5HGMA

Hexameric hiv-1 ca in complex with datp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
202
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 70
structure length 202
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgmA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgmA02
4U0EA 3P05A 4LQWC 3DPHA 1QRJA 3G26A 4XRQA 3DS1A 3DS5A 1EIAA 4J93A 5I4TG 4INBA 4M0IA 4U0CA 2WLVA 3DS4A 3G29A 4U0FA 2XXMA 3G21A 4U0DA 3DS2A 4PH2A 1L6NA 1U7KA 2XV6A 1M9YC 3G28A 4E92A 1G03A 1M9FC 3G0VA 4PH3A 2WLVB 3H4EA 4HTWA 3VRLC 2M8PA 2XGYA 2PWMA 2BUOA 4PH0A 2V4XA 2JO0A 2KGFA 2GONA 3DTJA 2L6EA 3H47A 3BP9A 1M9DC 4XROA 1D1DA 5JPAA 5HGMA 1AK4C 2PXRC 4WYMA 4PH1A 4QNBA 5DCKA 2X83A 1AUMA 2JYGA 4XFYA 4E91A 1BAJA 1A8OA 5HGLA 2ONTA 5HGNA 2M8LA 2M8NA 3G1GA 1M9XC 3G1IA 2EIAA 4DGAC 2X82A 1P7NA 5HGOA 3MGEA 1GWPA 4DGEC 4COCA 2GOLB 3DS3A 2XT1A 4XFZA 3NTEA 4U0AA 4COPA 1E6JP 2XDEA 2XGVA 4NX4C 2KODA 1M9EC 1M9CC 1EM9A 2JPRA 3LRYA 2XGUA 1A43A 3DS0A 4U0BA 4XFXA 2LF4A 2PWOA 4B4NA 2X2DD 1EOQA 5HGKA 2JYLA 4IPYA 2Y4ZA 1AFVA
chains in the Genus database with same CATH superfamily
3EJDA 2VLPA 1YJ9P 2OTJP 3NY7B 5BS1A 2FVEA 3GZMA 1EIAA 4J93A 1MZ8A 5I4TG 2N6ZA 4M0IA 2CGQA 2LTEA 1VQ6P 3G29A 2WLVA 3DS4A 1DNYA 2LIUA 1K9MQ 1ACPA 4PH2A 2EHTA 1L6NA 2FHSC 1ZNVA 1T8KA 1M9FC 3HYBA 2AF8A 1GPJA 4HTWA 2FAEA 2JO0A 3B5IA 2CWOA 3LMOA 4QKOA 3DTJA 1M6NA 2EG5A 1GXGA 1YI2P 1YJWP 1M9DC 2NO8A 1VKUA 5HGMA 4WYMA 4PH1A 2KORA 4QNBA 2QEXP 5DCKA 2JYGA 4H2YC 2ONTA 5KP8B 2PEIA 3G1GA 2GZJA 1M90Q 2X2BA 3G1IA 2EIAA 1Q82Q 2JU1A 3MGEA 2PEQA 2K92A 4XFZA 3NTEA 4U0AA 1IMQA 1VQLP 2XDEA 2XGVA 2FVAA 4BPGA 2XGUA 1A43A 2K0XA 1F80D 2Z45A 2PWOA 2CNRA 5HV8A 1E0HA 1ZMBA 1AF8A 2KOQA 1AFVA 1HY8A 1HQBA 1NQ4A 5CZDB 4LQWC 3DPHA 5EJDA 3G26A 2KR5A 4XRQA 2KGCA 1L0IA 3G71P 2K0YA 1VQNP 4F37A 2MR8A 3EJEA 2FADA 3OW2O 3RG6C 4U0FA 4GR2A 4DG9A 2GZIA 2VLQA 3G28A 1G03A 2GZEA 3VRLC 2M8PA 1JJ2O 2PEOA 2BHVA 2QNWA 2KGFA 1M6EX 2JGPA 2N6YA 2GDYA 1NJIQ 3BP9A 1IUQA 2KOPA 5F2NA 2OTLP 1D1DA 1AK4C 1Z6MA 2MVVA 3CCQP 1CEIA 2DGYA 4IZ6A 2K5XA 