5HGMA

Hexameric hiv-1 ca in complex with datp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
202
Chain Sequence
b'PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 70
structure length 202
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgmA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgmA02
3G1GA 1EOQA 2EIAA 2WLVB 2XGUA 4E92A 2GOLB 2PWMA 4INBA 3G26A 3BP9A 4COCA 5I4TG 5HGLA 1E6JP 3P05A 1QRJA 1M9EC 1A8OA 2KODA 4PH2A 4PH1A 2M8PA 4WYMA 3G21A 1M9XC 1L6NA 4HTWA 4U0FA 5HGOA 2XV6A 4XFZA 1P7NA 3DS4A 2XGYA 4IPYA 2XT1A 1G03A 2XGVA 4DGAC 1EM9A 3DS3A 3DTJA 1M9DC 2L6EA 4U0EA 2JO0A 1M9YC 2V4XA 2KGFA 2PWOA 2X82A 5DCKA 5HGMA 4U0CA 4COPA 1AFVA 2JYGA 3DS2A 1AK4C 2XDEA 4XFYA 4NX4C 3VRLC 4XRQA 2Y4ZA 1BAJA 1AUMA 3DS0A 5JPAA 3MGEA 4U0BA 5HGKA 4XROA 2JYLA 4PH0A 2X83A 1M9CC 3LRYA 2XXMA 3G28A 2M8LA 2BUOA 3H47A 2JPRA 3NTEA 4E91A 3DS5A 1GWPA 4B4NA 1EIAA 5HGNA 2M8NA 4M0IA 2WLVA 3G0VA 2X2DD 2PXRC 1U7KA 4J93A 4QNBA 3G1IA 2LF4A 3DS1A 2GONA 1D1DA 4U0DA 1M9FC 1A43A 4LQWC 3DPHA 3G29A 4PH3A 4DGEC 2ONTA 4XFXA 4U0AA 3H4EA
chains in the Genus database with same CATH superfamily
1E0HA 2LKIA 1K30A 3G26A 1CEIA 4COCA 1E6JP 2LIUA 1QRJA 2PEJA 1BXIA 4H2WC 1A8OA 2KODA 3CCMP 3HYBA 1M9XC 4HTWA 4U0FA 4BPGA 2DNWA 1GXHA 1MZ8A 1G03A 1F80D 1RNIA 3DS3A 3CMAP 4CA3A 1VQNP 3B4QA 5CZDB 2FQ1A 2K2QA 2FADA 1YI2P 3EJDA 2ROQA 2PWOA 1X3OA 3RG6C 2CGQA 4U0CA 1KC8Q 3DS2A 4UHPB 4XFYA 3CCQP 1ZMBA 2VLPA 2VLOA 1YJWP 2Y4ZA 2FQ2A 4PXHB 2GZFA 5F2NA 3LMOA 1HY8A 2QA4P 2Z44A 2EG5A 2KOQA 3LRYA 1YJNP 3G28A 2M8LA 3M1MA 3GZMA 1IUQA 1GWPA 5HV8A 2EHSA 2P9XA 3G0VA 2PXRC 1U7KA 4QNBA 3G1IA 3CCVP 1JJ2O 2FAEA 1A43A 1Q7YQ 3DPHA 4DGEC 2KOOA 2GYKA 3EJEA 3G6EP 3CCJP 1NQ4A 2CQ8A 2LTEA 4QKOA 2VLQA 1EOQA 2EIAA 4E92A 2PWMA 4INBA 2KORA 1VQ5P 5HGLA 2AVAA 3P05A 4IZ6A 2EHTA 4H2XC 1M9EC 1YHQP 4PH2A 3CC4P 4PH1A 5EW5E 4WYMA 1P7NA 2XGYA 2L4BA 1QVGO 2FQ0A 2XT1A 1EM9A 2KW2A 2L6EA 2JO0A 2PENA 2V4XA 2K0DX 2KGFA 3H0DA 3I56P 2X82A 5DCKA 1YJ9P 4R0MA 2KR5A 3NY7B 1K8AQ 1VKUA 4COPA 4DG9A 2JU1A 1DNYA 2VSQA 3VRLC 1VQ9P 3I55P 