5HGMA

Hexameric hiv-1 ca in complex with datp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
202
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 70
structure length 202
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgmA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgmA02
2M8PA 1QRJA 5HGLA 1M9DC 4U0CA 4NX4C 3NTEA 4E92A 3G21A 1D1DA 2XGUA 4M0IA 2JYLA 2PXRC 1AFVA 2GOLB 2KGFA 3LRYA 1E6JP 1G03A 4WYMA 2Y4ZA 3G0VA 3BP9A 2WLVB 4COCA 5HGNA 4HTWA 4COPA 3G26A 4PH0A 4INBA 2XT1A 3DS1A 4XFYA 2M8NA 5DCKA 4PH2A 5HGMA 3DS3A 1EM9A 2V4XA 2LF4A 4U0AA 2XXMA 3G1GA 1A8OA 2ONTA 5I4TG 1M9EC 1EOQA 1AK4C 4U0EA 2JPRA 3H4EA 2X82A 4B4NA 4U0FA 2X83A 3H47A 5HGKA 2KODA 4IPYA 4U0BA 3DS2A 1EIAA 4E91A 2GONA 2M8LA 5HGOA 1M9FC 4LQWC 1BAJA 1P7NA 1M9XC 2PWMA 3DTJA 1GWPA 3G1IA 2XGYA 4XFXA 3VRLC 3P05A 2XDEA 3MGEA 3DS0A 1M9CC 4XRQA 4PH1A 1U7KA 3DS5A 1A43A 4J93A 2WLVA 5JPAA 3G29A 2BUOA 2EIAA 4U0DA 1L6NA 4DGAC 1AUMA 2X2DD 4DGEC 2L6EA 4PH3A 3DPHA 3G28A 2JYGA 2XGVA 4XFZA 2XV6A 4QNBA 1M9YC 2JO0A 3DS4A 4XROA 2PWOA
chains in the Genus database with same CATH superfamily
5KP6B 4U0CA 3CPWO 4NX4C 1YJNP 2Z44A 2WPTA 2AVAA 1X3OA 2KR5A 1K9MQ 1YHQP 2OTLP 3I56P 4WYMA 3G0VA 3CCRP 4HTWA 4COPA 1VQ9P 2L0QA 2M8NA 3DS3A 2N98A 2MR7A 4U0AA 1M6NA 2X2BA 3G1GA 1A8OA 2LIWA 1Q7YQ 3CC4P 5I4TG 3GJNA 1EOQA 4H2YC 1Q86Q 3G6EP 2K0YA 2N6YA 1AYIA 5HGKA 2KODA 4IPYA 1HY8A 2ERHA 1VHNA 2VSQA 2KG8A 1E0HA 1M9FC 1KQSO 4LQWC 1M9XC 3DTJA 2L9FA 5F2NA 3G1IA 2CGQA 3CCQP 2NO8A 1UJZA 2N5IA 4XFXA 3MGEA 3EJBA 1M90Q 1VQPP 2KOPA 3DS0A 2GZEA 2JGPA 1A43A 1QVGO 2M5RA 5JPAA 2CNRA 4U0DA 3GKLC 2AF8A 2VLNA 4H2XC 5KP7B 2N6ZA 1VQ7P 1L0IA 3CCVP 1YJWP 3NY7B 4XROA 3HZQA 2K92A 1KLPA 2M8PA 2PENA 2FVEA 2VLOA 2KGEA 4DG9A 2KOOA 3NTEA 1F80D 2FADA 2FQ2A 1RO2A 3G21A 2PEMA 3E2DA 1EMVA 1AFVA 2MY5A 2KGFA 2GYKA 4PXHB 3CC2P 3LRYA 1E6JP 1ZMBA 5BS2A 2WLVB 4INBA 1K73Q 5DCKA 2LIUA 2XXMA 3GZMA 3CXCO 2MVVA 2PEJA 4R0MA 1M9EC 3GZLA 2GZFA 1AK4C 3EJEA 5F2OA 4PWVB 1VQKP 3CCEP 2X83A 2KGDA 4H2WC 4E91A 1HQBA 2GONA 1KD1Q 5HGOA 1VQ5P 4QKOA 