2X83A 4XFYA 4BPHA 1W2BO 2M8LA 2JQ4A 5KP7B 3CMEP 1M9XC 2EHSA 2N5IA 1Q81Q 1QVGO 1VQ9P 2KGEA 5HGOA 3GJNA 4COCA 2LMLA 2PEKA 1E6JP 1DV5A 2LPKA 2PY8A 1M9CC 2L22A 2MVUA 2P9XA 2PNGA 1K30A 4H2WC 3CCVP 3DS0A 4XFXA 4HKGA 2FVFA 1EOQA 5HGKA 2JYLA 3CCSP 2LOLA 3E2DA 2Y4ZA 1Q7YQ 2GZFA 2Z46A 1QRJA 3CE7A 2Z44A 2KW2A 2KWLA 3CCJP 2KOOA 2MD9A 5F2KA 1IMPA 2L0QA 3WBHA 2LL8A 2XXMA 3G21A 2DNWA 2KG9A 1YIJP 2GZGA 2PEJA 4GR6A 3DS2A 1BXIA 2XV6A 1M9YC 3H4EA 2XGYA 2VSQA 2PWMA 4PH0A 2KGDA 2V4XA 2EFJA 2GDXA 2K94A 4MRTC 2L6EA 2AVAA 2JU2A 1UJZA 1VQPP 2CQ8A 4XROA 4NEOA 4CA3A 5JPAA 2PXRC 1RNIA 3CMAP 1VQMP 4PWVB 2XZ0D 3GZLA 4E91A 1BAJA 2GDWA 1A8OA 2M8NA 2AFEA 5HVCA 1Q86Q 4DGAC 3CC4P 1P7NA 1FR2A 2E1MA 1N8RQ 4DGEC 2PENA 3RG2A 1KQSO 2XT1A 1VQ8P 2L4BA 2L9FA 2KODA 1M9EC 1EM9A 2JPRA 1UNKA 3G4SP 3CCMP 3LRYA 4U0BA 2K93A 1QVFO 2LF4A 1YJNP 2X2DD 3G6EP 2FQ1A 2K2QA 3CCUP 2KG8A 2LIWA 2FQ0A 1M1KQ 2LKIA 2KGAA 4U0EA 3P05A 5BS2A 5KP6B 3CCLP 4PXHB 2QA4P 1VHNA 2VLNA 3CD6P 3DS1A 3DS5A 1K8AQ 2GYKA 4INBA 3U43A 1VQ4P 3GKLC 2K0DX 4U0CA 2FACA 2MY5A 4U0DA 2XZ1C 5F2OA 2WPTA 1RO0A 1U7KA 3HZQA 4E92A 3G0VA 4PH3A 2WLVB 1K73Q 3CPWO 2BUOA 1YITP 1VQKP 2N50A 1EMVA 1S72P 1KD1Q 2OARA 3Q20A 2KOSA 3I56P 2GONA 2JAZA 2N5HA 3H47A 1X3OA 2ROQA 3CC2P 3EJBA 1M74A 3I55P 3CXCO 1AUMA 3M1MA 1VQ5P 1GXHA 2M5RA 1RO2A 1YHQP 3H0DA 2MR7A 5HGLA 5HGNA 3B4QA 1L0HA 1VQ7P 2PEMA 2MF4A 2X82A 2AFDA 1GWPA 1AYIA 5EW5E 2FQ2A 4H2XC 2GOLB 3DS3A 2KG6A 2VLOA 2JB0A 4COPA 7CEIA 2N98A 4BPFA 4NX4C 1KLPA 1KC8Q 4R0MA 2CG5B 1OR5A 3CCRP 3CCEP 4B4NA 2JBGA 2ERHA 4IPYA 4UHPB 1VQOP 3CC7P
chains in the Genus database with same CATH topology
4U0EA 3P05A 1YJ9P 5BS2A 1Q7YQ 2OTJP 4LQWC 3CCLP 3DPHA 2Z46A 5BS1A 1QRJA 3G26A 2QA4P 4XRQA 2Z44A 3CD6P 3DS1A 3DS5A 1EIAA 4J93A 1K8AQ 3G71P 5I4TG 4INBA 4M0IA 3CCJP 1VQ4P 1VQNP 5F2KA 3OW2O 4U0CA 2WLVA 3DS4A 3G29A 3RG6C 1VQ6P 4U0FA 4GR2A 3WBHA 2XXMA 3G21A 4U0DA 1YIJP 1K9MQ 2PEJA 4GR6A 3DS2A 4PH2A 1L6NA 5F2OA 1RO0A 1U7KA 2XV6A 1M9YC 3G28A 3HZQA 4E92A 1G03A 1M9FC 3G0VA 4PH3A 3HYBA 2WLVB 1K73Q 3H4EA 4HTWA 3VRLC 2M8PA 2XGYA 