2GZJA 3OW2O 5BS1A 3DS0A 2KG8A 2K5XA 2PEIA 5JPAA 2N98A 1VQ4P 2PEOA 1Z6MA 3HZQA 4XROA 1GXGA 1Q82Q 1IMPA 2XXMA 3CPWO 4B4NA 4NEOA 1Q86Q 3CCLP 4GR2A 2M8NA 2K94A 1IMQA 1S72P 2X2DD 5KP6B 3CCSP 2LF4A 3DS1A 1D1DA 2JGPA 4U0DA 2GDWA 1M9FC 4LQWC 2MF4A 3G29A 2K93A 3CCRP 1VQKP 2FVAA 2PY8A 3U43A 1VQ8P 2ERHA 1L0IA 2N50A 3GJNA 3BP9A 1GPJA 2XZ1C 2KGCA 2L9FA 1M6EX 2K92A 4BPFA 2M8PA 3G21A 2NO8A 2XV6A 2AFDA 3DS4A 4IPYA 2Z46A 3EJBA 2L0QA 2WPTA 1AF8A 2JAZA 2KWLA 1ZNVA 5F2OA 1M1KQ 1M9YC 2PNGA 1HQBA 2GZEA 3CCEP 2Z45A 2KGDA 3B5IA 1VQ6P 1RO0A 2JU2A 1YIJP 1VQLP 1AFVA 2JYGA 2AF8A 2XDEA 2N6YA 2KG6A 2N5IA 4XRQA 2LPKA 4GR6A 2BHVA 1AUMA 2GZGA 3MGEA 4U0BA 2CNRA 2JYLA 5KP8B 4PH0A 1VQPP 3CC2P 2BUOA 3H47A 2MVUA 3DS5A 3CC7P 2FHSC 3Q20A 5F2KA 2WLVA 2LOLA 3GZLA 2MVVA 2OTJP 2GONA 2VLNA 2PEKA 1EMVA 2KGEA 4PH3A 5HVCA 1M74A 3H4EA 1M90Q 3G1GA 2KOPA 2WLVB 2XGUA 2GZIA 2GOLB 2GDXA 2MD9A 4MRTC 5I4TG 1VQMP 2LMLA 1RO2A 3CXCO 3RG2A 2KOSA 2DGYA 1KQSO 1L6NA 5HGOA 4XFZA 3CCUP 2AFEA 2XGVA 2GDYA 4DGAC 1UNKA 3DTJA 5KP7B 1YITP 1M9DC 4PWVB 2CG5B 3GKLC 1VQOP 2L22A 4U0EA 1ACPA 2JQ4A 2FVFA 2OARA 2QNWA 2KGAA 2FACA 1VHNA 2M5RA 3WBHA 2E1MA 1KLPA 2OTLP 2PEQA 2K0YA 5HGMA 4F37A 1M6NA 2N5HA 2MR8A 1OR5A 3CE7A 1AK4C 2QEXP 2JBGA 4NX4C 1DV5A 3CMEP 1KD1Q 1BAJA 7CEIA 1N8RQ 2LIWA 3CD6P 3E2DA 5HGKA 1AYIA 1VQ7P 2LL8A 3G4SP 2X83A 2EFJA 1M9CC 2FVEA 2X2BA 5EJDA 2XZ0D 1K73Q 2KG9A 1W2BO 2MY5A 2N6ZA 1UJZA 1L0HA 2JPRA 3NTEA 4E91A 1EIAA 2JB0A 5BS2A 1QVFO 2PEMA 5HGNA 1T8KA 4M0IA 2MR7A 2K0XA 1NJIQ 1K9MQ 4J93A 4BPHA 1FR2A 1Q81Q 4HKGA 3G71P 2ONTA 4H2YC 4XFXA 4U0AA 2CWOA
chains in the Genus database with same CATH topology
3G1GA 1EOQA 2EIAA 2WLVB 2XGUA 4E92A 2GOLB 2PWMA 4INBA 1K30A 3G26A 3BP9A 4COCA 5I4TG 1VQMP 1VQ5P 5HGLA 1E6JP 3P05A 1M6EX 1RO2A 1QRJA 3CXCO 2PEJA 1M9EC 1YHQP 1A8OA 2KODA 4PH2A 3CC4P 4PH1A 3CCMP 2M8PA 2DGYA 3HYBA 1KQSO 4WYMA 3G21A 1M9XC 1L6NA 4HTWA 4U0FA 5HGOA 2XV6A 4XFZA 1P7NA 3DS4A 2XGYA 4IPYA 1QVGO 3CCUP 2Z46A 2XT1A 1G03A 2XGVA 4DGAC 1EM9A 1RNIA 3DS3A 3DTJA 3CMAP 1VQNP 1YITP 1M9DC 2L6EA 1VQOP 4U0EA 2JO0A 