA 4NEOA 3CCQP 1K9MQ 2OTJP 2X2BA 2LPKA 2KOQA 2PEIA 4PXHB 1D1DA 3HYBA 3OW2O 3GZMA 3CCVP 3I56P 1U7KA 2PEKA 2L4BA 4B4NA 4NX4C 2LOLA 5F2KA 2GZEA 5HGLA 2LIUA 1VQ9P 1DV5A 3H47A 3B5IA 2WLVB 1ZMBA 1M9FC 2BUOA 1VQMP 3CC4P 2Z45A 3DS3A 3DS0A 3MGEA 2JAZA 1VQ8P 2PXRC 3RG6C 2JGPA 2KGDA 2M8NA 2L22A 3GZLA 4MRTC 1RNIA 2EFJA 2XV6A 2Z44A 2WLVA 4PH0A 1M74A 5BS2A 4PWVB 2OARA 2MVVA 2Z46A 1E0HA 2N50A 5CZDB 2PEOA 2K0YA 1AYIA 1ACPA 2KG9A 4E92A 5KP7B 1BXIA 3G28A 2V4XA 2CQ8A 3CCSP 1F80D
chains in the Genus database with same CATH topology
3I55P 3G4SP 1JJ2O 1VQLP 2PENA 1EOQA 3E2DA 3G0VA 1M6EX 3CCJP 1YIJP 1KD1Q 4PH2A 3H4EA 3CCLP 3DTJA 2QA4P 1G03A 1YJNP 4DGEC 1AFVA 5HGOA 2DGYA 5F2OA 3CXCO 3WBHA 2XT1A 1QRJA 1GWPA 3BP9A 4XRQA 3CCQP 4LQWC 1K9MQ 2OTJP 4XFXA 4COPA 3CC2P 2EIAA 2PEIA 1D1DA 3HYBA 3VRLC 1AUMA 5F2NA 3OW2O 1Q86Q 3NTEA 1EIAA 2L6EA 3CCVP 3M1MA 1Q82Q 1Q81Q 3DS5A 2XGVA 1VQNP 3I56P 1U7KA 4U0CA 2PEKA 3CCEP 4B4NA 3DS1A 4NX4C 4HTWA 1E6JP 4QNBA 1VQ6P 2PEJA 1EM9A 5F2KA 2JYLA 3LRYA 1YJ9P 5HGLA 1RO0A 2PEMA 3P05A 1M90Q 3CMAP 1VQ9P 2JO0A 2OTLP 1N8RQ 3H47A 2GOLB 2WLVB 3B5IA 1M6NA 3CD6P 1K8AQ 2X83A 1M9FC 1ZMBA 4WYMA 2BUOA 4U0FA 5JPAA 1Q7YQ 1VQMP 3CC4P 4XROA 1L6NA 2Z45A 1BAJA 3DS3A 4M0IA 1K73Q 3DS0A 4IPYA 4U0BA 2JPRA 5HGNA 1YI2P 3MGEA 1VQ8P 1A43A 1M9EC 1VQKP 1M9DC 2PXRC 1W2BO 2KGFA 4E91A 3RG6C 1YITP 4XFZA 2M8NA 1AK4C 3Q20A 3CCUP 4GR2A 1RNIA 3CC7P 4GR6A 2EFJA 1YHQP 1VQ4P 2PEQA 2M8LA 5I4TG 2ONTA 2XV6A 2XDEA 2Z44A 2WLVA 3G1IA 3G29A 1VQPP 1IUQA 2PWOA 4J93A 4PH0A 1M74A 3G1GA 3G26A 5BS1A 5BS2A 1RO2A 2XXMA 2CWOA 2OARA 3H0DA 2X82A 3DS2A 2KODA 2P9XA 1NJIQ 3CMEP 2Z46A 2JYGA 4U0AA 2PY8A 1S72P 1P7NA 4U0DA 2X2DD 4XFYA 2GONA 4DGAC 2PEOA 4COCA 1KC8Q 1YJWP 2XGUA 1M9YC 2PWMA 3DS4A 1VQ5P 5HGMA 2BHVA 1KQSO 1M9CC 3CCMP 3DPHA 2EG5A 2Y4ZA 1M9XC 2QEXP 1K30A 4PH3A 5HGKA 3HZQA 1VQ7P 2XGYA 4E92A 3CCRP 2M8PA 1A8OA 4PH1A 1M1KQ 3CPWO 3G28A 1VQOP 1QVFO 3G21A 4INBA 2LF4A 3G6EP 5DCKA 2V4XA 1QVGO 3CCSP 4U0EA 2E1MA 3G71P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOQ A;  3G0V A;  4PH2 A;  3H4E A;  3DTJ A;  1G03 A;  4DGE C;  1AFV A;  5HGO A;  2XT1 A;  1QRJ A;  1GWP A;  3BP9 A;  4XRQ A;  4LQW C;  4XFX A;  4COP A;  2EIA A;  1D1D A;  3VRL C;  1AUM A;  3NTE A;  1EIA A;  2L6E A;  3DS5 A;  2XGV A;  1U7K A;  4U0C A;  4B4N A;  3DS1 