2PWMA 2BUOA 4PH0A 2PEOA 2BHVA 3CPWO 1YITP 1JJ2O 2V4XA 2EFJA 1VQKP 2JO0A 1S72P 1KD1Q 2OARA 3B5IA 2KGFA 1M6EX 3Q20A 2CWOA 3I56P 2GONA 3DTJA 1M6NA 2L6EA 3H47A 2EG5A 1NJIQ 1YI2P 3BP9A 1VQPP 1YJWP 1M9DC 3CC2P 1IUQA 4XROA 5F2NA 2OTLP 1D1DA 5JPAA 5HGMA 1AK4C 2PXRC 4WYMA 1M74A 1RNIA 4PH1A 3I55P 3CMAP 3CCQP 1VQMP 4QNBA 2QEXP 2DGYA 3CXCO 5DCKA 2X83A 1AUMA 3M1MA 2JYGA 4XFYA 4E91A 1BAJA 1VQ5P 1A8OA 1RO2A 1YHQP 3H0DA 5HGLA 2ONTA 5HGNA 1W2BO 2M8LA 2PEIA 2M8NA 3G1GA 1M9XC 3CMEP 1M90Q 1Q81Q 1QVGO 1VQ9P 3G1IA 2EIAA 1Q86Q 2PEMA 1VQ7P 4DGAC 3CC4P 2X82A 1Q82Q 1P7NA 5HGOA 3MGEA 2E1MA 1GWPA 2PEQA 1N8RQ 4DGEC 4COCA 2GOLB 2PENA 3DS3A 1KQSO 2XT1A 4XFZA 3NTEA 4U0AA 1VQ8P 2PEKA 4COPA 1VQLP 1E6JP 2XDEA 2XGVA 4NX4C 2KODA 2PY8A 1M9EC 1M9CC 1KC8Q 1EM9A 2JPRA 3G4SP 3CCMP 2P9XA 1K30A 3CCVP 3LRYA 2XGUA 1A43A 3DS0A 4U0BA 4XFXA 2Z45A 2LF4A 3CCRP 2PWOA 4B4NA 2X2DD 1YJNP 3CCEP 1QVFO 3G6EP 1EOQA 1ZMBA 5HGKA 2JYLA 4IPYA 3CCSP 3CCUP 1VQOP 3E2DA 2Y4ZA 1AFVA 3CC7P 1M1KQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0E A;  3P05 A;  4LQW C;  3DPH A;  1QRJ A;  3G26 A;  4XRQ A;  3DS1 A;  3DS5 A;  1EIA A;  4J93 A;  5I4T G;  4INB A;  4M0I A;  4U0C A;  2WLV A;  3DS4 A;  3G29 A;  4U0F A;  2XXM A;  3G21 A;  4U0D A;  3DS2 A;  4PH2 A;  1L6N A;  1U7K A;  2XV6 A;  1M9Y C;  3G28 A;  4E92 A;  1G03 A;  1M9F C;  3G0V A;  4PH3 A;  2WLV B;  3H4E A;  4HTW A;  3VRL C;  2M8P A;  2XGY A;  2PWM A;  2BUO A;  4PH0 A;  2V4X A;  2JO0 A;  2KGF A;  2GON A;  3DTJ A;  2L6E A;  3H47 A;  3BP9 A;  1M9D C;  4XRO A;  1D1D A;  5JPA A;  5HGM A;  1AK4 C;  2PXR C;  4WYM A;  4PH1 A;  4QNB A;  5DCK A;  2X83 A;  1AUM A;  2JYG A;  4XFY A;  4E91 A;  1BAJ A;  1A8O A;  5HGL A;  2ONT A;  5HGN A;  2M8L A;  2M8N A;  3G1G A;  1M9X C;  3G1I A;  2EIA A;  4DGA C;  2X82 A;  1P7N A;  5HGO A;  3MGE A;  1GWP A;  4DGE C;  4COC A;  2GOL B;  3DS3 A;  2XT1 A;  4XFZ A;  3NTE A;  4U0A A;  4COP A;  1E6J P;  2XDE A;  2XGV A;  4NX4 C;  2KOD A;  1M9E C;  1M9C C;  1EM9 A;  2JPR A;  3LRY A;  2XGU A;  1A43 A;  3DS0 A;  4U0B A;  4XFX A;  2LF4 A;  2PWO A;  4B4N A;  2X2D D;  1EOQ A;  5HGK A;  2JYL A;  4IPY A;  2Y4Z A;  1AFV A; 