2OARA 5F2OA 1YI2P 1M9YC 2PENA 1M1KQ 2V4XA 2KGFA 3H0DA 2PWOA 3I56P 3CCEP 3RG6C 2X82A 5DCKA 3WBHA 2E1MA 2Z45A 1YJ9P 3B5IA 2OTLP 2PEQA 1VQ6P 5HGMA 1RO0A 1K8AQ 1YIJP 1VQLP 4U0CA 1M6NA 4COPA 1AFVA 1KC8Q 2JYGA 3DS2A 1AK4C 2QEXP 2XDEA 4XFYA 3CCQP 1ZMBA 4NX4C 1YJWP 3VRLC 4XRQA 1VQ9P 3CMEP 2Y4ZA 4GR6A 1KD1Q 3I55P 3OW2O 2BHVA 1BAJA 5BS1A 1N8RQ 1AUMA 3DS0A 3CD6P 2PEIA 5JPAA 3E2DA 5F2NA 1VQ4P 3MGEA 2PEOA 4U0BA 5HGKA 3HZQA 4XROA 1VQ7P 2QA4P 2JYLA 3G4SP 2Z44A 1Q82Q 4PH0A 2X83A 1VQPP 2EG5A 2EFJA 1M9CC 3LRYA 1YJNP 3CC2P 2XXMA 3G28A 2M8LA 3M1MA 2BUOA 1K73Q 3H47A 1W2BO 2JPRA 3CPWO 3NTEA 4E91A 1IUQA 3DS5A 1GWPA 3CC7P 4B4NA 1EIAA 3Q20A 5BS2A 1QVFO 1Q86Q 3CCLP 4GR2A 2PEMA 5HGNA 2P9XA 5F2KA 2M8NA 4M0IA 2WLVA 3G0VA 1S72P 2X2DD 1NJIQ 2PXRC 3CCSP 1U7KA 1K9MQ 4J93A 4QNBA 2OTJP 3G1IA 2LF4A 1Q81Q 3DS1A 3CCVP 2GONA 1D1DA 1JJ2O 4U0DA 1M9FC 1A43A 2PEKA 4LQWC 1Q7YQ 3DPHA 3G29A 4PH3A 4DGEC 2ONTA 3G71P 3G6EP 3CCRP 1VQKP 2PY8A 4XFXA 4U0AA 2CWOA 1M74A 3CCJP 3H4EA 1M90Q 1VQ8P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1G A;  1EOQ A;  2EIA A;  2WLV B;  2XGU A;  4E92 A;  2GOL B;  2PWM A;  4INB A;  3G26 A;  3BP9 A;  4COC A;  5I4T G;  5HGL A;  1E6J P;  3P05 A;  1QRJ A;  1M9E C;  1A8O A;  2KOD A;  4PH2 A;  4PH1 A;  2M8P A;  4WYM A;  3G21 A;  1M9X C;  1L6N A;  4HTW A;  4U0F A;  5HGO A;  2XV6 A;  4XFZ A;  1P7N A;  3DS4 A;  2XGY A;  4IPY A;  2XT1 A;  1G03 A;  2XGV A;  4DGA C;  1EM9 A;  3DS3 A;  3DTJ A;  1M9D C;  2L6E A;  4U0E A;  2JO0 A;  1M9Y C;  2V4X A;  2KGF A;  2PWO A;  2X82 A;  5DCK A;  5HGM A;  4U0C A;  4COP A;  1AFV A;  2JYG A;  3DS2 A;  1AK4 C;  2XDE A;  4XFY A;  4NX4 C;  3VRL C;  4XRQ A;  2Y4Z A;  1BAJ A;  1AUM A;  3DS0 A;  5JPA A;  3MGE A;  4U0B A;  5HGK A;  4XRO A;  2JYL A;  4PH0 A;  2X83 A;  1M9C C;  3LRY A;  2XXM A;  3G28 A;  2M8L A;  2BUO A;  3H47 A;  2JPR A;  3NTE A;  4E91 A;  3DS5 A;  1GWP A;  4B4N A;  1EIA A;  5HGN A;  2M8N A;  4M0I A;  2WLV A;  3G0V A;  2X2D D;  2PXR C;  1U7K A;  4J93 A;  4QNB A;  3G1I A;  2LF4 A;  3DS1 A;  2GON A;  1D1D A;  4U0D A;  1M9F C;  1A43 A;  4LQW C;  3DPH A;  3G29 A;  4PH3 A;  4DGE C;  2ONT A;  4XFX A;  4U0A A;  3H4E A; 
