4U0BA

Hexamer hiv-1 ca in complex with cpsf6 peptide, p212121 crystal form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 75
structure length 208
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0bA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0bA02
4U0BA 3G29A 2JYGA 3LRYA 2X2DD 4XFXA 2X82A 4XRQA 2XGYA 1QRJA 3DS1A 2M8PA 3MGEA 2KODA 5DCKA 2V4XA 1AFVA 5HGNA 4IPYA 4NX4C 4PH1A 5HGMA 4E92A 1M9FC 4QNBA 2JO0A 1M9DC 2ONTA 1A43A 3G26A 1EM9A 4PH3A 5HGLA 3P05A 4LQWC 3DS0A 1M9EC 4U0EA 1M9CC 2XGUA 4COCA 1BAJA 4PH2A 2PXRC 3DS3A 2XT1A 4U0DA 3BP9A 1EIAA 2WLVB 3NTEA 4WYMA 1GWPA 3DS5A 2XGVA 4INBA 4XFZA 5HGOA 4PH0A 2GOLB 3DS4A 1EOQA 4M0IA 3VRLC 4U0AA 3G28A 2XDEA 2JYLA 2X83A 5HGKA 5I4TG 1M9YC 1D1DA 4E91A 4J93A 1E6JP 2WLVA 1A8OA 3DS2A 2XV6A 2KGFA 4U0FA 1U7KA 2M8LA 3G0VA 2LF4A 5JPAA 4B4NA 3G1GA 3H4EA 1AK4C 1P7NA 3DPHA 3H47A 1AUMA 3G21A 4DGAC 2BUOA 2EIAA 3DTJA 4XROA 2JPRA 3G1IA 1M9XC 1L6NA 2PWOA 4U0CA 4COPA 2XXMA 2M8NA 4HTWA 2Y4ZA 4DGEC 1G03A 2PWMA 2L6EA 4XFYA 2GONA
chains in the Genus database with same CATH superfamily
4HKGA 3LRYA 3CCJP 1DV5A 2JU1A 2M8PA 1Q7YQ 4H2XC 1IUQA 1L0IA 2VLQA 3RG2A 3CCSP 1ZNVA 5DCKA 2N5HA 3CC2P 2PEMA 4IPYA 2PEIA 1Q81Q 2AF8A 2M5RA 1M9FC 2Z46A 5CZDB 2AVAA 1A43A 4PH3A 1K8AQ 2E1MA 2GZGA 3P05A 3CCEP 2K94A 2JBGA 2PXRC 2VSQA 2OARA 1IMPA 4BPHA 2FQ0A 3DS5A 3G4SP 4INBA 1S72P 5HV8A 1AYIA 1VQLP 5HGOA 1VQ6P 2GOLB 1W2BO 3VRLC 2KGAA 3G28A 2VLOA 2PY8A 2XDEA 3Q20A 4PXHB 4J93A 5F2OA 2CNRA 2WLVA 3EJDA 1M74A 2XV6A 3CMEP 2KGFA 4U0FA 2MVVA 5EJDA 2M8LA 2WPTA 7CEIA 2GZFA 3CD6P 1AK4C 1RO0A 1AUMA 3G21A 1ACPA 2FVFA 1M6EX 3DTJA 1YHQP 4CA3A 1M9XC 2PWOA 2JAZA 2XZ1C 2OTLP 3HYBA 2CWOA 2K2QA 3CC7P 1QVGO 2PWMA 2KR5A 2N5IA 2FVEA 2EFJA 2JYGA 2X2DD 2GYKA 2FAEA 2FVAA 2QA4P 3DS1A 3MGEA 1VHNA 2JB0A 2KODA 2LTEA 2EHSA 4DG9A 1VQ8P 1KD1Q 2KGEA 5KP8B 5HGNA 3CCRP 2KOQA 4PH1A 5HGMA 1YJ9P 2LIUA 2L9FA 3E2DA 2FACA 1VQ4P 2ONTA 1QVFO 3I55P 1Q82Q 4LQWC 1M90Q 3DS0A 1M9EC 2EG5A 1YIJP 2PEQA 4PH2A 3G71P 4IZ6A 4UHPB 1RNIA 1EMVA 3DS3A 2L22A 2XT1A 5F2KA 4F37A 