#chains in the Genus database with same CATH topology
 3EJD A;  2VLP A;  1YJ9 P;  2OTJ P;  3NY7 B;  5BS1 A;  2FVE A;  3GZM A;  1EIA A;  4J93 A;  1MZ8 A;  5I4T G;  2N6Z A;  4M0I A;  2CGQ A;  2LTE A;  1VQ6 P;  3G29 A;  2WLV A;  3DS4 A;  1DNY A;  2LIU A;  1K9M Q;  1ACP A;  4PH2 A;  2EHT A;  1L6N A;  2FHS C;  1ZNV A;  1T8K A;  1M9F C;  3HYB A;  2AF8 A;  1GPJ A;  4HTW A;  2FAE A;  2JO0 A;  3B5I A;  2CWO A;  3LMO A;  4QKO A;  3DTJ A;  1M6N A;  2EG5 A;  1GXG A;  1YI2 P;  1YJW P;  1M9D C;  2NO8 A;  1VKU A;  5HGM A;  4WYM A;  4PH1 A;  2KOR A;  4QNB A;  2QEX P;  5DCK A;  2JYG A;  4H2Y C;  2ONT A;  5KP8 B;  2PEI A;  3G1G A;  2GZJ A;  1M90 Q;  2X2B A;  3G1I A;  2EIA A;  1Q82 Q;  2JU1 A;  3MGE A;  2PEQ A;  2K92 A;  4XFZ A;  3NTE A;  4U0A A;  1IMQ A;  1VQL P;  2XDE A;  2XGV A;  2FVA A;  4BPG A;  2XGU A;  1A43 A;  2K0X A;  1F80 D;  2Z45 A;  2PWO A;  2CNR A;  5HV8 A;  1E0H A;  1ZMB A;  1AF8 A;  2KOQ A;  1AFV A;  1HY8 A;  1HQB A;  1NQ4 A;  5CZD B;  4LQW C;  3DPH A;  5EJD A;  3G26 A;  2KR5 A;  4XRQ A;  2KGC A;  1L0I A;  3G71 P;  2K0Y A;  1VQN P;  4F37 A;  2MR8 A;  3EJE A;  2FAD A;  3OW2 O;  3RG6 C;  4U0F A;  4GR2 A;  4DG9 A;  2GZI A;  2VLQ A;  3G28 A;  1G03 A;  2GZE A;  3VRL C;  2M8P A;  1JJ2 O;  2PEO A;  2BHV A;  2QNW A;  2KGF A;  1M6E X;  2JGP A;  2N6Y A;  2GDY A;  1NJI Q;  3BP9 A;  1IUQ A;  2KOP A;  5F2N A;  2OTL P;  1D1D A;  1AK4 C;  1Z6M A;  2MVV A;  3CCQ P;  1CEI A;  2DGY A;  4IZ6 A;  2K5X A;  2X83 A;  4XFY A;  4BPH A;  1W2B O;  2M8L A;  2JQ4 A;  5KP7 B;  3CME P;  1M9X C;  2EHS A;  2N5I A;  1Q81 Q;  1QVG O;  1VQ9 P;  2KGE A;  5HGO A;  3GJN A;  4COC A;  2LML A;  2PEK A;  1E6J P;  1DV5 A;  2LPK A;  2PY8 A;  1M9C C;  2L22 A;  2MVU A;  2P9X A;  2PNG A;  1K30 A;  4H2W C;  3CCV P;  3DS0 A;  4XFX A;  4HKG A;  2FVF A;  1EOQ A;  5HGK A;  2JYL A;  3CCS P;  2LOL A;  3E2D A;  2Y4Z A;  1Q7Y Q;  2GZF A;  2Z46 A;  1QRJ A;  3CE7 A;  2Z44 A;  2KW2 A;  2KWL A;  3CCJ P;  2KOO A;  2MD9 A;  5F2K A;  1IMP A;  2L0Q A;  3WBH A;  2LL8 A;  2XXM A;  3G21 A;  2DNW A;  2KG9 A;  1YIJ P;  2GZG A;  2PEJ A;  4GR6 A;  3DS2 A;  1BXI A;  2XV6 A;  1M9Y C;  3H4E A;  2XGY A;  2VSQ A;  2PWM A;  4PH0 A;  2KGD A;  2V4X A;  2EFJ A;  2GDX A;  2K94 A;  4MRT C;  2L6E A;  2AVA A;  2JU2 A;  1UJZ A;  1VQP P;  2CQ8 A;  4XRO A;  4NEO A;  4CA3 A;  5JPA A;  2PXR C;  1RNI A;  3CMA P;  1VQM P;  4PWV B;  2XZ0 D;  3GZL A;  4E91 A;  1BAJ A;  2GDW A;  1A8O A;  2M8N A;  2AFE A;  5HVC A;  1Q86 Q;  4DGA C;  3CC4 P;  1P7N A;  1FR2 A;  2E1M A;  1N8R Q;  4DGE C;  2PEN A;  3RG2 A;  1KQS O;  2XT1 A;  1VQ8 P;  2L4B A;  2L9F A;  2KOD A;  1M9E C;  1EM9 A;  2JPR A;  1UNK A;  3G4S P;  3CCM P;  3LRY A;  4U0B A;  2K93 A;  1QVF O;  2LF4 A;  1YJN P;  2X2D D;  3G6E P;  2FQ1 A;  2K2Q A;  3CCU P;  2KG8 A;  2LIW A;  2FQ0 A;  1M1K Q;  2LKI A;  2KGA A;  4U0E A;  3P05 A;  5BS2 A;  5KP6 B;  3CCL P;  4PXH B;  2QA4 P;  1VHN A;  2VLN A;  3CD6 P;  3DS1 A;  3DS5 A;  1K8A Q;  2GYK A;  4INB A;  3U43 A;  1VQ4 P;  3GKL C;  2K0D X;  4U0C A;  2FAC A;  2MY5 A;  4U0D A;  2XZ1 C;  5F2O A;  2WPT A;  1RO0 A;  1U7K A;  3HZQ A;  4E92 A;  3G0V A;  4PH3 A;  2WLV B;  1K73 Q;  3CPW O;  2BUO A;  1YIT P;  1VQK P;  2N50 A;  1EMV A;  1S72 P;  1KD1 Q;  2OAR A;  3Q20 A;  2KOS A;  3I56 P;  2GON A;  2JAZ A;  2N5H A;  3H47 A;  1X3O A;  2ROQ A;  3CC2 P;  3EJB A;  1M74 A;  3I55 P;  3CXC O;  1AUM A;  3M1M A;  1VQ5 P;  1GXH A;  2M5R A;  1RO2 A;  1YHQ P;  3H0D A;  2MR7 A;  5HGL A;  5HGN A;  3B4Q A;  1L0H A;  1VQ7 P;  2PEM A;  2MF4 A;  2X82 A;  2AFD A;  1GWP A;  1AYI A;  5EW5 E;  2FQ2 A;  4H2X C;  2GOL B;  3DS3 A;  2KG6 A;  2VLO A;  2JB0 A;  4COP A;  7CEI A;  2N98 A;  4BPF A;  4NX4 C;  1KLP A;  1KC8 Q;  4R0M A;  2CG5 B;  1OR5 A;  3CCR P;  3CCE P;  4B4N A;  2JBG A;  2ERH A;  4IPY A;  4UHP B;  1VQO P;  3CC7 P; 
#chains in the Genus database with same CATH homology
