4U0BA

Hexamer hiv-1 ca in complex with cpsf6 peptide, p212121 crystal form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
208
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 75
structure length 208
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0bA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0bA02
1M9CC 1M9YC 2GONA 3H4EA 4XFYA 5HGKA 2X82A 3DS4A 1M9FC 1E6JP 4XROA 2ONTA 4J93A 4U0EA 3LRYA 4U0DA 2PWMA 2M8PA 4PH2A 3DS3A 4E91A 5HGMA 3DPHA 1QRJA 5DCKA 3G1GA 1M9DC 3DS0A 4B4NA 2KGFA 1M9XC 3DS2A 3DTJA 4DGEC 1A43A 2XGUA 4PH3A 1AK4C 3G0VA 3BP9A 4PH0A 2GOLB 3NTEA 4INBA 4WYMA 2XGVA 2JO0A 3DS5A 1M9EC 2M8NA 1P7NA 2PWOA 1L6NA 4HTWA 4U0CA 2WLVA 1EIAA 2Y4ZA 5HGOA 1AUMA 4NX4C 2PXRC 2BUOA 2L6EA 4LQWC 4XFXA 5HGNA 3DS1A 2XGYA 3G1IA 2JYGA 4U0BA 4IPYA 3MGEA 5I4TG 2XT1A 4XRQA 1EM9A 5HGLA 2X83A 3H47A 4COPA 1BAJA 2XV6A 1A8OA 2XDEA 4QNBA 4M0IA 4U0FA 3G28A 2WLVB 1G03A 2XXMA 3G21A 3G26A 3VRLC 4E92A 2JPRA 3G29A 4PH1A 2LF4A 2KODA 4XFZA 4COCA 4DGAC 3P05A 2M8LA 2X2DD 1D1DA 1GWPA 1EOQA 2EIAA 5JPAA 2JYLA 4U0AA 1AFVA 2V4XA 1U7KA
chains in the Genus database with same CATH superfamily
1M9YC 2GONA 4MRTC 2LL8A 4XFYA 2FACA 1VQOP 2FQ0A 2KOQA 1YJWP 2FHSC 2PWMA 2M8PA 2K0DX 5HGMA 2EG5A 3DPHA 2N5HA 2CWOA 2MF4A 3DTJA 1M9XC 1N8RQ 1GXHA 1HQBA 3B4QA 3CPWO 1M1KQ 5KP8B 3NTEA 3I55P 1VQ5P 1RO2A 4WYMA 3CCEP 2XGVA 5BS1A 1P7NA 1VQKP 1Q86Q 1EIAA 4NX4C 2X2BA 3GZLA 2BHVA 2K0YA 1YIJP 3Q20A 2EHSA 3GJNA 4DG9A 2M5RA 4U0BA 1GXGA 5I4TG 1VQMP 2XT1A 4XRQA 1EM9A 2FVFA 4COPA 2FVEA 2DGYA 2XDEA 1K30A 2GZEA 4M0IA 4U0FA 3G28A 2MY5A 1GPJA 2L9FA 4IZ6A 2XXMA 1VQ4P 3G26A 3EJDA 3VRLC 4R0MA 3B5IA 2VLQA 3CCUP 2LF4A 1M74A 2PY8A 2LKIA 5KP6B 2X2DD 2GYKA 7CEIA 1EOQA 3CCRP 2PEJA 1VHNA 1VQ8P 2Z45A 2DNWA 3CCLP 1U7KA 3EJEA 5EW5E 2PENA 3H4EA 3HZQA 3CCJP 2AVAA 4U0EA 2E1MA 4U0DA 2Z46A 3I56P 1VQ6P 1EMVA 4QKOA 4E91A 1S72P 2L22A 2PEKA 1VQPP 2KGEA 2LOLA 1KLPA 2N50A 1M6NA 1QRJA 1M9DC 5KP7B 1K8AQ 4HKGA 4UHPB 3G0VA 5HVCA 1IUQA 2OTLP 1M9EC 3G6EP 3CCQP 2GDYA 2WLVA 1W2BO 1UNKA 2MVUA 2LTEA 2BUOA 3OW2O 4LQWC 