3BP9A 1EIAA 3NTEA 4WYMA 1GWPA 2XGVA 4XFZA 5EW5E 1VQ7P 2VLNA 1EOQA 1Z6MA 3GZMA 2GDXA 5KP6B 1K9MQ 1VQKP 5HGKA 2FQ2A 1E6JP 1A8OA 3B4QA 3DS2A 2LPKA 3CCMP 5F2NA 1MZ8A 2LF4A 1K30A 5JPAA 2K93A 2N6ZA 2KG6A 1P7NA 2JQ4A 3H47A 4DGAC 1YJNP 2BUOA 2PNGA 1OR5A 2K0YA 1DNYA 3WBHA 1VQOP 2PEKA 3GJNA 3H0DA 1YITP 4U0CA 4GR6A 1UJZA 3U43A 2KGDA 2K92A 2L6EA 2GONA 2MVUA 2FQ1A 1VQ9P 3CC4P 2CQ8A 4XRQA 4XFXA 2X82A 2GZIA 1M6NA 2LOLA 1VQ5P 1NJIQ 2V4XA 2VLPA 1AFVA 3CXCO 2JGPA 2L4BA 2PEJA 1GXHA 2KGCA 1ZMBA 2JO0A 1YI2P 3EJBA 3G26A 2N98A 5HGLA 3CCLP 2KWLA 2X2BA 1GPJA 4H2WC 5BS1A 3HZQA 1M1KQ 3I56P 4COCA 1BAJA 1IMQA 3RG6C 4U0DA 1VKUA 2JU2A 2WLVB 1X3OA 4BPGA 1KLPA 1NQ4A 5KP7B 3OW2O 4PH0A 1T8KA 2N6YA 2KW2A 1CEIA 4M0IA 3CCVP 2LKIA 4U0AA 2MY5A 2GZJA 2JYLA 1D1DA 3NY7B 4E91A 3CE7A 1L0HA 1KQSO 1BXIA 1GXGA 2FADA 1U7KA 1VQNP 2NO8A 2PEOA 2Z44A 3G0VA 4BPFA 3G1GA 2KOOA 2KOSA 3DPHA 2CGQA 2KOPA 2EHTA 4XROA 2JPRA 3G1IA 3CCUP 2AFEA 2XXMA 2M8NA 1N8RQ 2Y4ZA 1G03A 3B5IA 4U0BA 3G29A 2P9XA 2XGYA 4H2YC 1QRJA 2QEXP 2CG5B 1AF8A 2GDWA 1K73Q 2BHVA 2GZEA 2XZ0D 3CPWO 4NX4C 1JJ2O 1YJWP 4E92A 4QNBA 1FR2A 4MRTC 2K0XA 4PWVB 1M9DC 2AFDA 2Z45A 1EM9A 2PENA 2DGYA 3LMOA 2MR8A 4U0EA 1M9CC 2XGUA 2FHSC 4GR2A 2MF4A 1KC8Q 2LL8A 2QNWA 1UNKA 2K5XA 2N50A 2DNWA 3G6EP 3M1MA 2L0QA 5HVCA 3CMAP 2ROQA 3DS4A 2LIWA 1VQMP 5I4TG 2X83A 1M9YC 4QKOA 1F80D 3GKLC 1HQBA 5BS2A 2KG9A 2GDYA 2KG8A 3EJEA 4B4NA 3GZLA 4R0MA 2K0DX 3H4EA 2LMLA 3CCQP 2KORA 2EIAA 1HY8A 1VQPP 1L6NA 1Q86Q 4NEOA 1RO2A 1E0HA 4COPA 2MD9A 2MR7A 4HTWA 4DGEC 2ERHA 4XFYA 2OTJP
chains in the Genus database with same CATH topology
4U0BA 2EFJA 3G29A 1VQ9P 2JYGA 2P9XA 3LRYA 3CCJP 3CC4P 2X2DD 4XFXA 2X82A 4XRQA 2XGYA 2QA4P 1QRJA 1M6NA 3DS1A 2M8PA 1Q7YQ 2QEXP 3MGEA 2KODA 1VQ5P 1IUQA 1NJIQ 3CCSP 5DCKA 1K73Q 2V4XA 3CC2P 2BHVA 1AFVA 3CXCO 1VQ8P 1KD1Q 5HGNA 2PEMA 4IPYA 2PEJA 4NX4C 3CPWO 3CCRP 2PEIA 1ZMBA 4PH1A 5HGMA 1YJ9P 1Q81Q 1JJ2O 1YJWP 4E92A 3E2DA 1M9FC 4QNBA 2JO0A 2Z46A 1YI2P 1VQ4P 1M9DC 2ONTA 1A43A 1QVFO 2Z45A 3G26A 1EM9A 4PH3A 3I55P 1Q82Q 1K8AQ 2E1MA 2PENA 5HGLA 