4PH3A

N-terminal domain of the capsid protein from bovine leukaemia virus (with no beta-hairpin)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
114
Chain Sequence
RAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLQYIASPVDQTAHMTSLTAAIAAAEAANTLQGFNPQNGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLV capsid
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
total genus 39
structure length 114
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4ph3A00
1G03A 5HGOA 4QNBA 4HTWA 1M9CC 4DGEC 1QRJA 5HGKA 2JPRA 1M9YC 2KGFA 4PH0A 2XGVA 1EM9A 3NTEA 2PXRC 3H47A 4PH2A 2PWOA 1D1DA 4DGAC 3H4EA 1AK4C 4U0AA 1EIAA 4XRQA 4PH3A 4E91A 1GWPA 1M9XC 1E6JP 5JPAA 3P05A 2V4XA 2X83A 4U0BA 2X82A 2XGYA 4B4NA 4U0CA 3BP9A 4WYMA 2EIAA 1M9FC 2XDEA 2XGUA 4XFYA 4XFZA 4XFXA 4U0EA 2X2DD 2GONA 4XROA 3MGEA 4INBA 2LF4A 1L6NA 2M8NA 1M9DC 4J93A 2M8LA 2Y4ZA 1P7NA 4U0DA 1M9EC 2M8PA 5HGLA 2WLVA 5HGMA 1AFVA 4NX4C 5HGNA 4LQWC 2PWMA 4U0FA 2GOLB 4E92A 1U7KA 2WLVB
chains in the Genus database with same CATH superfamily
1G03A 5HGOA 4QNBA 4HTWA 1M9CC 4DGEC 1QRJA 5HGKA 2JPRA 1M9YC 2KGFA 4PH0A 2XGVA 1EM9A 3NTEA 2PXRC 3H47A 4PH2A 2PWOA 1D1DA 4DGAC 3H4EA 1AK4C 4U0AA 1EIAA 4XRQA 4PH3A 4E91A 1GWPA 1M9XC 1E6JP 5JPAA 3P05A 2V4XA 2X83A 4U0BA 2X82A 2XGYA 4B4NA 4U0CA 3BP9A 4WYMA 2EIAA 1M9FC 2XDEA 2XGUA 4XFYA 4XFZA 4XFXA 4U0EA 2X2DD 2GONA 4XROA 3MGEA 4INBA 2LF4A 1L6NA 2M8NA 1M9DC 4J93A 2M8LA 2Y4ZA 1P7NA 4U0DA 1M9EC 2M8PA 5HGLA 2WLVA 5HGMA 1AFVA 4NX4C 5HGNA 4LQWC 2PWMA 4U0FA 2GOLB 4E92A 1U7KA 2WLVB
chains in the Genus database with same CATH topology
1G03A 5HGOA 4QNBA 4HTWA 1M9CC 4DGEC 1QRJA 5HGKA 2JPRA 1M9YC 2KGFA 4PH0A 2XGVA 1EM9A 3NTEA 2PXRC 3H47A 4PH2A 2PWOA 1D1DA 4DGAC 3H4EA 1AK4C 4U0AA 1EIAA 4XRQA 4PH3A 4E91A 1GWPA 1M9XC 1E6JP 5JPAA 3P05A 2V4XA 2X83A 4U0BA 2X82A 2XGYA 4B4NA 4U0CA 3BP9A 4WYMA 2EIAA 1M9FC 2XDEA 2XGUA 4XFYA 4XFZA 4XFXA 4U0EA 2X2DD 2GONA 4XROA 3MGEA 4INBA 2LF4A 1L6NA 2M8NA 1M9DC 4J93A 2M8LA 2Y4ZA 1P7NA 4U0DA 1M9EC 2M8PA 5HGLA 2WLVA 5HGMA 1AFVA 4NX4C 5HGNA 4LQWC 2PWMA 4U0FA 2GOLB 4E92A 1U7KA 2WLVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G03 A;  5HGO A;  4QNB A;  4HTW A;  1M9C C;  4DGE C;  1QRJ A;  5HGK A;  2JPR A;  1M9Y C;  2KGF A;  4PH0 A;  2XGV A;  