4U0BA

Hexamer hiv-1 ca in complex with cpsf6 peptide, p212121 crystal form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 75
structure length 208
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0bA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0bA02
2XGUA 4INBA 5DCKA 4XROA 3G29A 4QNBA 1GWPA 1A43A 2JO0A 1M9FC 4COPA 1D1DA 1M9EC 3G28A 2M8NA 2XGVA 3DS4A 4COCA 5HGKA 5HGNA 4U0DA 1A8OA 1BAJA 4NX4C 3VRLC 4WYMA 1QRJA 4PH1A 4U0EA 2ONTA 1EOQA 3G0VA 4LQWC 4HTWA 2WLVA 4IPYA 2XGYA 1L6NA 2Y4ZA 4M0IA 5HGLA 2PWOA 5I4TG 2V4XA 2GOLB 2JYLA 3DS1A 4DGAC 3G26A 3G1IA 4XFXA 3DS5A 2EIAA 2WLVB 5HGMA 1P7NA 4U0CA 5JPAA 1M9XC 2M8PA 3MGEA 2XT1A 3NTEA 1AUMA 1M9YC 3H47A 2M8LA 3DPHA 3DTJA 3H4EA 2PXRC 4U0BA 2X83A 1G03A 1AFVA 4U0FA 2GONA 1AK4C 3P05A 5HGOA 4PH2A 2JYGA 4B4NA 4XFZA 1E6JP 2L6EA 2X2DD 4J93A 3DS3A 3DS0A 4U0AA 1U7KA 2LF4A 4E91A 3G21A 1M9DC 2KGFA 1EIAA 4PH3A 1M9CC 4XFYA 2XV6A 3DS2A 1EM9A 4PH0A 2X82A 2XXMA 3LRYA 4DGEC 4E92A 2KODA 2XDEA 3G1GA 2PWMA 2BUOA 4XRQA 2JPRA 3BP9A
chains in the Genus database with same CATH superfamily
2XGUA 5DCKA 2Z45A 1VKUA 3G29A 1HQBA 4BPFA 2JQ4A 2KGCA 1Q82Q 2LMLA 3M1MA 1GWPA 1M9FC 3CCLP 2X2BA 2M8NA 2XGVA 2JAZA 3CXCO 2K94A 1VQ8P 2KOSA 4COCA 3CCVP 3B4QA 1BXIA 2K0XA 2CWOA 1EMVA 3VRLC 3EJEA 4PH1A 1UNKA 2ONTA 4HTWA 2AVAA 2K93A 4IPYA 3G71P 1NQ4A 5EJDA 2Y4ZA 1F80D 2KW2A 4DGAC 3CCRP 2KGDA 2N5HA 4F37A 2L22A 1KD1Q 1M6NA 5JPAA 2M8PA 2GDWA 2QNWA 1M1KQ 2K2QA 2PNGA 1NJIQ 3NTEA 2LPKA 1M9YC 1HY8A 2LKIA 3H47A 3DTJA 1K73Q 2GZIA 1K8AQ 2KG6A 2X83A 1AFVA 1AK4C 1Q81Q 4B4NA 5HV8A 1JJ2O 2JGPA 1E6JP 3U43A 3DS3A 2Z46A 1VQ5P 1RO0A 2L4BA 2QEXP 2KGFA 2LIUA 2LTEA 4PH3A 3E2DA 2PEIA 4XFYA 1EM9A 1OR5A 1RNIA 2FQ0A 1CEIA 2L0QA 4E92A 1MZ8A 2VSQA 2CNRA 3B5IA 1KQSO 1VQ6P 2FVEA 4QKOA 2DGYA 1A43A 2FVFA 4H2XC 3CMEP 5HGKA 1YHQP 1A8OA 2EG5A 3HYBA 1KLPA 2K0DX 1X3OA 1QRJA 2MF4A 4CA3A 1Z6MA 2KG8A 1L0IA 2FADA 1ACPA 1YIJP 4U0EA 3GJNA 1EOQA 4LQWC 4GR2A 2FVAA 1L6NA 1UJZA 2QA4P 2CGQA 5HGLA 5I4TG 2GOLB 2FQ2A 1VQ9P 3G26A 5KP8B 1YJ9P 3DS5A 3Q20A 1DNYA 2WLVB 