2DGYA 3P05A 4LQWC 3CCLP 1M90Q 3CCEP 3DS0A 1M9EC 4U0EA 5BS1A 1M9CC 2XGUA 2EG5A 3HZQA 1M1KQ 3I56P 1YIJP 2PEQA 4COCA 1BAJA 4PH2A 2PXRC 3G71P 4GR2A 1RNIA 3DS3A 1KC8Q 2OARA 2XT1A 3RG6C 4U0DA 5F2KA 3BP9A 1EIAA 2WLVB 3NTEA 4WYMA 1GWPA 3DS5A 3G4SP 3G6EP 2XGVA 4INBA 1S72P 4XFZA 3M1MA 1VQLP 5HGOA 3CMAP 4PH0A 3OW2O 1VQ6P 2GOLB 1W2BO 3DS4A 1VQ7P 1EOQA 4M0IA 3CCVP 3VRLC 4U0AA 3G28A 2PY8A 1K9MQ 2XDEA 1VQMP 2JYLA 2X83A 5HGKA 5I4TG 1VQKP 1M9YC 3Q20A 1D1DA 4E91A 4J93A 5F2OA 1E6JP 2WLVA 1A8OA 1M74A 2XV6A 3DS2A 1KQSO 5BS2A 3CMEP 2KGFA 4U0FA 3CCMP 1U7KA 5F2NA 2M8LA 1VQNP 2PEOA 2Z44A 3G0VA 2LF4A 1K30A 5JPAA 4B4NA 3CD6P 3G1GA 3H4EA 1AK4C 1P7NA 1RO0A 3DPHA 3H47A 3CCQP 1AUMA 3G21A 4DGAC 1YJNP 2BUOA 1M6EX 2EIAA 3WBHA 1VQPP 1VQOP 3DTJA 2PEKA 4XROA 1YHQP 2JPRA 3G1IA 3H0DA 1M9XC 1L6NA 1YITP 2PWOA 3CCUP 4U0CA 4GR6A 1Q86Q 1RO2A 2OTLP 4COPA 2XXMA 2M8NA 3HYBA 4HTWA 2CWOA 1N8RQ 2Y4ZA 1QVGO 4DGEC 3CC7P 1G03A 2PWMA 2L6EA 3B5IA 4XFYA 2GONA 2OTJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0B A;  3G29 A;  2JYG A;  3LRY A;  2X2D D;  4XFX A;  2X82 A;  4XRQ A;  2XGY A;  1QRJ A;  3DS1 A;  2M8P A;  3MGE A;  2KOD A;  5DCK A;  2V4X A;  1AFV A;  5HGN A;  4IPY A;  4NX4 C;  4PH1 A;  5HGM A;  4E92 A;  1M9F C;  4QNB A;  2JO0 A;  1M9D C;  2ONT A;  1A43 A;  3G26 A;  1EM9 A;  4PH3 A;  5HGL A;  3P05 A;  4LQW C;  3DS0 A;  1M9E C;  4U0E A;  1M9C C;  2XGU A;  4COC A;  1BAJ A;  4PH2 A;  2PXR C;  3DS3 A;  2XT1 A;  4U0D A;  3BP9 A;  1EIA A;  2WLV B;  3NTE A;  4WYM A;  1GWP A;  3DS5 A;  2XGV A;  4INB A;  4XFZ A;  5HGO A;  4PH0 A;  2GOL B;  3DS4 A;  1EOQ A;  4M0I A;  3VRL C;  4U0A A;  3G28 A;  2XDE A;  2JYL A;  2X83 A;  5HGK A;  5I4T G;  1M9Y C;  1D1D A;  4E91 A;  4J93 A;  1E6J P;  2WLV A;  1A8O A;  3DS2 A;  2XV6 A;  2KGF A;  4U0F A;  1U7K A;  2M8L A;  3G0V A;  2LF4 A;  5JPA A;  4B4N A;  3G1G A;  3H4E A;  1AK4 C;  1P7N A;  3DPH A;  3H47 A;  1AUM A;  3G21 A;  4DGA C;  2BUO A;  2EIA A;  3DTJ A;  4XRO A;  2JPR A;  3G1I A;  1M9X C;  1L6N A;  2PWO A;  4U0C A;  4COP A;  2XXM A;  2M8N A;  4HTW A;  2Y4Z A;  4DGE C;  1G03 A;  2PWM A;  2L6E A;  4XFY A;  2GON A; 