A;  4NX4 C;  4HTW A;  1E6J P;  4QNB A;  1EM9 A;  2JYL A;  3LRY A;  5HGL A;  3P05 A;  2JO0 A;  3H47 A;  2GOL B;  2WLV B;  2X83 A;  1M9F C;  4WYM A;  2BUO A;  4U0F A;  5JPA A;  4XRO A;  1L6N A;  1BAJ A;  3DS3 A;  4M0I A;  3DS0 A;  4IPY A;  4U0B A;  2JPR A;  5HGN A;  3MGE A;  1A43 A;  1M9E C;  1M9D C;  2PXR C;  2KGF A;  4E91 A;  4XFZ A;  2M8N A;  1AK4 C;  5I4T G;  2M8L A;  2ONT A;  2XV6 A;  2XDE A;  2WLV A;  3G1I A;  3G29 A;  2PWO A;  4J93 A;  4PH0 A;  3G1G A;  3G26 A;  2XXM A;  2X82 A;  3DS2 A;  2KOD A;  2JYG A;  4U0A A;  1P7N A;  4U0D A;  2X2D D;  4XFY A;  2GON A;  4DGA C;  4COC A;  2XGU A;  1M9Y C;  2PWM A;  3DS4 A;  5HGM A;  1M9C C;  3DPH A;  2Y4Z A;  1M9X C;  4PH3 A;  5HGK A;  2XGY A;  4E92 A;  2M8P A;  1A8O A;  4PH1 A;  3G28 A;  3G21 A;  4INB A;  2LF4 A;  5DCK A;  2V4X A;  4U0E A; 
#chains in the Genus database with same CATH topology
 2KWL A;  1VQL P;  2PEN A;  3E2D A;  2KOR A;  2K92 A;  1YIJ P;  4H2Y C;  1KD1 Q;  3H4E A;  2QA4 P;  2VLQ A;  2N6Y A;  5HGO A;  1CEI A;  2MR8 A;  2XT1 A;  2KG6 A;  3BP9 A;  2K2Q A;  4LQW C;  3VRL C;  1Q82 Q;  1Q81 Q;  3DS5 A;  2XGV A;  4BPH A;  1VQN P;  2JBG A;  2FVE A;  2KR5 A;  3CCE P;  2JQ4 A;  2L0Q A;  5KP6 B;  2KGC A;  1E6J P;  2FAD A;  1KLP A;  2K0D X;  1RO0 A;  2XZ0 D;  1AF8 A;  2JO0 A;  4DG9 A;  1K8A Q;  2AVA A;  4UHP B;  4WYM A;  7CEI A;  4XRO A;  1L6N A;  2QNW A;  2KOO A;  1UNK A;  2EHS A;  4IPY A;  2CNR A;  1ZNV A;  1A43 A;  1W2B O;  4E91 A;  3CCU P;  2PEQ A;  5I4T G;  2LTE A;  1GXH A;  2PWO A;  4J93 A;  5HVC A;  5BS1 A;  1Z6M A;  1X3O A;  2GDX A;  2PNG A;  2PY8 A;  2FQ0 A;  2VLO A;  2GZF A;  4COC A;  1KC8 Q;  2XGU A;  5HGM A;  2BHV A;  1KQS O;  1M9C C;  3DPH A;  2Y4Z A;  2QEX P;  2KW2 A;  1VQ7 P;  2M8P A;  4F37 A;  1QVF O;  3G6E P;  1VKU A;  2KG8 A;  1MZ8 A;  1EOQ A;  2KOS A;  3G0V A;  4DGE C;  3CXC O;  5F2O A;  2FAE A;  3WBH A;  2GZG A;  1GWP A;  1HY8 A;  2JU2 A;  3CC2 P;  5F2N A;  1EIA A;  2L6E A;  3M1M A;  1L0I A;  2KGA A;  2M5R A;  2GZI A;  3DS1 A;  1VQ6 P;  2K0X A;  2K93 A;  3LRY A;  1FR2 A;  2PEM A;  3CMA P;  2ROQ A;  2MD9 A;  1N8R Q;  2GOL B;  3CD6 P;  4BPG A;  2X83 A;  2LL8 A;  1DNY A;  1BAJ A;  4M0I A;  1NQ4 A;  3U43 A;  2AFD A;  4U0B A;  1YI2 P;  2VSQ A;  1M9E C;  1M9D C;  1YIT P;  3EJB A;  4HKG A;  3G1I