5HGMA 2JBGA 1M6EX 4HKGA 3CC4P 3MGEA 2OTLP 2KOPA 2XT1A 1Q86Q 1S72P 2FHSC 2GONA 5HGOA 4PH2A 1E0HA 2FQ1A 4J93A 4U0AA 3CE7A 3G21A 2JU2A 1EIAA 2VLPA 1IMPA 2NO8A 3RG2A 2GZGA 2XV6A 2FACA 1GPJA 2X82A 1GXGA 2Z44A 1VQNP 2GZJA 2K92A 2BUOA 2OARA 2N50A 3BP9A 2MR8A 4INBA 2GDXA 2AF8A 4IZ6A 2MY5A 2GDYA 2JO0A 2KWLA 4COPA 1D1DA 2PENA 4DG9A 1M9EC 2JB0A 1IUQA 2DNWA 1VQLP 1RO2A 5HGNA 2VLOA 5EW5E 4U0DA 1BAJA 3HZQA 2XZ0D 1M74A 3NY7B 3G0VA 2GZFA 5CZDB 1K9MQ 5F2OA 2XGYA 4M0IA 2PWOA 3LMOA 2FAEA 3EJBA 2JYLA 5KP7B 2BHVA 1QVGO 2EFJA 2PEKA 4BPHA 4U0CA 4PXHB 1VQMP 1DV5A 1W2BO 2EHTA 3CCQP 1AUMA 2M8LA 5F2KA 4BPGA 3DPHA 3H4EA 1VQ4P 3CC2P 1YI2P 1AYIA 4U0FA 3I56P 3CCUP 2K0YA 2LL8A 3RG6C 1FR2A 2K5XA 4H2WC 1ZMBA 1U7KA 2LF4A 1M9DC 2N6YA 2ROQA 2EHSA 1VHNA 2N5IA 1M9CC 7CEIA 4PH0A 2CQ8A 1VQOP 4PWVB 2XXMA 3LRYA 1YJWP 2KGAA 2KODA 3G1GA 4XRQA 2PEQA 2MVVA 1AF8A 2E1MA 2N98A 4XROA 2PEMA 4QNBA 2LIWA 1VQPP 3OW2O 2KR5A 4H2YC 2VLQA 2OTJP 1VQKP 3G28A 1M90Q 3DS4A 3EJDA 5HVCA 2KOQA 2AFEA 2KG9A 2AFDA 2PEOA 2PY8A 3CCMP 3CCSP 4NX4C 3CC7P 4WYMA 3I55P 1YJNP 3GZLA 2M5RA 2JU1A 5BS1A 2WLVA 5KP6B 4GR6A 2V4XA 3GZMA 3CCEP 3WBHA 2VLNA 3DS1A 3CPWO 4MRTC 3G1IA 4XFXA 3CMAP 1KC8Q 3CD6P 2EIAA 2ERHA 1QVFO 1P7NA 3GKLC 5F2NA 1M9XC 3CCJP 2XZ1C 4UHPB 2MD9A 1IMQA 1YITP 5BS2A 2PEJA 2CG5B 1K30A 2PXRC 2KORA 4U0BA 3H0DA 1G03A 1N8RQ 2N6ZA 1ZNVA 3P05A 2JYGA 4XFZA 2L6EA 2X2DD 1GXHA 1L0HA 3DS0A 3G4SP 2GYKA 4E91A 2LOLA 2WPTA 3G6EP 2KOOA 4NEOA 4R0MA 3DS2A 2L9FA 1VQ7P 2P9XA 4DGEC 2MR7A 2XDEA 2MVUA 1Q7YQ 2PWMA 2KGEA 1T8KA 2GZEA 2JPRA
chains in the Genus database with same CATH topology
2XGUA 4INBA 2E1MA 5DCKA 4XROA 2Z45A 3G29A 1KQSO 1Q82Q 1VQ6P 3M1MA 2PEMA 4QNBA 2DGYA 1VQPP 3OW2O 1GWPA 1A43A 2JO0A 1M9FC 4COPA 3CCLP 2OTJP 1D1DA 2PENA 1VQKP 1M9EC 3G28A 2M8NA 3CMEP 1M90Q 1IUQA 2XGVA 3DS4A 1VQLP 1RO2A 3CXCO 1VQ8P 4COCA 3CCVP 5HGKA 5HGNA 1YHQP 4U0DA 2CWOA 1A8OA 2PEOA 2PY8A 1BAJA 2EG5A 3HYBA 3CCMP 3B5IA 4NX4C 3CCSP 3HZQA 3CC7P 3VRLC 4WYMA 1QRJA 3I55P 1YJNP 4PH1A 1M74A 1YIJP 4U0EA 2ONTA 5BS1A 1EOQA 3G0VA 4LQWC 4HTWA 4GR2A 