#chains in the Genus database with same CATH topology
 4HKG A;  3LRY A;  3CCJ P;  1DV5 A;  2JU1 A;  2M8P A;  1Q7Y Q;  4H2X C;  1IUQ A;  1L0I A;  2VLQ A;  3RG2 A;  3CCS P;  1ZNV A;  5DCK A;  2N5H A;  3CC2 P;  2PEM A;  4IPY A;  2PEI A;  1Q81 Q;  2AF8 A;  2M5R A;  1M9F C;  2Z46 A;  5CZD B;  2AVA A;  1A43 A;  4PH3 A;  1K8A Q;  2E1M A;  2GZG A;  3P05 A;  3CCE P;  2K94 A;  2JBG A;  2PXR C;  2VSQ A;  2OAR A;  1IMP A;  4BPH A;  2FQ0 A;  3DS5 A;  3G4S P;  4INB A;  1S72 P;  5HV8 A;  1AYI A;  1VQL P;  5HGO A;  1VQ6 P;  2GOL B;  1W2B O;  3VRL C;  2KGA A;  3G28 A;  2VLO A;  2PY8 A;  2XDE A;  3Q20 A;  4PXH B;  4J93 A;  5F2O A;  2CNR A;  2WLV A;  3EJD A;  1M74 A;  2XV6 A;  3CME P;  2KGF A;  4U0F A;  2MVV A;  5EJD A;  2M8L A;  2WPT A;  7CEI A;  2GZF A;  3CD6 P;  1AK4 C;  1RO0 A;  1AUM A;  3G21 A;  1ACP A;  2FVF A;  1M6E X;  3DTJ A;  1YHQ P;  4CA3 A;  1M9X C;  2PWO A;  2JAZ A;  2XZ1 C;  2OTL P;  3HYB A;  2CWO A;  2K2Q A;  3CC7 P;  1QVG O;  2PWM A;  2KR5 A;  2N5I A;  2FVE A;  2EFJ A;  2JYG A;  2X2D D;  2GYK A;  2FAE A;  2FVA A;  2QA4 P;  3DS1 A;  3MGE A;  1VHN A;  2JB0 A;  2KOD A;  2LTE A;  2EHS A;  4DG9 A;  1VQ8 P;  1KD1 Q;  2KGE A;  5KP8 B;  5HGN A;  3CCR P;  2KOQ A;  4PH1 A;  5HGM A;  1YJ9 P;  2LIU A;  2L9F A;  3E2D A;  2FAC A;  1VQ4 P;  2ONT A;  1QVF O;  3I55 P;  1Q82 Q;  4LQW C;  1M90 Q;  3DS0 A;  1M9E C;  2EG5 A;  1YIJ P;  2PEQ A;  4PH2 A;  3G71 P;  4IZ6 A;  4UHP B;  1RNI A;  1EMV A;  3DS3 A;  2L22 A;  2XT1 A;  5F2K A;  4F37 A;  3BP9 A;  1EIA A;  3NTE A;  4WYM A;  1GWP A;  2XGV A;  4XFZ A;  5EW5 E;  1VQ7 P;  2VLN A;  1EOQ A;  1Z6M A;  3GZM A;  2GDX A;  5KP6 B;  1K9M Q;  1VQK P;  5HGK A;  2FQ2 A;  1E6J P;  1A8O A;  3B4Q A;  3DS2 A;  2LPK A;  3CCM P;  5F2N A;  1MZ8 A;  2LF4 A;  1K30 A;  5JPA A;  2K93 A;  2N6Z A;  2KG6 A;  1P7N A;  2JQ4 A;  3H47 A;  4DGA C;  1YJN P;  2BUO A;  2PNG A;  1OR5 A;  2K0Y A;  1DNY A;  3WBH A;  1VQO P;  2PEK A;  3GJN A;  3H0D A;  1YIT