1NQ4A 2JU1A 3CD6P 2XGYA 3G1IA 2KOSA 2XZ0D 5F2NA 2JAZA 1BAJA 1IMQA 2XV6A 1QVFO 3NY7B 4QNBA 2LIWA 2N6ZA 2WLVB 1G03A 4F37A 2KG6A 2N6YA 3CMAP 1AF8A 2VLPA 3G21A 2JU2A 5CZDB 2Z44A 2JPRA 2KWLA 1RO0A 4BPFA 2KODA 4XFZA 1HY8A 4COCA 2VLNA 1YITP 2M8LA 3WBHA 4BPHA 2N5IA 2P9XA 2FVAA 1AYIA 1F80D 2KGDA 1E6JP 1ZNVA 2KGCA 4XROA 2ONTA 2VLOA 1JJ2O 4J93A 3LRYA 3LMOA 4GR2A 2AF8A 4PH2A 3HYBA 2CG5B 1IMPA 2LPKA 1DNYA 5DCKA 3GKLC 4DGEC 1A43A 2XGUA 3CCVP 1AK4C 2JBGA 3BP9A 2LMLA 3CMEP 2FAEA 4PH0A 3EJBA 4INBA 2MVVA 2VSQA 2PEQA 1E0HA 1L6NA 2M8NA 2PWOA 4U0CA 1NJIQ 5F2OA 2Y4ZA 3H0DA 2OTJP 3CC4P 1L0HA 2PXRC 1CEIA 2ROQA 3RG6C 1DV5A 5HGNA 3DS1A 1VQ7P 2JYGA 2L0QA 3MGEA 1M90Q 3G71P 1Q81Q 5HGLA 2GDWA 1YJ9P 1Q82Q 2GDXA 3H47A 2KR5A 2K94A 2KORA 1A8OA 3GZMA 2PEOA 3CC7P 2K5XA 2MR7A 1X3OA 3CC2P 2CNRA 2CGQA 3M1MA 2FQ1A 2JQ4A 3RG2A 4BPGA 3P05A 2FADA 4PXHB 1L0IA 2K92A 2LIUA 2XZ1C 2MR8A 2AFDA 1ZMBA 1M9CC 2GZIA 5HGKA 2X82A 3DS4A 1M9FC 1RNIA 2KOPA 5F2KA 1YHQP 2L4BA 2QEXP 3DS3A 1KD1Q 2KG9A 3G1GA 3CCSP 3DS0A 1QVGO 1VQLP 4B4NA 2KGFA 2K2QA 3DS2A 1T8KA 1VKUA 2EHTA 4PH3A 1YJNP 5HV8A 1ACPA 1MZ8A 2GOLB 4H2XC 2GZFA 2AFEA 3E2DA 2JO0A 3DS5A 1YI2P 4HTWA 3G4SP 2CQ8A 4CA3A 1VQNP 2KG8A 2OARA 5HGOA 2KGAA 1AUMA 2K0XA 2JB0A 2L6EA 2PEMA 1Z6MA 1OR5A 4XFXA 2PEIA 2KOOA 4IPYA 1KC8Q 1K73Q 2N98A 3CCMP 1FR2A 1M6EX 1UJZA 2X83A 3CXCO 2PNGA 5EJDA 2QA4P 2MD9A 1KQSO 3CE7A 4PWVB 1VQ9P 4H2YC 2JGPA 3U43A 2NO8A 4GR6A 2GZGA 5BS2A 2QNWA 1K9MQ 4E92A 2ERHA 2WPTA 2K93A 3G29A 4PH1A 4NEOA 4DGAC 1Q7YQ 1D1DA 1GWPA 2FQ2A 2EIAA 5JPAA 2EFJA 2JYLA 4U0AA 4H2WC 1AFVA 2V4XA 1BXIA 2GZJA 2KW2A
chains in the Genus database with same CATH topology
1M9CC 1M9YC 2GONA 2PENA 3H4EA 4XFYA 5HGKA 2X82A 3DS4A 3HZQA 3CCJP 1M9FC 1E6JP 1VQOP 4XROA 2ONTA 1JJ2O 4J93A 4U0EA 1RNIA 3LRYA 2E1MA 4U0DA 2Z46A 5F2KA 3I56P 1YHQP 1VQ6P 1YJWP 4GR2A 2PWMA 2M8PA 2QEXP 4PH2A 3DS3A 4E91A 1KD1Q 1S72P 5HGMA 2EG5A 3HYBA 2PEKA 3DPHA 1VQPP 2CWOA 1M6NA 1QRJA 5DCKA 3G1GA 3CCSP 1M9DC 3DS0A 1QVGO 1VQLP 4B4NA 2KGFA 1M9XC 3DS2A 3DTJA 1N8RQ 1K8AQ 4DGEC 1A43A 2XGUA 3CCVP 3CPWO 