A;  3G29 A;  2AF8 A;  2K94 A;  2FAC A;  2N5H A;  1RO2 A;  2XXM A;  3NY7 B;  4IZ6 A;  2X82 A;  5EJD A;  3DS2 A;  1NJI Q;  1GPJ A;  3CME P;  2JYG A;  4U0A A;  2EHT A;  1S72 P;  4U0D A;  4XFY A;  4DGA C;  2FVF A;  2N5I A;  1YJW P;  1M9Y C;  2PWM A;  3DS4 A;  3GJN A;  1K30 A;  4PH3 A;  1M1K Q;  1VHN A;  3CPW O;  1VQO P;  1QVG O;  4INB A;  2LF4 A;  3LMO A;  2L9F A;  5DCK A;  4U0E A;  2E1M A;  2MVU A;  3G71 P;  3I55 P;  1JJ2 O;  1M6E X;  3GKL C;  3CCL P;  3DTJ A;  2LML A;  1AFV A;  3EJD A;  2FQ1 A;  4XRQ A;  4H2X C;  4XFX A;  5EW5 E;  4COP A;  2EIA A;  1OR5 A;  2KGE A;  1AUM A;  1T8K A;  1Q86 Q;  3NTE A;  5HV8 A;  3B4Q A;  2WPT A;  2MY5 A;  1GXG A;  2GZJ A;  4U0C A;  2JB0 A;  4HTW A;  4QNB A;  2PEJ A;  1EM9 A;  2FVA A;  1L0H A;  2JYL A;  1YJ9 P;  3P05 A;  1M90 Q;  2CGQ A;  2OTL P;  1M6N A;  2MR7 A;  4U0F A;  5JPA A;  1Q7Y Q;  2XZ1 C;  2FHS C;  2NO8 A;  1K73 Q;  2LKI A;  1UJZ A;  2AFE A;  2JPR A;  5HGN A;  1HQB A;  2N6Z A;  1VQK P;  2KGF A;  4XFZ A;  3Q20 A;  1AK4 C;  4GR2 A;  3CC7 P;  4GR6 A;  1YHQ P;  1VQ4 P;  2M8L A;  1EMV A;  2ONT A;  2ERH A;  2JU1 A;  2N98 A;  2XDE A;  2VLP A;  1VQP P;  1IUQ A;  4QKO A;  3G1G A;  3G26 A;  4BPF A;  2CWO A;  3H0D A;  2DNW A;  5KP8 B;  2KOD A;  2P9X A;  1P7N A;  3CE7 A;  2X2D D;  2GON A;  1IMP A;  2K5X A;  1VQ5 P;  3RG2 A;  2LIW A;  2KOP A;  3CCM P;  2CG5 B;  2EG5 A;  2GYK A;  1M9X C;  5HGK A;  3HZQ A;  4R0M A;  2XGY A;  3CCR P;  1A8O A;  4PH1 A;  4CA3 A;  1IMQ A;  3G21 A;  3G4S P;  2GDY A;  3CCJ P;  4PH2 A;  2MF4 A;  4H2W C;  1G03 A;  2FQ2 A;  1YJN P;  2VLN A;  2GDW A;  2DGY A;  1QRJ A;  3EJE A;  4NEO A;  3CCQ P;  1K9M Q;  2OTJ P;  2X2B A;  2LPK A;  2KOQ A;  2PEI A;  4PXH B;  1D1D A;  3HYB A;  3OW2 O;  3GZM A;  3CCV P;  3I56 P;  1U7K A;  2PEK A;  2L4B A;  4B4N A;  4NX4 C;  2LOL A;  5F2K A;  2GZE A;  5HGL A;  2LIU A;  1VQ9 P;  1DV5 A;  3H47 A;  3B5I A;  2WLV B;  1ZMB A;  1M9F C;  2BUO A;  1VQM P;  3CC4 P;  2Z45 A;  3DS3 A;  3DS0 A;  3MGE A;  2JAZ A;  1VQ8 P;  2PXR C;  3RG6 C;  2JGP A;  2KGD A;  2M8N A;  2L22 A;  3GZL A;  4MRT C;  1RNI A;  2EFJ A;  2XV6 A;  2Z44 A;  2WLV A;  4PH0 A;  1M74 A;  5BS2 A;  4PWV B;  2OAR A;  2MVV A;  2Z46 A;  1E0H A;  2N50 A;  5CZD B;  2PEO A;  2K0Y A;  1AYI A;  1ACP A;  2KG9 A;  4E92 A;  5KP7 B;  1BXI A;  3G28 A;  2V4X A;  2CQ8 A;  3CCS P;  1F80 D; 