P;  4U0C A;  4GR6 A;  1UJZ A;  3U43 A;  2KGD A;  2K92 A;  2L6E A;  2GON A;  2MVU A;  2FQ1 A;  1VQ9 P;  3CC4 P;  2CQ8 A;  4XRQ A;  4XFX A;  2X82 A;  2GZI A;  1M6N A;  2LOL A;  1VQ5 P;  1NJI Q;  2V4X A;  2VLP A;  1AFV A;  3CXC O;  2JGP A;  2L4B A;  2PEJ A;  1GXH A;  2KGC A;  1ZMB A;  2JO0 A;  1YI2 P;  3EJB A;  3G26 A;  2N98 A;  5HGL A;  3CCL P;  2KWL A;  2X2B A;  1GPJ A;  4H2W C;  5BS1 A;  3HZQ A;  1M1K Q;  3I56 P;  4COC A;  1BAJ A;  1IMQ A;  3RG6 C;  4U0D A;  1VKU A;  2JU2 A;  2WLV B;  1X3O A;  4BPG A;  1KLP A;  1NQ4 A;  5KP7 B;  3OW2 O;  4PH0 A;  1T8K A;  2N6Y A;  2KW2 A;  1CEI A;  4M0I A;  3CCV P;  2LKI A;  4U0A A;  2MY5 A;  2GZJ A;  2JYL A;  1D1D A;  3NY7 B;  4E91 A;  3CE7 A;  1L0H A;  1KQS O;  1BXI A;  1GXG A;  2FAD A;  1U7K A;  1VQN P;  2NO8 A;  2PEO A;  2Z44 A;  3G0V A;  4BPF A;  3G1G A;  2KOO A;  2KOS A;  3DPH A;  2CGQ A;  2KOP A;  2EHT A;  4XRO A;  2JPR A;  3G1I A;  3CCU P;  2AFE A;  2XXM A;  2M8N A;  1N8R Q;  2Y4Z A;  1G03 A;  3B5I A;  4U0B A;  3G29 A;  2P9X A;  2XGY A;  4H2Y C;  1QRJ A;  2QEX P;  2CG5 B;  1AF8 A;  2GDW A;  1K73 Q;  2BHV A;  2GZE A;  2XZ0 D;  3CPW O;  4NX4 C;  1JJ2 O;  1YJW P;  4E92 A;  4QNB A;  1FR2 A;  4MRT C;  2K0X A;  4PWV B;  1M9D C;  2AFD A;  2Z45 A;  1EM9 A;  2PEN A;  2DGY A;  3LMO A;  2MR8 A;  4U0E A;  1M9C C;  2XGU A;  2FHS C;  4GR2 A;  2MF4 A;  1KC8 Q;  2LL8 A;  2QNW A;  1UNK A;  2K5X A;  2N50 A;  2DNW A;  3G6E P;  3M1M A;  2L0Q A;  5HVC A;  3CMA P;  2ROQ A;  3DS4 A;  2LIW A;  1VQM P;  5I4T G;  2X83 A;  1M9Y C;  4QKO A;  1F80 D;  3GKL C;  1HQB A;  5BS2 A;  2KG9 A;  2GDY A;  2KG8 A;  3EJE A;  4B4N A;  3GZL A;  4R0M A;  2K0D X;  3H4E A;  2LML A;  3CCQ P;  2KOR A;  2EIA A;  1HY8 A;  1VQP P;  1L6N A;  1Q86 Q;  4NEO A;  1RO2 A;  1E0H A;  4COP A;  2MD9 A;  2MR7 A;  4HTW A;  4DGE C;  2ERH A;  4XFY A;  2OTJ P; 
#chains in the Genus database with same CATH homology