#chains in the Genus database with same CATH topology
 1E0H A;  2LKI A;  1K30 A;  3G26 A;  1CEI A;  4COC A;  1E6J P;  2LIU A;  1QRJ A;  2PEJ A;  1BXI A;  4H2W C;  1A8O A;  2KOD A;  3CCM P;  3HYB A;  1M9X C;  4HTW A;  4U0F A;  4BPG A;  2DNW A;  1GXH A;  1MZ8 A;  1G03 A;  1F80 D;  1RNI A;  3DS3 A;  3CMA P;  4CA3 A;  1VQN P;  3B4Q A;  5CZD B;  2FQ1 A;  2K2Q A;  2FAD A;  1YI2 P;  3EJD A;  2ROQ A;  2PWO A;  1X3O A;  3RG6 C;  2CGQ A;  4U0C A;  1KC8 Q;  3DS2 A;  4UHP B;  4XFY A;  3CCQ P;  1ZMB A;  2VLP A;  2VLO A;  1YJW P;  2Y4Z A;  2FQ2 A;  4PXH B;  2GZF A;  5F2N A;  3LMO A;  1HY8 A;  2QA4 P;  2Z44 A;  2EG5 A;  2KOQ A;  3LRY A;  1YJN P;  3G28 A;  2M8L A;  3M1M A;  3GZM A;  1IUQ A;  1GWP A;  5HV8 A;  2EHS A;  2P9X A;  3G0V A;  2PXR C;  1U7K A;  4QNB A;  3G1I A;  3CCV P;  1JJ2 O;  2FAE A;  1A43 A;  1Q7Y Q;  3DPH A;  4DGE C;  2KOO A;  2GYK A;  3EJE A;  3G6E P;  3CCJ P;  1NQ4 A;  2CQ8 A;  2LTE A;  4QKO A;  2VLQ A;  1EOQ A;  2EIA A;  4E92 A;  2PWM A;  4INB A;  2KOR A;  1VQ5 P;  5HGL A;  2AVA A;  3P05 A;  4IZ6 A;  2EHT A;  4H2X C;  1M9E C;  1YHQ P;  4PH2 A;  3CC4 P;  4PH1 A;  5EW5 E;  4WYM A;  1P7N A;  2XGY A;  2L4B A;  1QVG O;  2FQ0 A;  2XT1 A;  1EM9 A;  2KW2 A;  2L6E A;  2JO0 A;  2PEN A;  2V4X A;  2K0D X;  2KGF A;  3H0D A;  3I56 P;  2X82 A;  5DCK A;  1YJ9 P;  4R0M A;  2KR5 A;  3NY7 B;  1K8A Q;  1VKU A;  4COP A;  4DG9 A;  2JU1 A;  1DNY A;  2VSQ A;  3VRL C;  1VQ9 P;  3I55 P;  2GZJ A;  3OW2 O;  5BS1 A;  3DS0 A;  2KG8 A;  2K5X A;  2PEI A;  5JPA A;  2N98 A;  1VQ4 P;  2PEO A;  1Z6M A;  3HZQ A;  4XRO A;  1GXG A;  1Q82 Q;  1IMP A;  2XXM A;  3CPW O;  4B4N A;  4NEO A;  1Q86 Q;  3CCL P;  4GR2 A;  2M8N A;  2K94 A;  1IMQ A;  1S72 P;  2X2D D;  5KP6 B;  3CCS P;  2LF4 A;  3DS1 A;  1D1D A;  2JGP A;  4U0D A;  2GDW A;  1M9F C;  4LQW C;  2MF4 A;  3G29 A;  2K93 A;  3CCR P;  1VQK P;  2FVA A;  2PY8 A;  3U43 A;  1VQ8 P;  2ERH A;  1L0I A;  2N50 A;  3GJN A;  3BP9 A;  