1K9MQ 2WLVA 4IPYA 5F2OA 3G71P 2XGYA 1L6NA 2QA4P 2Y4ZA 4GR6A 4M0IA 5HGLA 2PWOA 5I4TG 2V4XA 2GOLB 3CCEP 3WBHA 1VQ9P 2JYLA 3DS1A 4DGAC 3G26A 3CCRP 1YJ9P 3CPWO 3G1IA 4XFXA 3DS5A 3CMAP 2BHVA 3Q20A 1KC8Q 3CD6P 2EIAA 1QVGO 2EFJA 2WLVB 5HGMA 2PEKA 1KD1Q 1P7NA 1QVFO 1M6NA 4U0CA 5JPAA 1VQMP 5F2NA 1M6EX 1M9XC 2M8PA 3CCJP 3CC4P 3MGEA 2OTLP 1W2BO 1M1KQ 2XT1A 1YITP 1NJIQ 3CCQP 3NTEA 1AUMA 5BS2A 1Q86Q 1M9YC 2PEJA 3H47A 2M8LA 5F2KA 3DPHA 1S72P 1K30A 3DTJA 1K73Q 3H4EA 1VQ4P 3CC2P 2PXRC 1K8AQ 1YI2P 4U0BA 3H0DA 2X83A 1G03A 1N8RQ 1AFVA 4U0FA 2GONA 1AK4C 3P05A 5HGOA 3I56P 4PH2A 1Q81Q 3CCUP 2JYGA 4B4NA 1JJ2O 4XFZA 1E6JP 2L6EA 2X2DD 4J93A 3DS3A 3RG6C 3DS0A 2Z46A 1VQ5P 4U0AA 1ZMBA 3G4SP 1U7KA 2LF4A 1RO0A 4E91A 2QEXP 3G21A 1M9DC 2KGFA 3G6EP 1EIAA 4PH3A 3E2DA 2PEIA 1M9CC 4XFYA 2XV6A 3DS2A 1EM9A 1VQ7P 4PH0A 2X82A 2P9XA 1RNIA 1VQOP 2XXMA 2Z44A 3LRYA 4DGEC 1YJWP 4E92A 1VQNP 2KODA 2XDEA 3G1GA 1Q7YQ 2PWMA 2BUOA 4XRQA 2PEQA 2OARA 2JPRA 3BP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGU A;  4INB A;  5DCK A;  4XRO A;  3G29 A;  4QNB A;  1GWP A;  1A43 A;  2JO0 A;  1M9F C;  4COP A;  1D1D A;  1M9E C;  3G28 A;  2M8N A;  2XGV A;  3DS4 A;  4COC A;  5HGK A;  5HGN A;  4U0D A;  1A8O A;  1BAJ A;  4NX4 C;  3VRL C;  4WYM A;  1QRJ A;  4PH1 A;  4U0E A;  2ONT A;  1EOQ A;  3G0V A;  4LQW C;  4HTW A;  2WLV A;  4IPY A;  2XGY A;  1L6N A;  2Y4Z A;  4M0I A;  5HGL A;  2PWO A;  5I4T G;  2V4X A;  2GOL B;  2JYL A;  3DS1 A;  4DGA C;  3G26 A;  3G1I A;  4XFX A;  3DS5 A;  2EIA A;  2WLV B;  5HGM A;  1P7N A;  4U0C A;  5JPA A;  1M9X C;  2M8P A;  3MGE A;  2XT1 A;  3NTE A;  1AUM A;  1M9Y C;  3H47 A;  2M8L A;  3DPH A;  3DTJ A;  3H4E A;  2PXR C;  4U0B A;  2X83 A;  1G03 A;  1AFV A;  4U0F A;  2GON A;  1AK4 C;  3P05 A;  5HGO A;  4PH2 A;  2JYG A;  4B4N A;  4XFZ A;  1E6J P;  2L6E A;  2X2D D;  4J93 A;  3DS3 A;  3DS0 A;  4U0A A;  1U7K A;  2LF4 A;  4E91 A;  3G21 A;  1M9D C;  2KGF A;  1EIA A;  4PH3 A;  1M9C C;  4XFY A;  2XV6 A;  3DS2 A;  1EM9 A;  4PH0 A;  2X82 A;  2XXM A;  3LRY A;  4DGE C;  4E92 A;  2KOD A;  2XDE A;  3G1G A;  2PWM A;  2BUO A;  4XRQ A;  2JPR A;  3BP9 A; 