 4U0B A;  2EFJ A;  3G29 A;  1VQ9 P;  2JYG A;  2P9X A;  3LRY A;  3CCJ P;  3CC4 P;  2X2D D;  4XFX A;  2X82 A;  4XRQ A;  2XGY A;  2QA4 P;  1QRJ A;  1M6N A;  3DS1 A;  2M8P A;  1Q7Y Q;  2QEX P;  3MGE A;  2KOD A;  1VQ5 P;  1IUQ A;  1NJI Q;  3CCS P;  5DCK A;  1K73 Q;  2V4X A;  3CC2 P;  2BHV A;  1AFV A;  3CXC O;  1VQ8 P;  1KD1 Q;  5HGN A;  2PEM A;  4IPY A;  2PEJ A;  4NX4 C;  3CPW O;  3CCR P;  2PEI A;  1ZMB A;  4PH1 A;  5HGM A;  1YJ9 P;  1Q81 Q;  1JJ2 O;  1YJW P;  4E92 A;  3E2D A;  1M9F C;  4QNB A;  2JO0 A;  2Z46 A;  1YI2 P;  1VQ4 P;  1M9D C;  2ONT A;  1A43 A;  1QVF O;  2Z45 A;  3G26 A;  1EM9 A;  4PH3 A;  3I55 P;  1Q82 Q;  1K8A Q;  2E1M A;  2PEN A;  5HGL A;  2DGY A;  3P05 A;  4LQW C;  3CCL P;  1M90 Q;  3CCE P;  3DS0 A;  1M9E C;  4U0E A;  5BS1 A;  1M9C C;  2XGU A;  2EG5 A;  3HZQ A;  1M1K Q;  3I56 P;  1YIJ P;  2PEQ A;  4COC A;  1BAJ A;  4PH2 A;  2PXR C;  3G71 P;  4GR2 A;  1RNI A;  3DS3 A;  1KC8 Q;  2OAR A;  2XT1 A;  3RG6 C;  4U0D A;  5F2K A;  3BP9 A;  1EIA A;  2WLV B;  3NTE A;  4WYM A;  1GWP A;  3DS5 A;  3G4S P;  3G6E P;  2XGV A;  4INB A;  1S72 P;  4XFZ A;  3M1M A;  1VQL P;  5HGO A;  3CMA P;  4PH0 A;  3OW2 O;  1VQ6 P;  2GOL B;  1W2B O;  3DS4 A;  1VQ7 P;  1EOQ A;  4M0I A;  3CCV P;  3VRL C;  4U0A A;  3G28 A;  2PY8 A;  1K9M Q;  2XDE A;  1VQM P;  2JYL A;  2X83 A;  5HGK A;  5I4T G;  1VQK P;  1M9Y C;  3Q20 A;  1D1D A;  4E91 A;  4J93 A;  5F2O A;  1E6J P;  2WLV A;  1A8O A;  1M74 A;  2XV6 A;  3DS2 A;  1KQS O;  5BS2 A;  3CME P;  2KGF A;  4U0F A;  3CCM P;  1U7K A;  5F2N A;  2M8L A;  1VQN P;  2PEO A;  2Z44 A;  3G0V A;  2LF4 A;  1K30 A;  5JPA A;  4B4N A;  3CD6 P;  3G1G A;  3H4E A;  1AK4 C;  1P7N A;  1RO0 A;  3DPH A;  3H47 A;  3CCQ P;  1AUM A;  3G21 A;  4DGA C;  1YJN P;  2BUO A;  1M6E X;  2EIA A;  3WBH A;  1VQP P;  1VQO P;  3DTJ A;  2PEK A;  4XRO A;  1YHQ P;  2JPR A;  3G1I A;  3H0D A;  1M9X C;  1L6N A;  1YIT P;  2PWO A;  3CCU P;  4U0C A;  4GR6 A;  1Q86 Q;  1RO2 A;  2OTL P;  4COP A;  2XXM A;  2M8N A;  3HYB A;  4HTW A;  2CWO A;  1N8R Q;  2Y4Z A;  1QVG O;  4DGE C;  3CC7 P;  1G03 A;  2PWM A;  2L6E A;  3B5I A;  4XFY A;  2GON A;  2OTJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...