1GPJ A;  2XZ1 C;  2KGC A;  2L9F A;  1M6E X;  2K92 A;  4BPF A;  2M8P A;  3G21 A;  2NO8 A;  2XV6 A;  2AFD A;  3DS4 A;  4IPY A;  2Z46 A;  3EJB A;  2L0Q A;  2WPT A;  1AF8 A;  2JAZ A;  2KWL A;  1ZNV A;  5F2O A;  1M1K Q;  1M9Y C;  2PNG A;  1HQB A;  2GZE A;  3CCE P;  2Z45 A;  2KGD A;  3B5I A;  1VQ6 P;  1RO0 A;  2JU2 A;  1YIJ P;  1VQL P;  1AFV A;  2JYG A;  2AF8 A;  2XDE A;  2N6Y A;  2KG6 A;  2N5I A;  4XRQ A;  2LPK A;  4GR6 A;  2BHV A;  1AUM A;  2GZG A;  3MGE A;  4U0B A;  2CNR A;  2JYL A;  5KP8 B;  4PH0 A;  1VQP P;  3CC2 P;  2BUO A;  3H47 A;  2MVU A;  3DS5 A;  3CC7 P;  2FHS C;  3Q20 A;  5F2K A;  2WLV A;  2LOL A;  3GZL A;  2MVV A;  2OTJ P;  2GON A;  2VLN A;  2PEK A;  1EMV A;  2KGE A;  4PH3 A;  5HVC A;  1M74 A;  3H4E A;  1M90 Q;  3G1G A;  2KOP A;  2WLV B;  2XGU A;  2GZI A;  2GOL B;  2GDX A;  2MD9 A;  4MRT C;  5I4T G;  1VQM P;  2LML A;  1RO2 A;  3CXC O;  3RG2 A;  2KOS A;  2DGY A;  1KQS O;  1L6N A;  5HGO A;  4XFZ A;  3CCU P;  2AFE A;  2XGV A;  2GDY A;  4DGA C;  1UNK A;  3DTJ A;  5KP7 B;  1YIT P;  1M9D C;  4PWV B;  2CG5 B;  3GKL C;  1VQO P;  2L22 A;  4U0E A;  1ACP A;  2JQ4 A;  2FVF A;  2OAR A;  2QNW A;  2KGA A;  2FAC A;  1VHN A;  2M5R A;  3WBH A;  2E1M A;  1KLP A;  2OTL P;  2PEQ A;  2K0Y A;  5HGM A;  4F37 A;  1M6N A;  2N5H A;  2MR8 A;  1OR5 A;  3CE7 A;  1AK4 C;  2QEX P;  2JBG A;  4NX4 C;  1DV5 A;  3CME P;  1KD1 Q;  1BAJ A;  7CEI A;  1N8R Q;  2LIW A;  3CD6 P;  3E2D A;  5HGK A;  1AYI A;  1VQ7 P;  2LL8 A;  3G4S P;  2X83 A;  2EFJ A;  1M9C C;  2FVE A;  2X2B A;  5EJD A;  2XZ0 D;  1K73 Q;  2KG9 A;  1W2B O;  2MY5 A;  2N6Z A;  1UJZ A;  1L0H A;  2JPR A;  3NTE A;  4E91 A;  1EIA A;  2JB0 A;  5BS2 A;  1QVF O;  2PEM A;  5HGN A;  1T8K A;  4M0I A;  2MR7 A;  2K0X A;  1NJI Q;  1K9M Q;  4J93 A;  4BPH A;  1FR2 A;  1Q81 Q;  4HKG A;  3G71 P;  2ONT A;  4H2Y C;  4XFX A;  4U0A A;  2CWO A; 
#chains in the Genus database with same CATH homology