4PH3A 1YJNP 1AK4C 3G0VA 3BP9A 3CMEP 1M1KQ 4PH0A 2GOLB 3NTEA 4INBA 3I55P 1VQ5P 1RO2A 2PEQA 4WYMA 3E2DA 3CCEP 2XGVA 1IUQA 2JO0A 1M9EC 2M8NA 1P7NA 2PWOA 1L6NA 3DS5A 4HTWA 5BS1A 3G4SP 3G6EP 1YI2P 3CCQP 4U0CA 1VQKP 1VQNP 2OTLP 1NJIQ 5F2OA 1Q86Q 2WLVA 1EIAA 1W2BO 2Y4ZA 5HGOA 2OARA 3H0DA 1AUMA 2OTJP 4NX4C 2BHVA 1YIJP 3CC4P 2PXRC 2BUOA 2L6EA 2PEMA 3OW2O 4LQWC 4XFXA 2PEIA 3CD6P 3Q20A 3RG6C 5HGNA 3DS1A 2XGYA 3G1IA 1VQ7P 2JYGA 4U0BA 4IPYA 1KC8Q 1K73Q 3MGEA 5I4TG 3CCMP 2XT1A 4XRQA 1M6EX 3G71P 1EM9A 1VQMP 1Q81Q 1M90Q 5HGLA 2X83A 3CXCO 1YJ9P 2QA4P 1Q82Q 3H47A 5F2NA 1KQSO 4COPA 1BAJA 2DGYA 1VQ9P 2XV6A 1QVFO 1A8OA 2XDEA 4QNBA 1K30A 2PEOA 4M0IA 4U0FA 3G28A 3CC7P 2WLVB 1G03A 4GR6A 3CMAP 3CC2P 2XXMA 3G21A 5BS2A 1VQ4P 3G26A 3VRLC 1K9MQ 3B5IA 4E92A 3M1MA 2Z44A 2JPRA 3G29A 4PH1A 1RO0A 3CCUP 2LF4A 2KODA 4XFZA 1M74A 2PY8A 4COCA 1YITP 4DGAC 3P05A 2M8LA 3WBHA 2X2DD 1Q7YQ 1D1DA 1GWPA 1EOQA 3CCRP 2EIAA 5JPAA 2EFJA 2PEJA 1VQ8P 2JYLA 2Z45A 4U0AA 1AFVA 2V4XA 1ZMBA 2P9XA 3CCLP 1U7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9C C;  1M9Y C;  2GON A;  3H4E A;  4XFY A;  5HGK A;  2X82 A;  3DS4 A;  1M9F C;  1E6J P;  4XRO A;  2ONT A;  4J93 A;  4U0E A;  3LRY A;  4U0D A;  2PWM A;  2M8P A;  4PH2 A;  3DS3 A;  4E91 A;  5HGM A;  3DPH A;  1QRJ A;  5DCK A;  3G1G A;  1M9D C;  3DS0 A;  4B4N A;  2KGF A;  1M9X C;  3DS2 A;  3DTJ A;  4DGE C;  1A43 A;  2XGU A;  4PH3 A;  1AK4 C;  3G0V A;  3BP9 A;  4PH0 A;  2GOL B;  3NTE A;  4INB A;  4WYM A;  2XGV A;  2JO0 A;  3DS5 A;  1M9E C;  2M8N A;  1P7N A;  2PWO A;  1L6N A;  4HTW A;  4U0C A;  2WLV A;  1EIA A;  2Y4Z A;  5HGO A;  1AUM A;  4NX4 C;  2PXR C;  2BUO A;  2L6E A;  4LQW C;  4XFX A;  5HGN A;  3DS1 A;  2XGY A;  3G1I A;  2JYG A;  4U0B A;  4IPY A;  3MGE A;  5I4T G;  2XT1 A;  4XRQ A;  1EM9 A;  5HGL A;  2X83 A;  3H47 A;  4COP A;  1BAJ A;  2XV6 A;  1A8O A;  2XDE A;  4QNB A;  4M0I A;  4U0F A;  3G28 A;  2WLV B;  1G03 A;  2XXM A;  3G21 A;  3G26 A;  3VRL C;  4E92 A;  2JPR A;  3G29 A;  4PH1 A;  2LF4 A;  2KOD A;  4XFZ A;  4COC A;  4DGA C;  3P05 A;  2M8L A;  2X2D D;  1D1D A;  1GWP A;  1EOQ A;  2EIA A;  5JPA A;  2JYL A;  4U0A A;  1AFV A;  2V4X A;  1U7K A; 