3B5IA 2N50A 1U7KA 2LMLA 3WBHA 2WLVA 3CE7A 1KC8Q 2JU1A 1JJ2O 1M74A 4HKGA 1L6NA 3G71P 1YI2P 4GR2A 1UNKA 2VLPA 1YIJP 2QNWA 4BPFA 1Q82Q 2XGVA 2XV6A 4QNBA 1CEIA 3DS4A 2LL8A 2PWOA 1DV5A 5HGLA 2GDYA 2FQ0A 2EG5A 4E92A 2K0DX 2XGUA 2JAZA 2E1MA 5KP8B 4GR6A 2PEQA 2Z45A 2GOLB 1GPJA 1AF8A 3CMAP 5CZDB 4F37A 2PNGA 1L0HA 2Y4ZA 3BP9A 2PEIA 4COCA 1IUQA 3G26A 1VQLP 4PH0A 3CCSP 3DS1A 4XFYA 4PH2A 2EHTA 3I55P 2V4XA 1VQOP 1M1KQ 2FAEA 1GXGA 2AFDA 2OARA 4U0EA 3OW2O 2JPRA 2CWOA 2P9XA 1VKUA 4B4NA 2K0XA 1NQ4A 2JB0A 3H47A 1K8AQ 2OTJP 2EHSA 3CD6P 4NEOA 2L22A 2KORA 1EIAA 2EFJA 4IZ6A 1IMPA 2QA4P 2M8LA 2FHSC 5BS1A 1BAJA 1K30A 2GDXA 2PWMA 2K94A 5HV8A 2LKIA 2JQ4A 1YITP 2XGYA 3H0DA 3CCLP 2LTEA 3CC7P 2MD9A 1M9CC 4PH1A 4XRQA 2GZGA 1RNIA 1ZNVA 2KGCA 4J93A 1YJ9P 2BUOA 3RG6C 4DGAC 1AUMA 2X2DD 4DGEC 1MZ8A 2KGAA 2KW2A 1OR5A 1VQNP 3CCUP 4PH3A 3DPHA 2JYGA 3CMEP 1T8KA 2FVFA 2K5XA 2GZJA 1M9YC 4MRTC 1QRJA 1M6EX 2MR8A 1M9DC 1VQ8P 2CQ8A 2L4BA 1D1DA 3Q20A 4M0IA 1N8RQ 1VQ6P 3U43A 2PXRC 1IMQA 5EW5E 2JU2A 1G03A 2KG6A 4CA3A 5HGNA 2MVUA 1ACPA 3CCMP 2GDWA 1VQ4P 2PEKA 2XT1A 1QVFO 2DNWA 5HGMA 2CG5B 1EM9A 2FQ1A 2LPKA 3RG2A 2LF4A 2PY8A 4BPGA 2AFEA 5F2KA 2ONTA 3CCJP 5HVCA 1GXHA 3B4QA 3LMOA 3H4EA 2X82A 4U0FA 1RO0A 2FACA 4UHPB 1Q81Q 4U0BA 1VQMP 3DS2A 2JBGA 2XZ0D 2Z46A 7CEIA 2KWLA 1DNYA 1P7NA 1GWPA 1S72P 1FR2A 5EJDA 4BPHA 1Z6MA 2MF4A 3VRLC 3P05A 2XDEA 3EJDA 2LOLA 2FVAA 3DS5A 2K2QA 3G29A 3M1MA 3G4SP 2QEXP 2K93A 1BXIA 2KOSA 2EIAA 2KOQA 2GZIA 2DGYA 2XZ1C 2L6EA 3G28A 4XFZA 3HYBA 2ROQA 2KG9A 2VLQA 2BHVA 2JO0A 2N5HA 1W2BO 1NJIQ 2PEOA 2JYLA
chains in the Genus database with same CATH topology
2M8PA 1QRJA 5HGLA 1M6EX 2PENA 1M9DC 4U0CA 1VQ8P 3CPWO 4NX4C 1YJNP 3NTEA 2EG5A 2Z44A 4E92A 1RO2A 3G21A 1D1DA 2XGUA 3Q20A 4M0IA 2E1MA 1N8RQ 1VQ6P 4GR6A 2PEMA 3E2DA 2JYLA 2PXRC 2PEQA 1AFVA 2Z45A 2GOLB 2KGFA 3CC2P 3LRYA 3CMAP 1K9MQ 1E6JP 1YHQP 2OTLP 1ZMBA 3I56P 1G03A 4WYMA 5BS2A 2Y4ZA 3G0VA 3BP9A 3CCRP 2WLVB 2PEIA 3HZQA 4COCA 5HGNA 4HTWA 1IUQA 4COPA 3G26A 3CCMP 1VQLP 4PH0A 4INBA 2PEKA 3CCSP 1VQ4P 1VQ9P 2XT1A 3DS1A 