 3G1G A;  1EOQ A;  2EIA A;  2WLV B;  2XGU A;  4E92 A;  2GOL B;  2PWM A;  4INB A;  1K30 A;  3G26 A;  3BP9 A;  4COC A;  5I4T G;  1VQM P;  1VQ5 P;  5HGL A;  1E6J P;  3P05 A;  1M6E X;  1RO2 A;  1QRJ A;  3CXC O;  2PEJ A;  1M9E C;  1YHQ P;  1A8O A;  2KOD A;  4PH2 A;  3CC4 P;  4PH1 A;  3CCM P;  2M8P A;  2DGY A;  3HYB A;  1KQS O;  4WYM A;  3G21 A;  1M9X C;  1L6N A;  4HTW A;  4U0F A;  5HGO A;  2XV6 A;  4XFZ A;  1P7N A;  3DS4 A;  2XGY A;  4IPY A;  1QVG O;  3CCU P;  2Z46 A;  2XT1 A;  1G03 A;  2XGV A;  4DGA C;  1EM9 A;  1RNI A;  3DS3 A;  3DTJ A;  3CMA P;  1VQN P;  1YIT P;  1M9D C;  2L6E A;  1VQO P;  4U0E A;  2JO0 A;  2OAR A;  5F2O A;  1YI2 P;  1M9Y C;  2PEN A;  1M1K Q;  2V4X A;  2KGF A;  3H0D A;  2PWO A;  3I56 P;  3CCE P;  3RG6 C;  2X82 A;  5DCK A;  3WBH A;  2E1M A;  2Z45 A;  1YJ9 P;  3B5I A;  2OTL P;  2PEQ A;  1VQ6 P;  5HGM A;  1RO0 A;  1K8A Q;  1YIJ P;  1VQL P;  4U0C A;  1M6N A;  4COP A;  1AFV A;  1KC8 Q;  2JYG A;  3DS2 A;  1AK4 C;  2QEX P;  2XDE A;  4XFY A;  3CCQ P;  1ZMB A;  4NX4 C;  1YJW P;  3VRL C;  4XRQ A;  1VQ9 P;  3CME P;  2Y4Z A;  4GR6 A;  1KD1 Q;  3I55 P;  3OW2 O;  2BHV A;  1BAJ A;  5BS1 A;  1N8R Q;  1AUM A;  3DS0 A;  3CD6 P;  2PEI A;  5JPA A;  3E2D A;  5F2N A;  1VQ4 P;  3MGE A;  2PEO A;  4U0B A;  5HGK A;  3HZQ A;  4XRO A;  1VQ7 P;  2QA4 P;  2JYL A;  3G4S P;  2Z44 A;  1Q82 Q;  4PH0 A;  2X83 A;  1VQP P;  2EG5 A;  2EFJ A;  1M9C C;  3LRY A;  1YJN P;  3CC2 P;  2XXM A;  3G28 A;  2M8L A;  3M1M A;  2BUO A;  1K73 Q;  3H47 A;  1W2B O;  2JPR A;  3CPW O;  3NTE A;  4E91 A;  1IUQ A;  3DS5 A;  1GWP A;  3CC7 P;  4B4N A;  1EIA A;  3Q20 A;  5BS2 A;  1QVF O;  1Q86 Q;  3CCL P;  4GR2 A;  2PEM A;  5HGN A;  2P9X A;  5F2K A;  2M8N A;  4M0I A;  2WLV A;  3G0V A;  1S72 P;  2X2D D;  1NJI Q;  2PXR C;  3CCS P;  1U7K A;  1K9M Q;  4J93 A;  4QNB A;  2OTJ P;  3G1I A;  2LF4 A;  1Q81 Q;  3DS1 A;  3CCV P;  2GON A;  1D1D A;  1JJ2 O;  4U0D A;  1M9F C;  1A43 A;  2PEK A;  4LQW C;  1Q7Y Q;  3DPH A;  3G29 A;  4PH3 A;  4DGE C;  2ONT A;  3G71 P;  3G6E P;  3CCR P;  1VQK P;  2PY8 A;  4XFX A;  4U0A A;  2CWO A;  1M74 A;  3CCJ P;  3H4E A;  1M90 Q;  1VQ8 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...