#chains in the Genus database with same CATH topology
 2XGU A;  5DCK A;  2Z45 A;  1VKU A;  3G29 A;  1HQB A;  4BPF A;  2JQ4 A;  2KGC A;  1Q82 Q;  2LML A;  3M1M A;  1GWP A;  1M9F C;  3CCL P;  2X2B A;  2M8N A;  2XGV A;  2JAZ A;  3CXC O;  2K94 A;  1VQ8 P;  2KOS A;  4COC A;  3CCV P;  3B4Q A;  1BXI A;  2K0X A;  2CWO A;  1EMV A;  3VRL C;  3EJE A;  4PH1 A;  1UNK A;  2ONT A;  4HTW A;  2AVA A;  2K93 A;  4IPY A;  3G71 P;  1NQ4 A;  5EJD A;  2Y4Z A;  1F80 D;  2KW2 A;  4DGA C;  3CCR P;  2KGD A;  2N5H A;  4F37 A;  2L22 A;  1KD1 Q;  1M6N A;  5JPA A;  2M8P A;  2GDW A;  2QNW A;  1M1K Q;  2K2Q A;  2PNG A;  1NJI Q;  3NTE A;  2LPK A;  1M9Y C;  1HY8 A;  2LKI A;  3H47 A;  3DTJ A;  1K73 Q;  2GZI A;  1K8A Q;  2KG6 A;  2X83 A;  1AFV A;  1AK4 C;  1Q81 Q;  4B4N A;  5HV8 A;  1JJ2 O;  2JGP A;  1E6J P;  3U43 A;  3DS3 A;  2Z46 A;  1VQ5 P;  1RO0 A;  2L4B A;  2QEX P;  2KGF A;  2LIU A;  2LTE A;  4PH3 A;  3E2D A;  2PEI A;  4XFY A;  1EM9 A;  1OR5 A;  1RNI A;  2FQ0 A;  1CEI A;  2L0Q A;  4E92 A;  1MZ8 A;  2VSQ A;  2CNR A;  3B5I A;  1KQS O;  1VQ6 P;  2FVE A;  4QKO A;  2DGY A;  1A43 A;  2FVF A;  4H2X C;  3CME P;  5HGK A;  1YHQ P;  1A8O A;  2EG5 A;  3HYB A;  1KLP A;  2K0D X;  1X3O A;  1QRJ A;  2MF4 A;  4CA3 A;  1Z6M A;  2KG8 A;  1L0I A;  2FAD A;  1ACP A;  1YIJ P;  4U0E A;  3GJN A;  1EOQ A;  4LQW C;  4GR2 A;  2FVA A;  1L6N A;  1UJZ A;  2QA4 P;  2CGQ A;  5HGL A;  5I4T G;  2GOL B;  2FQ2 A;  1VQ9 P;  3G26 A;  5KP8 B;  1YJ9 P;  3DS5 A;  3Q20 A;  1DNY A;  2WLV B;  5HGM A;  2JBG A;  1M6E X;  4HKG A;  3CC4 P;  3MGE A;  2OTL P;  2KOP A;  2XT1 A;  1Q86 Q;  1S72 P;  2FHS C;  2GON A;  5HGO A;  4PH2 A;  1E0H A;  2FQ1 A;  4J93 A;  4U0A A;  3CE7 A;  3G21 A;  2JU2 A;  1EIA A;  2VLP A;  1IMP A;  2NO8 A;  3RG2 A;  2GZG A;  2XV6 A;  2FAC A;  1GPJ A;  2X82 A;  1GXG A;  2Z44 A;  1VQN P;  2GZJ A;  2K92 A;  2BUO A;  2OAR A;  2N50 A;  3BP9 A;  2MR8 A;  4INB A;  2GDX A;  2AF8 A;  4IZ6 A;  2MY5 A;  2GDY A;  2JO0 