#chains in the Genus database with same CATH topology
 1M9Y C;  2GON A;  4MRT C;  2LL8 A;  4XFY A;  2FAC A;  1VQO P;  2FQ0 A;  2KOQ A;  1YJW P;  2FHS C;  2PWM A;  2M8P A;  2K0D X;  5HGM A;  2EG5 A;  3DPH A;  2N5H A;  2CWO A;  2MF4 A;  3DTJ A;  1M9X C;  1N8R Q;  1GXH A;  1HQB A;  3B4Q A;  3CPW O;  1M1K Q;  5KP8 B;  3NTE A;  3I55 P;  1VQ5 P;  1RO2 A;  4WYM A;  3CCE P;  2XGV A;  5BS1 A;  1P7N A;  1VQK P;  1Q86 Q;  1EIA A;  4NX4 C;  2X2B A;  3GZL A;  2BHV A;  2K0Y A;  1YIJ P;  3Q20 A;  2EHS A;  3GJN A;  4DG9 A;  2M5R A;  4U0B A;  1GXG A;  5I4T G;  1VQM P;  2XT1 A;  4XRQ A;  1EM9 A;  2FVF A;  4COP A;  2FVE A;  2DGY A;  2XDE A;  1K30 A;  2GZE A;  4M0I A;  4U0F A;  3G28 A;  2MY5 A;  1GPJ A;  2L9F A;  4IZ6 A;  2XXM A;  1VQ4 P;  3G26 A;  3EJD A;  3VRL C;  4R0M A;  3B5I A;  2VLQ A;  3CCU P;  2LF4 A;  1M74 A;  2PY8 A;  2LKI A;  5KP6 B;  2X2D D;  2GYK A;  7CEI A;  1EOQ A;  3CCR P;  2PEJ A;  1VHN A;  1VQ8 P;  2Z45 A;  2DNW A;  3CCL P;  1U7K A;  3EJE A;  5EW5 E;  2PEN A;  3H4E A;  3HZQ A;  3CCJ P;  2AVA A;  4U0E A;  2E1M A;  4U0D A;  2Z46 A;  3I56 P;  1VQ6 P;  1EMV A;  4QKO A;  4E91 A;  1S72 P;  2L22 A;  2PEK A;  1VQP P;  2KGE A;  2LOL A;  1KLP A;  2N50 A;  1M6N A;  1QRJ A;  1M9D C;  5KP7 B;  1K8A Q;  4HKG A;  4UHP B;  3G0V A;  5HVC A;  1IUQ A;  2OTL P;  1M9E C;  3G6E P;  3CCQ P;  2GDY A;  2WLV A;  1W2B O;  1UNK A;  2MVU A;  2LTE A;  2BUO A;  3OW2 O;  4LQW C;  1NQ4 A;  2JU1 A;  3CD6 P;  2XGY A;  3G1I A;  2KOS A;  2XZ0 D;  5F2N A;  2JAZ A;  1BAJ A;  1IMQ A;  2XV6 A;  1QVF O;  3NY7 B;  4QNB A;  2LIW A;  2N6Z A;  2WLV B;  1G03 A;  4F37 A;  2KG6 A;  2N6Y A;  3CMA P;  1AF8 A;  2VLP A;  3G21 A;  2JU2 A;  5CZD B;  2Z44 A;  2JPR A;  2KWL A;  1RO0 A;  4BPF A;  2KOD A;  4XFZ A;  1HY8 A;  4COC A;  2VLN A;  1YIT P;  2M8L A;  3WBH A;  4BPH A;  2N5I A;  2P9X A;  2FVA A;  1AYI A;  1F80 D;  2KGD A;  1E6J P;  1ZNV A;  2KGC A;  4XRO A;  2ONT A;  2VLO A;  1JJ2 