1QVFO 1K73Q 4XFYA 2M8NA 5DCKA 4PH2A 3I55P 5HGMA 3DS3A 1EM9A 2V4XA 1VQOP 1M1KQ 2LF4A 4U0AA 1M6NA 2XXMA 2PY8A 3G1GA 1A8OA 3CXCO 3CC4P 1Q7YQ 5F2KA 2ONTA 3CCJP 5I4TG 2PEJA 1M9EC 2OARA 1EOQA 1AK4C 4U0EA 3OW2O 2JPRA 2CWOA 5F2OA 1Q86Q 2P9XA 1VQKP 3H4EA 3G6EP 2X82A 4B4NA 4U0FA 3CCEP 2X83A 3H47A 1RO0A 5HGKA 2KODA 1K8AQ 2OTJP 1Q81Q 4IPYA 3CD6P 4U0BA 1VQMP 3DS2A 1EIAA 4E91A 2EFJA 2GONA 1KD1Q 2Z46A 2QA4P 2M8LA 5HGOA 1M9FC 5BS1A 1KQSO 4LQWC 1VQ5P 1BAJA 1K30A 1P7NA 1M9XC 2PWMA 3DTJA 1GWPA 5F2NA 3G1IA 1S72P 3CCQP 1YITP 2XGYA 3B5IA 3H0DA 3CCLP 4XFXA 3CC7P 3VRLC 3P05A 2XDEA 3MGEA 1M90Q 1VQPP 3DS0A 1M9CC 4XRQA 4PH1A 1U7KA 3WBHA 3DS5A 1A43A 1QVGO 1RNIA 4J93A 2WLVA 5JPAA 3G29A 3M1MA 3G4SP 2QEXP 1KC8Q 1YJ9P 2BUOA 1JJ2O 2EIAA 4U0DA 1M74A 3RG6C 1L6NA 3G71P 2DGYA 4DGAC 1AUMA 2X2DD 4DGEC 2L6EA 1YI2P 4GR2A 1VQ7P 1VQNP 3CCUP 4PH3A 3DPHA 3G28A 1YIJP 3CCVP 2JYGA 1Q82Q 2XGVA 4XFZA 3HYBA 1YJWP 3CMEP 2XV6A 4QNBA 1M9YC 2BHVA 2JO0A 3DS4A 1W2BO 1NJIQ 4XROA 2PEOA 2PWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8P A;  1QRJ A;  5HGL A;  1M9D C;  4U0C A;  4NX4 C;  3NTE A;  4E92 A;  3G21 A;  1D1D A;  2XGU A;  4M0I A;  2JYL A;  2PXR C;  1AFV A;  2GOL B;  2KGF A;  3LRY A;  1E6J P;  1G03 A;  4WYM A;  2Y4Z A;  3G0V A;  3BP9 A;  2WLV B;  4COC A;  5HGN A;  4HTW A;  4COP A;  3G26 A;  4PH0 A;  4INB A;  2XT1 A;  3DS1 A;  4XFY A;  2M8N A;  5DCK A;  4PH2 A;  5HGM A;  3DS3 A;  1EM9 A;  2V4X A;  2LF4 A;  4U0A A;  2XXM A;  3G1G A;  1A8O A;  2ONT A;  5I4T G;  1M9E C;  1EOQ A;  1AK4 C;  4U0E A;  2JPR A;  3H4E A;  2X82 A;  4B4N A;  4U0F A;  2X83 A;  3H47 A;  5HGK A;  2KOD A;  4IPY A;  4U0B A;  3DS2 A;  1EIA A;  4E91 A;  2GON A;  2M8L A;  5HGO A;  1M9F C;  4LQW C;  1BAJ A;  1P7N A;  1M9X C;  2PWM A;  3DTJ A;  1GWP A;  3G1I A;  2XGY A;  4XFX A;  3VRL C;  3P05 A;  2XDE A;  3MGE A;  3DS0 A;  1M9C C;  4XRQ A;  4PH1 A;  1U7K A;  3DS5 A;  1A43 A;  4J93 A;  2WLV A;  5JPA A;  3G29 A;  2BUO A;  2EIA A;  4U0D A;  1L6N A;  4DGA C;  1AUM A;  2X2D D;  4DGE C;  2L6E A;  4PH3 A;  3DPH A;  3G28 A;  2JYG A;  2XGV A;  4XFZ A;  2XV6 A;  4QNB A;  1M9Y C;  2JO0 A;  3DS4 A;  4XRO A;  2PWO A; 
#chains in the Genus database with same CATH topology
 5KP6 B;  4U0C A;  3CPW O;  4NX4 C;  1YJN P;  2Z44 A;  2WPT A;  2AVA A;  1X3O A;  2KR5 A;  1K9M Q;  1YHQ P;  2OTL P;  3I56 P;  4WYM A;  3G0V A;  3CCR P;  4HTW A;  4COP A;  1VQ9 P;  2L0Q A;  2M8N A;  3DS3 A;  2N98 A;  2MR7 A;  4U0A A;  1M6N A;  2X2B A;  3G1G A;  1A8O A;  2LIW A;  1Q7Y Q;  3CC4 P;  5I4T G;  3GJN A;  1EOQ A;  4H2Y C;  1Q86 Q;  3G6E P;  2K0Y A;  2N6Y A;  1AYI A;  5HGK A;  2KOD A;  4IPY A;  1HY8 A;  2ERH A;  1VHN A;  2VSQ A;  2KG8 A;  1E0H A;  1M9F C;  1KQS O;  4LQW C;  1M9X C;  3DTJ A;  2L9F A;  5F2N A;  3G1I A;  2CGQ A;  3CCQ P;  2NO8 A;  1UJZ A;  2N5I A;  4XFX A;  3MGE A;  3EJB A;  1M90 Q;  1VQP P;  2KOP A;  3DS0 A;  2GZE A;  2JGP A;  1A43 A;  1QVG O;  2M5R A;  5JPA A;  2CNR A;  4U0D A;  3GKL C;  2AF8 A;  2VLN A;  4H2X C;  5KP7 B;  2N6Z A;  1VQ7 P;  1L0I A;  3CCV P;  1YJW P;  3NY7 B;  4XRO A;  3HZQ A;  2K92 A;  1KLP A;  2M8P A;  2PEN A;  2FVE A;  2VLO A;  2KGE A;  4DG9 A;  2KOO A;  3NTE A;  1F80 D;  2FAD A;  2FQ2 A;  1RO2 A;  3G21 A;  2PEM A;  3E2D A;  1EMV A;  1AFV A;  2MY5 A;  2KGF A;  2GYK A;  4PXH B;  3CC2 P;  3LRY A;  1E6J P;  1ZMB A;  5BS2 A;  2WLV B;  4INB A;  1K73 Q;  5DCK A;  2LIU A;  2XXM A;  3GZM A;  3CXC O;  2MVV A;  2PEJ A;  4R0M A;  1M9E C;  3GZL A;  2GZF A;  1AK4 C;  3EJE A;  5F2O A;  4PWV B;  1VQK P;  3CCE P;  2X83 A;  2KGD A;  4H2W C;  4E91 A;  1HQB A;  2GON A;  1KD1 Q;  5HGO A;  1VQ5 P;  4QKO A;  3B5I A;  2N50 A;  1U7K A;  2LML A;  3WBH A;  2WLV A;  3CE7 A;  1KC8 Q;  2JU1 A;  1JJ2 O;  1M74 A;  4HKG A;  1L6N A;  3G71 P;  1YI2 P;  4GR2 A;  1UNK A;  2VLP A;  1YIJ P;  2QNW A;  4BPF A;  1Q82 Q;  2XGV A;  2XV6 A;  4QNB A;  1CEI A;  3DS4 A;  2LL8 A;  2PWO A;  1DV5 A;  5HGL A;  2GDY A;  2FQ0 A;  2EG5 A;  4E92 A;  2K0D X;  2XGU A;  2JAZ A;  2E1M A;  5KP8 B;  4GR6 A;  2PEQ A;  2Z45 A;  2GOL B;  1GPJ A;  1AF8 A;  3CMA P;  5CZD B;  4F37 A;  2PNG A;  1L0H A;  2Y4Z