1EM9 A;  3NTE A;  2PXR C;  3H47 A;  4PH2 A;  2PWO A;  1D1D A;  4DGA C;  3H4E A;  1AK4 C;  4U0A A;  1EIA A;  4XRQ A;  4PH3 A;  4E91 A;  1GWP A;  1M9X C;  1E6J P;  5JPA A;  3P05 A;  2V4X A;  2X83 A;  4U0B A;  2X82 A;  2XGY A;  4B4N A;  4U0C A;  3BP9 A;  4WYM A;  2EIA A;  1M9F C;  2XDE A;  2XGU A;  4XFY A;  4XFZ A;  4XFX A;  4U0E A;  2X2D D;  2GON A;  4XRO A;  3MGE A;  4INB A;  2LF4 A;  1L6N A;  2M8N A;  1M9D C;  4J93 A;  2M8L A;  2Y4Z A;  1P7N A;  4U0D A;  1M9E C;  2M8P A;  5HGL A;  2WLV A;  5HGM A;  1AFV A;  4NX4 C;  5HGN A;  4LQW C;  2PWM A;  4U0F A;  2GOL B;  4E92 A;  1U7K A;  2WLV B; 
#chains in the Genus database with same CATH topology
 1G03 A;  5HGO A;  4QNB A;  4HTW A;  1M9C C;  4DGE C;  1QRJ A;  5HGK A;  2JPR A;  1M9Y C;  2KGF A;  4PH0 A;  2XGV A;  1EM9 A;  3NTE A;  2PXR C;  3H47 A;  4PH2 A;  2PWO A;  1D1D A;  4DGA C;  3H4E A;  1AK4 C;  4U0A A;  1EIA A;  4XRQ A;  4PH3 A;  4E91 A;  1GWP A;  1M9X C;  1E6J P;  5JPA A;  3P05 A;  2V4X A;  2X83 A;  4U0B A;  2X82 A;  2XGY A;  4B4N A;  4U0C A;  3BP9 A;  4WYM A;  2EIA A;  1M9F C;  2XDE A;  2XGU A;  4XFY A;  4XFZ A;  4XFX A;  4U0E A;  2X2D D;  2GON A;  4XRO A;  3MGE A;  4INB A;  2LF4 A;  1L6N A;  2M8N A;  1M9D C;  4J93 A;  2M8L A;  2Y4Z A;  1P7N A;  4U0D A;  1M9E C;  2M8P A;  5HGL A;  2WLV A;  5HGM A;  1AFV A;  4NX4 C;  5HGN A;  4LQW C;  2PWM A;  4U0F A;  2GOL B;  4E92 A;  1U7K A;  2WLV B; 
#chains in the Genus database with same CATH homology
 1G03 A;  5HGO A;  4QNB A;  4HTW A;  1M9C C;  4DGE C;  1QRJ A;  5HGK A;  2JPR A;  1M9Y C;  2KGF A;  4PH0 A;  2XGV A;  1EM9 A;  3NTE A;  2PXR C;  3H47 A;  4PH2 A;  2PWO A;  1D1D A;  4DGA C;  3H4E A;  1AK4 C;  4U0A A;  1EIA A;  4XRQ A;  4PH3 A;  4E91 A;  1GWP A;  1M9X C;  1E6J P;  5JPA A;  3P05 A;  2V4X A;  2X83 A;  4U0B A;  2X82 A;  2XGY A;  4B4N A;  4U0C A;  3BP9 A;  4WYM A;  2EIA A;  1M9F C;  2XDE A;  2XGU A;  4XFY A;  4XFZ A;  4XFX A;  4U0E A;  2X2D D;  2GON A;  4XRO A;  3MGE A;  4INB A;  2LF4 A;  1L6N A;  2M8N A;  1M9D C;  4J93 A;  2M8L A;  2Y4Z A;  1P7N A;  4U0D A;  1M9E C;  2M8P A;  5HGL A;  2WLV A;  5HGM A;  1AFV A;  4NX4 C;  5HGN A;  4LQW C;  2PWM A;  4U0F A;  2GOL B;  4E92 A;  1U7K A;  2WLV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...