O;  4J93 A;  3LRY A;  3LMO A;  4GR2 A;  2AF8 A;  4PH2 A;  3HYB A;  2CG5 B;  1IMP A;  2LPK A;  1DNY A;  5DCK A;  3GKL C;  4DGE C;  1A43 A;  2XGU A;  3CCV P;  1AK4 C;  2JBG A;  3BP9 A;  2LML A;  3CME P;  2FAE A;  4PH0 A;  3EJB A;  4INB A;  2MVV A;  2VSQ A;  2PEQ A;  1E0H A;  1L6N A;  2M8N A;  2PWO A;  4U0C A;  1NJI Q;  5F2O A;  2Y4Z A;  3H0D A;  2OTJ P;  3CC4 P;  1L0H A;  2PXR C;  1CEI A;  2ROQ A;  3RG6 C;  1DV5 A;  5HGN A;  3DS1 A;  1VQ7 P;  2JYG A;  2L0Q A;  3MGE A;  1M90 Q;  3G71 P;  1Q81 Q;  5HGL A;  2GDW A;  1YJ9 P;  1Q82 Q;  2GDX A;  3H47 A;  2KR5 A;  2K94 A;  2KOR A;  1A8O A;  3GZM A;  2PEO A;  3CC7 P;  2K5X A;  2MR7 A;  1X3O A;  3CC2 P;  2CNR A;  2CGQ A;  3M1M A;  2FQ1 A;  2JQ4 A;  3RG2 A;  4BPG A;  3P05 A;  2FAD A;  4PXH B;  1L0I A;  2K92 A;  2LIU A;  2XZ1 C;  2MR8 A;  2AFD A;  1ZMB A;  1M9C C;  2GZI A;  5HGK A;  2X82 A;  3DS4 A;  1M9F C;  1RNI A;  2KOP A;  5F2K A;  1YHQ P;  2L4B A;  2QEX P;  3DS3 A;  1KD1 Q;  2KG9 A;  3G1G A;  3CCS P;  3DS0 A;  1QVG O;  1VQL P;  4B4N A;  2KGF A;  2K2Q A;  3DS2 A;  1T8K A;  1VKU A;  2EHT A;  4PH3 A;  1YJN P;  5HV8 A;  1ACP A;  1MZ8 A;  2GOL B;  4H2X C;  2GZF A;  2AFE A;  3E2D A;  2JO0 A;  3DS5 A;  1YI2 P;  4HTW A;  3G4S P;  2CQ8 A;  4CA3 A;  1VQN P;  2KG8 A;  2OAR A;  5HGO A;  2KGA A;  1AUM A;  2K0X A;  2JB0 A;  2L6E A;  2PEM A;  1Z6M A;  1OR5 A;  4XFX A;  2PEI A;  2KOO A;  4IPY A;  1KC8 Q;  1K73 Q;  2N98 A;  3CCM P;  1FR2 A;  1M6E X;  1UJZ A;  2X83 A;  3CXC O;  2PNG A;  5EJD A;  2QA4 P;  2MD9 A;  1KQS O;  3CE7 A;  4PWV B;  1VQ9 P;  4H2Y C;  2JGP A;  3U43 A;  2NO8 A;  4GR6 A;  2GZG A;  5BS2 A;  2QNW A;  1K9M Q;  4E92 A;  2ERH A;  2WPT A;  2K93 A;  3G29 A;  4PH1 A;  4NEO A;  4DGA C;  1Q7Y Q;  1D1D A;  1GWP A;  2FQ2 A;  2EIA A;  5JPA A;  2EFJ A;  2JYL A;  4U0A A;  4H2W C;  1AFV A;  2V4X A;  1BXI A;  2GZJ A;  2KW2 A; 
#chains in the Genus database with same CATH homology