A;  2KWL A;  4COP A;  1D1D A;  2PEN A;  4DG9 A;  1M9E C;  2JB0 A;  1IUQ A;  2DNW A;  1VQL P;  1RO2 A;  5HGN A;  2VLO A;  5EW5 E;  4U0D A;  1BAJ A;  3HZQ A;  2XZ0 D;  1M74 A;  3NY7 B;  3G0V A;  2GZF A;  5CZD B;  1K9M Q;  5F2O A;  2XGY A;  4M0I A;  2PWO A;  3LMO A;  2FAE A;  3EJB A;  2JYL A;  5KP7 B;  2BHV A;  1QVG O;  2EFJ A;  2PEK A;  4BPH A;  4U0C A;  4PXH B;  1VQM P;  1DV5 A;  1W2B O;  2EHT A;  3CCQ P;  1AUM A;  2M8L A;  5F2K A;  4BPG A;  3DPH A;  3H4E A;  1VQ4 P;  3CC2 P;  1YI2 P;  1AYI A;  4U0F A;  3I56 P;  3CCU P;  2K0Y A;  2LL8 A;  3RG6 C;  1FR2 A;  2K5X A;  4H2W C;  1ZMB A;  1U7K A;  2LF4 A;  1M9D C;  2N6Y A;  2ROQ A;  2EHS A;  1VHN A;  2N5I A;  1M9C C;  7CEI A;  4PH0 A;  2CQ8 A;  1VQO P;  4PWV B;  2XXM A;  3LRY A;  1YJW P;  2KGA A;  2KOD A;  3G1G A;  4XRQ A;  2PEQ A;  2MVV A;  1AF8 A;  2E1M A;  2N98 A;  4XRO A;  2PEM A;  4QNB A;  2LIW A;  1VQP P;  3OW2 O;  2KR5 A;  4H2Y C;  2VLQ A;  2OTJ P;  1VQK P;  3G28 A;  1M90 Q;  3DS4 A;  3EJD A;  5HVC A;  2KOQ A;  2AFE A;  2KG9 A;  2AFD A;  2PEO A;  2PY8 A;  3CCM P;  3CCS P;  4NX4 C;  3CC7 P;  4WYM A;  3I55 P;  1YJN P;  3GZL A;  2M5R A;  2JU1 A;  5BS1 A;  2WLV A;  5KP6 B;  4GR6 A;  2V4X A;  3GZM A;  3CCE P;  3WBH A;  2VLN A;  3DS1 A;  3CPW O;  4MRT C;  3G1I A;  4XFX A;  3CMA P;  1KC8 Q;  3CD6 P;  2EIA A;  2ERH A;  1QVF O;  1P7N A;  3GKL C;  5F2N A;  1M9X C;  3CCJ P;  2XZ1 C;  4UHP B;  2MD9 A;  1IMQ A;  1YIT P;  5BS2 A;  2PEJ A;  2CG5 B;  1K30 A;  2PXR C;  2KOR A;  4U0B A;  3H0D A;  1G03 A;  1N8R Q;  2N6Z A;  1ZNV A;  3P05 A;  2JYG A;  4XFZ A;  2L6E A;  2X2D D;  1GXH A;  1L0H A;  3DS0 A;  3G4S P;  2GYK A;  4E91 A;  2LOL A;  2WPT A;  3G6E P;  2KOO A;  4NEO A;  4R0M A;  3DS2 A;  2L9F A;  1VQ7 P;  2P9X A;  4DGE C;  2MR7 A;  2XDE A;  2MVU A;  1Q7Y Q;  2PWM A;  2KGE A;  1T8K A;  2GZE A;  2JPR A; 
#chains in the Genus database with same CATH homology