A;  3BP9 A;  2PEI A;  4COC A;  1IUQ A;  3G26 A;  1VQL P;  4PH0 A;  3CCS P;  3DS1 A;  4XFY A;  4PH2 A;  2EHT A;  3I55 P;  2V4X A;  1VQO P;  1M1K Q;  2FAE A;  1GXG A;  2AFD A;  2OAR A;  4U0E A;  3OW2 O;  2JPR A;  2CWO A;  2P9X A;  1VKU A;  4B4N A;  2K0X A;  1NQ4 A;  2JB0 A;  3H47 A;  1K8A Q;  2OTJ P;  2EHS A;  3CD6 P;  4NEO A;  2L22 A;  2KOR A;  1EIA A;  2EFJ A;  4IZ6 A;  1IMP A;  2QA4 P;  2M8L A;  2FHS C;  5BS1 A;  1BAJ A;  1K30 A;  2GDX A;  2PWM A;  2K94 A;  5HV8 A;  2LKI A;  2JQ4 A;  1YIT P;  2XGY A;  3H0D A;  3CCL P;  2LTE A;  3CC7 P;  2MD9 A;  1M9C C;  4PH1 A;  4XRQ A;  2GZG A;  1RNI A;  1ZNV A;  2KGC A;  4J93 A;  1YJ9 P;  2BUO A;  3RG6 C;  4DGA C;  1AUM A;  2X2D D;  4DGE C;  1MZ8 A;  2KGA A;  2KW2 A;  1OR5 A;  1VQN P;  3CCU P;  4PH3 A;  3DPH A;  2JYG A;  3CME P;  1T8K A;  2FVF A;  2K5X A;  2GZJ A;  1M9Y C;  4MRT C;  1QRJ A;  1M6E X;  2MR8 A;  1M9D C;  1VQ8 P;  2CQ8 A;  2L4B A;  1D1D A;  3Q20 A;  4M0I A;  1N8R Q;  1VQ6 P;  3U43 A;  2PXR C;  1IMQ A;  5EW5 E;  2JU2 A;  1G03 A;  2KG6 A;  4CA3 A;  5HGN A;  2MVU A;  1ACP A;  3CCM P;  2GDW A;  1VQ4 P;  2PEK A;  2XT1 A;  1QVF O;  2DNW A;  5HGM A;  2CG5 B;  1EM9 A;  2FQ1 A;  2LPK A;  3RG2 A;  2LF4 A;  2PY8 A;  4BPG A;  2AFE A;  5F2K A;  2ONT A;  3CCJ P;  5HVC A;  1GXH A;  3B4Q A;  3LMO A;  3H4E A;  2X82 A;  4U0F A;  1RO0 A;  2FAC A;  4UHP B;  1Q81 Q;  4U0B A;  1VQM P;  3DS2 A;  2JBG A;  2XZ0 D;  2Z46 A;  7CEI A;  2KWL A;  1DNY A;  1P7N A;  1GWP A;  1S72 P;  1FR2 A;  5EJD A;  4BPH A;  1Z6M A;  2MF4 A;  3VRL C;  3P05 A;  2XDE A;  3EJD A;  2LOL A;  2FVA A;  3DS5 A;  2K2Q A;  3G29 A;  3M1M A;  3G4S P;  2QEX P;  2K93 A;  1BXI A;  2KOS A;  2EIA A;  2KOQ A;  2GZI A;  2DGY A;  2XZ1 C;  2L6E A;  3G28 A;  4XFZ A;  3HYB A;  2ROQ A;  2KG9 A;  2VLQ A;  2BHV A;  2JO0 A;  2N5H A;  1W2B O;  1NJI Q;  2PEO A;  2JYL A; 
#chains in the Genus database with same CATH homology