 1M9C C;  1M9Y C;  2GON A;  2PEN A;  3H4E A;  4XFY A;  5HGK A;  2X82 A;  3DS4 A;  3HZQ A;  3CCJ P;  1M9F C;  1E6J P;  1VQO P;  4XRO A;  2ONT A;  1JJ2 O;  4J93 A;  4U0E A;  1RNI A;  3LRY A;  2E1M A;  4U0D A;  2Z46 A;  5F2K A;  3I56 P;  1YHQ P;  1VQ6 P;  1YJW P;  4GR2 A;  2PWM A;  2M8P A;  2QEX P;  4PH2 A;  3DS3 A;  4E91 A;  1KD1 Q;  1S72 P;  5HGM A;  2EG5 A;  3HYB A;  2PEK A;  3DPH A;  1VQP P;  2CWO A;  1M6N A;  1QRJ A;  5DCK A;  3G1G A;  3CCS P;  1M9D C;  3DS0 A;  1QVG O;  1VQL P;  4B4N A;  2KGF A;  1M9X C;  3DS2 A;  3DTJ A;  1N8R Q;  1K8A Q;  4DGE C;  1A43 A;  2XGU A;  3CCV P;  3CPW O;  4PH3 A;  1YJN P;  1AK4 C;  3G0V A;  3BP9 A;  3CME P;  1M1K Q;  4PH0 A;  2GOL B;  3NTE A;  4INB A;  3I55 P;  1VQ5 P;  1RO2 A;  2PEQ A;  4WYM A;  3E2D A;  3CCE P;  2XGV A;  1IUQ A;  2JO0 A;  1M9E C;  2M8N A;  1P7N A;  2PWO A;  1L6N A;  3DS5 A;  4HTW A;  5BS1 A;  3G4S P;  3G6E P;  1YI2 P;  3CCQ P;  4U0C A;  1VQK P;  1VQN P;  2OTL P;  1NJI Q;  5F2O A;  1Q86 Q;  2WLV A;  1EIA A;  1W2B O;  2Y4Z A;  5HGO A;  2OAR A;  3H0D A;  1AUM A;  2OTJ P;  4NX4 C;  2BHV A;  1YIJ P;  3CC4 P;  2PXR C;  2BUO A;  2L6E A;  2PEM A;  3OW2 O;  4LQW C;  4XFX A;  2PEI A;  3CD6 P;  3Q20 A;  3RG6 C;  5HGN A;  3DS1 A;  2XGY A;  3G1I A;  1VQ7 P;  2JYG A;  4U0B A;  4IPY A;  1KC8 Q;  1K73 Q;  3MGE A;  5I4T G;  3CCM P;  2XT1 A;  4XRQ A;  1M6E X;  3G71 P;  1EM9 A;  1VQM P;  1Q81 Q;  1M90 Q;  5HGL A;  2X83 A;  3CXC O;  1YJ9 P;  2QA4 P;  1Q82 Q;  3H47 A;  5F2N A;  1KQS O;  4COP A;  1BAJ A;  2DGY A;  1VQ9 P;  2XV6 A;  1QVF O;  1A8O A;  2XDE A;  4QNB A;  1K30 A;  2PEO A;  4M0I A;  4U0F A;  3G28 A;  3CC7 P;  2WLV B;  1G03 A;  4GR6 A;  3CMA P;  3CC2 P;  2XXM A;  3G21 A;  5BS2 A;  1VQ4 P;  3G26 A;  3VRL C;  1K9M Q;  3B5I A;  4E92 A;  3M1M A;  2Z44 A;  2JPR A;  3G29 A;  4PH1 A;  1RO0 A;  3CCU P;  2LF4 A;  2KOD A;  4XFZ A;  1M74 A;  2PY8 A;  4COC A;  1YIT P;  4DGA C;  3P05 A;  2M8L A;  3WBH A;  2X2D D;  1Q7Y Q;  1D1D A;  1GWP A;  1EOQ A;  3CCR P;  2EIA A;  5JPA A;  2EFJ A;  2PEJ A;  1VQ8 P;  2JYL A;  2Z45 A;  4U0A A;  1AFV A;  2V4X A;  1ZMB A;  2P9X A;  3CCL P;  1U7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...