#chains in the Genus database with same CATH homology
 3I55 P;  3G4S P;  1JJ2 O;  1VQL P;  2PEN A;  1EOQ A;  3E2D A;  3G0V A;  1M6E X;  3CCJ P;  1YIJ P;  1KD1 Q;  4PH2 A;  3H4E A;  3CCL P;  3DTJ A;  2QA4 P;  1G03 A;  1YJN P;  4DGE C;  1AFV A;  5HGO A;  2DGY A;  5F2O A;  3CXC O;  3WBH A;  2XT1 A;  1QRJ A;  1GWP A;  3BP9 A;  4XRQ A;  3CCQ P;  4LQW C;  1K9M Q;  2OTJ P;  4XFX A;  4COP A;  3CC2 P;  2EIA A;  2PEI A;  1D1D A;  3HYB A;  3VRL C;  1AUM A;  5F2N A;  3OW2 O;  1Q86 Q;  3NTE A;  1EIA A;  2L6E A;  3CCV P;  3M1M A;  1Q82 Q;  1Q81 Q;  3DS5 A;  2XGV A;  1VQN P;  3I56 P;  1U7K A;  4U0C A;  2PEK A;  3CCE P;  4B4N A;  3DS1 A;  4NX4 C;  4HTW A;  1E6J P;  4QNB A;  1VQ6 P;  2PEJ A;  1EM9 A;  5F2K A;  2JYL A;  3LRY A;  1YJ9 P;  5HGL A;  1RO0 A;  2PEM A;  3P05 A;  1M90 Q;  3CMA P;  1VQ9 P;  2JO0 A;  2OTL P;  1N8R Q;  3H47 A;  2GOL B;  2WLV B;  3B5I A;  1M6N A;  3CD6 P;  1K8A Q;  2X83 A;  1M9F C;  1ZMB A;  4WYM A;  2BUO A;  4U0F A;  5JPA A;  1Q7Y Q;  1VQM P;  3CC4 P;  4XRO A;  1L6N A;  2Z45 A;  1BAJ A;  3DS3 A;  4M0I A;  1K73 Q;  3DS0 A;  4IPY A;  4U0B A;  2JPR A;  5HGN A;  1YI2 P;  3MGE A;  1VQ8 P;  1A43 A;  1M9E C;  1VQK P;  1M9D C;  2PXR C;  1W2B O;  2KGF A;  4E91 A;  3RG6 C;  1YIT P;  4XFZ A;  2M8N A;  1AK4 C;  3Q20 A;  3CCU P;  4GR2 A;  1RNI A;  3CC7 P;  4GR6 A;  2EFJ A;  1YHQ P;  1VQ4 P;  2PEQ A;  2M8L A;  5I4T G;  2ONT A;  2XV6 A;  2XDE A;  2Z44 A;  2WLV A;  3G1I A;  3G29 A;  1VQP P;  1IUQ A;  2PWO A;  4J93 A;  4PH0 A;  1M74 A;  3G1G A;  3G26 A;  5BS1 A;  5BS2 A;  1RO2 A;  2XXM A;  2CWO A;  2OAR A;  3H0D A;  2X82 A;  3DS2 A;  2KOD A;  2P9X A;  1NJI Q;  3CME P;  2Z46 A;  2JYG A;  4U0A A;  2PY8 A;  1S72 P;  1P7N A;  4U0D A;  2X2D D;  4XFY A;  2GON A;  4DGA C;  2PEO A;  4COC A;  1KC8 Q;  1YJW P;  2XGU A;  1M9Y C;  2PWM A;  3DS4 A;  1VQ5 P;  5HGM A;  2BHV A;  1KQS O;  1M9C C;  3CCM P;  3DPH A;  2EG5 A;  2Y4Z A;  1M9X C;  2QEX P;  1K30 A;  4PH3 A;  5HGK A;  3HZQ A;  1VQ7 P;  2XGY A;  4E92 A;  3CCR P;  2M8P A;  1A8O A;  4PH1 A;  1M1K Q;  3CPW O;  3G28 A;  1VQO P;  1QVF O;  3G21 A;  4INB A;  2LF4 A;  3G6E P;  5DCK A;  2V4X A;  1QVG O;  3CCS P;  4U0E A;  2E1M A;  3G71 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...