 4U0E A;  3P05 A;  1YJ9 P;  5BS2 A;  1Q7Y Q;  2OTJ P;  4LQW C;  3CCL P;  3DPH A;  2Z46 A;  5BS1 A;  1QRJ A;  3G26 A;  2QA4 P;  4XRQ A;  2Z44 A;  3CD6 P;  3DS1 A;  3DS5 A;  1EIA A;  4J93 A;  1K8A Q;  3G71 P;  5I4T G;  4INB A;  4M0I A;  3CCJ P;  1VQ4 P;  1VQN P;  5F2K A;  3OW2 O;  4U0C A;  2WLV A;  3DS4 A;  3G29 A;  3RG6 C;  1VQ6 P;  4U0F A;  4GR2 A;  3WBH A;  2XXM A;  3G21 A;  4U0D A;  1YIJ P;  1K9M Q;  2PEJ A;  4GR6 A;  3DS2 A;  4PH2 A;  1L6N A;  5F2O A;  1RO0 A;  1U7K A;  2XV6 A;  1M9Y C;  3G28 A;  3HZQ A;  4E92 A;  1G03 A;  1M9F C;  3G0V A;  4PH3 A;  3HYB A;  2WLV B;  1K73 Q;  3H4E A;  4HTW A;  3VRL C;  2M8P A;  2XGY A;  2PWM A;  2BUO A;  4PH0 A;  2PEO A;  2BHV A;  3CPW O;  1YIT P;  1JJ2 O;  2V4X A;  2EFJ A;  1VQK P;  2JO0 A;  1S72 P;  1KD1 Q;  2OAR A;  3B5I A;  2KGF A;  1M6E X;  3Q20 A;  2CWO A;  3I56 P;  2GON A;  3DTJ A;  1M6N A;  2L6E A;  3H47 A;  2EG5 A;  1NJI Q;  1YI2 P;  3BP9 A;  1VQP P;  1YJW P;  1M9D C;  3CC2 P;  1IUQ A;  4XRO A;  5F2N A;  2OTL P;  1D1D A;  5JPA A;  5HGM A;  1AK4 C;  2PXR C;  4WYM A;  1M74 A;  1RNI A;  4PH1 A;  3I55 P;  3CMA P;  3CCQ P;  1VQM P;  4QNB A;  2QEX P;  2DGY A;  3CXC O;  5DCK A;  2X83 A;  1AUM A;  3M1M A;  2JYG A;  4XFY A;  4E91 A;  1BAJ A;  1VQ5 P;  1A8O A;  1RO2 A;  1YHQ P;  3H0D A;  5HGL A;  2ONT A;  5HGN A;  1W2B O;  2M8L A;  2PEI A;  2M8N A;  3G1G A;  1M9X C;  3CME P;  1M90 Q;  1Q81 Q;  1QVG O;  1VQ9 P;  3G1I A;  2EIA A;  1Q86 Q;  2PEM A;  1VQ7 P;  4DGA C;  3CC4 P;  2X82 A;  1Q82 Q;  1P7N A;  5HGO A;  3MGE A;  2E1M A;  1GWP A;  2PEQ A;  1N8R Q;  4DGE C;  4COC A;  2GOL B;  2PEN A;  3DS3 A;  1KQS O;  2XT1 A;  4XFZ A;  3NTE A;  4U0A A;  1VQ8 P;  2PEK A;  4COP A;  1VQL P;  1E6J P;  2XDE A;  2XGV A;  4NX4 C;  2KOD A;  2PY8 A;  1M9E C;  1M9C C;  1KC8 Q;  1EM9 A;  2JPR A;  3G4S P;  3CCM P;  2P9X A;  1K30 A;  3CCV P;  3LRY A;  2XGU A;  1A43 A;  3DS0 A;  4U0B A;  4XFX A;  2Z45 A;  2LF4 A;  3CCR P;  2PWO A;  4B4N A;  2X2D D;  1YJN P;  3CCE P;  1QVF O;  3G6E P;  1EOQ A;  1ZMB A;  5HGK A;  2JYL A;  4IPY A;  3CCS P;  3CCU P;  1VQO P;  3E2D A;  2Y4Z A;  1AFV A;  3CC7 P;  1M1K Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...