 2M8P A;  1QRJ A;  5HGL A;  1M6E X;  2PEN A;  1M9D C;  4U0C A;  1VQ8 P;  3CPW O;  4NX4 C;  1YJN P;  3NTE A;  2EG5 A;  2Z44 A;  4E92 A;  1RO2 A;  3G21 A;  1D1D A;  2XGU A;  3Q20 A;  4M0I A;  2E1M A;  1N8R Q;  1VQ6 P;  4GR6 A;  2PEM A;  3E2D A;  2JYL A;  2PXR C;  2PEQ A;  1AFV A;  2Z45 A;  2GOL B;  2KGF A;  3CC2 P;  3LRY A;  3CMA P;  1K9M Q;  1E6J P;  1YHQ P;  2OTL P;  1ZMB A;  3I56 P;  1G03 A;  4WYM A;  5BS2 A;  2Y4Z A;  3G0V A;  3BP9 A;  3CCR P;  2WLV B;  2PEI A;  3HZQ A;  4COC A;  5HGN A;  4HTW A;  1IUQ A;  4COP A;  3G26 A;  3CCM P;  1VQL P;  4PH0 A;  4INB A;  2PEK A;  3CCS P;  1VQ4 P;  1VQ9 P;  2XT1 A;  3DS1 A;  1QVF O;  1K73 Q;  4XFY A;  2M8N A;  5DCK A;  4PH2 A;  3I55 P;  5HGM A;  3DS3 A;  1EM9 A;  2V4X A;  1VQO P;  1M1K Q;  2LF4 A;  4U0A A;  1M6N A;  2XXM A;  2PY8 A;  3G1G A;  1A8O A;  3CXC O;  3CC4 P;  1Q7Y Q;  5F2K A;  2ONT A;  3CCJ P;  5I4T G;  2PEJ A;  1M9E C;  2OAR A;  1EOQ A;  1AK4 C;  4U0E A;  3OW2 O;  2JPR A;  2CWO A;  5F2O A;  1Q86 Q;  2P9X A;  1VQK P;  3H4E A;  3G6E P;  2X82 A;  4B4N A;  4U0F A;  3CCE P;  2X83 A;  3H47 A;  1RO0 A;  5HGK A;  2KOD A;  1K8A Q;  2OTJ P;  1Q81 Q;  4IPY A;  3CD6 P;  4U0B A;  1VQM P;  3DS2 A;  1EIA A;  4E91 A;  2EFJ A;  2GON A;  1KD1 Q;  2Z46 A;  2QA4 P;  2M8L A;  5HGO A;  1M9F C;  5BS1 A;  1KQS O;  4LQW C;  1VQ5 P;  1BAJ A;  1K30 A;  1P7N A;  1M9X C;  2PWM A;  3DTJ A;  1GWP A;  5F2N A;  3G1I A;  1S72 P;  3CCQ P;  1YIT P;  2XGY A;  3B5I A;  3H0D A;  3CCL P;  4XFX A;  3CC7 P;  3VRL C;  3P05 A;  2XDE A;  3MGE A;  1M90 Q;  1VQP P;  3DS0 A;  1M9C C;  4XRQ A;  4PH1 A;  1U7K A;  3WBH A;  3DS5 A;  1A43 A;  1QVG O;  1RNI A;  4J93 A;  2WLV A;  5JPA A;  3G29 A;  3M1M A;  3G4S P;  2QEX P;  1KC8 Q;  1YJ9 P;  2BUO A;  1JJ2 O;  2EIA A;  4U0D A;  1M74 A;  3RG6 C;  1L6N A;  3G71 P;  2DGY A;  4DGA C;  1AUM A;  2X2D D;  4DGE C;  2L6E A;  1YI2 P;  4GR2 A;  1VQ7 P;  1VQN P;  3CCU P;  4PH3 A;  3DPH A;  3G28 A;  1YIJ P;  3CCV P;  2JYG A;  1Q82 Q;  2XGV A;  4XFZ A;  3HYB A;  1YJW P;  3CME P;  2XV6 A;  4QNB A;  1M9Y C;  2BHV A;  2JO0 A;  3DS4 A;  1W2B O;  1NJI Q;  4XRO A;  2PEO A;  2PWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...