 2XGU A;  4INB A;  2E1M A;  5DCK A;  4XRO A;  2Z45 A;  3G29 A;  1KQS O;  1Q82 Q;  1VQ6 P;  3M1M A;  2PEM A;  4QNB A;  2DGY A;  1VQP P;  3OW2 O;  1GWP A;  1A43 A;  2JO0 A;  1M9F C;  4COP A;  3CCL P;  2OTJ P;  1D1D A;  2PEN A;  1VQK P;  1M9E C;  3G28 A;  2M8N A;  3CME P;  1M90 Q;  1IUQ A;  2XGV A;  3DS4 A;  1VQL P;  1RO2 A;  3CXC O;  1VQ8 P;  4COC A;  3CCV P;  5HGK A;  5HGN A;  1YHQ P;  4U0D A;  2CWO A;  1A8O A;  2PEO A;  2PY8 A;  1BAJ A;  2EG5 A;  3HYB A;  3CCM P;  3B5I A;  4NX4 C;  3CCS P;  3HZQ A;  3CC7 P;  3VRL C;  4WYM A;  1QRJ A;  3I55 P;  1YJN P;  4PH1 A;  1M74 A;  1YIJ P;  4U0E A;  2ONT A;  5BS1 A;  1EOQ A;  3G0V A;  4LQW C;  4HTW A;  4GR2 A;  1K9M Q;  2WLV A;  4IPY A;  5F2O A;  3G71 P;  2XGY A;  1L6N A;  2QA4 P;  2Y4Z A;  4GR6 A;  4M0I A;  5HGL A;  2PWO A;  5I4T G;  2V4X A;  2GOL B;  3CCE P;  3WBH A;  1VQ9 P;  2JYL A;  3DS1 A;  4DGA C;  3G26 A;  3CCR P;  1YJ9 P;  3CPW O;  3G1I A;  4XFX A;  3DS5 A;  3CMA P;  2BHV A;  3Q20 A;  1KC8 Q;  3CD6 P;  2EIA A;  1QVG O;  2EFJ A;  2WLV B;  5HGM A;  2PEK A;  1KD1 Q;  1P7N A;  1QVF O;  1M6N A;  4U0C A;  5JPA A;  1VQM P;  5F2N A;  1M6E X;  1M9X C;  2M8P A;  3CCJ P;  3CC4 P;  3MGE A;  2OTL P;  1W2B O;  1M1K Q;  2XT1 A;  1YIT P;  1NJI Q;  3CCQ P;  3NTE A;  1AUM A;  5BS2 A;  1Q86 Q;  1M9Y C;  2PEJ A;  3H47 A;  2M8L A;  5F2K A;  3DPH A;  1S72 P;  1K30 A;  3DTJ A;  1K73 Q;  3H4E A;  1VQ4 P;  3CC2 P;  2PXR C;  1K8A Q;  1YI2 P;  4U0B A;  3H0D A;  2X83 A;  1G03 A;  1N8R Q;  1AFV A;  4U0F A;  2GON A;  1AK4 C;  3P05 A;  5HGO A;  3I56 P;  4PH2 A;  1Q81 Q;  3CCU P;  2JYG A;  4B4N A;  1JJ2 O;  4XFZ A;  1E6J P;  2L6E A;  2X2D D;  4J93 A;  3DS3 A;  3RG6 C;  3DS0 A;  2Z46 A;  1VQ5 P;  4U0A A;  1ZMB A;  3G4S P;  1U7K A;  2LF4 A;  1RO0 A;  4E91 A;  2QEX P;  3G21 A;  1M9D C;  2KGF A;  3G6E P;  1EIA A;  4PH3 A;  3E2D A;  2PEI A;  1M9C C;  4XFY A;  2XV6 A;  3DS2 A;  1EM9 A;  1VQ7 P;  4PH0 A;  2X82 A;  2P9X A;  1RNI A;  1VQO P;  2XXM A;  2Z44 A;  3LRY A;  4DGE C;  1YJW P;  4E92 A;  1VQN P;  2KOD A;  2XDE A;  3G1G A;  1Q7Y Q;  2PWM A;  2BUO A;  4XRQ A;  2PEQ A;  2OAR A;  2JPR A;  3BP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...