4U0BA

Hexamer hiv-1 ca in complex with cpsf6 peptide, p212121 crystal form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 75
structure length 208
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0bA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0bA02
5HGLA 2M8NA 1AUMA 4HTWA 2BUOA 3G21A 3DS0A 4U0FA 2GONA 2XGUA 4DGEC 3G1IA 3DS4A 3BP9A 2WLVB 4PH2A 4E91A 5JPAA 2XDEA 1EOQA 2PWMA 1AK4C 3DS3A 2JYGA 3DPHA 3DS1A 3DTJA 4PH1A 3LRYA 3G28A 4COCA 2X83A 4INBA 4PH3A 2EIAA 1M9YC 3P05A 2JYLA 5HGMA 4XROA 4XFYA 2KGFA 4XFXA 4PH0A 4XRQA 4U0BA 5HGNA 1A43A 3H47A 1GWPA 4XFZA 3H4EA 2XT1A 5DCKA 1M9DC 2XGYA 2V4XA 1M9EC 4E92A 1P7NA 1G03A 4U0EA 3G0VA 3G29A 3DS5A 2PWOA 1A8OA 4J93A 1U7KA 2L6EA 5HGOA 3NTEA 4DGAC 4U0AA 2LF4A 4B4NA 1M9FC 2JO0A 1EIAA 4LQWC 3G26A 3G1GA 5HGKA 2PXRC 1D1DA 1BAJA 1EM9A 4COPA 1L6NA 4QNBA 2XGVA 2X82A 2GOLB 2JPRA 2M8LA 4WYMA 2WLVA 4M0IA 2M8PA 2XV6A 3DS2A 2ONTA 2KODA 2X2DD 3MGEA 2XXMA 1M9XC 1QRJA 4U0CA 4U0DA 1E6JP 5I4TG 1M9CC 1AFVA 4NX4C 4IPYA 2Y4ZA 3VRLC
chains in the Genus database with same CATH superfamily
1CEIA 1UJZA 3CCUP 2K94A 1VQNP 1ZMBA 2L22A 2JGPA 2JQ4A 3CCSP 2BUOA 3NY7B 1GXGA 3CCLP 2LIWA 4DGEC 3G1IA 2VLPA 4BPGA 4HKGA 3CCJP 3DS1A 4PXHB 2X83A 2KG8A 4INBA 1Q81Q 1BXIA 4PH3A 1VQ6P 1IUQA 2GDXA 2NO8A 3CCRP 2E1MA 3GJNA 2GZIA 3B4QA 4BPHA 4XFXA 4XRQA 2EFJA 5HGNA 5F2NA 2KGAA 5EJDA 4R0MA 4CA3A 4QKOA 5DCKA 1M9DC 1M9EC 5KP8B 3EJBA 3RG2A 1VQ8P 1UNKA 4U0EA 3G0VA 1KLPA 2MF4A 4BPFA 1U7KA 2PEQA 2Z44A 1VQ5P 2CWOA 2CGQA 1VQMP 3GZLA 1EMVA 4LQWC 2N50A 1L0IA 5BS1A 1HY8A 1JJ2O 2X82A 2GOLB 2DNWA 1VQ7P 2K93A 4GR2A 1OR5A 2K0YA 2XV6A 2X2DD 2K0XA 2KG6A 1W2BO 4H2WC 2GZJA 2EHSA 3G6EP 4NX4C 4NEOA 4IPYA 2N6YA 2Y4ZA 2GZEA 3H0DA 2P9XA 2FVFA 1AUMA 2AF8A 4HTWA 2KORA 1HQBA 1KQSO 1FR2A 1NQ4A 5EW5E 3EJEA 2DGYA 2LOLA 2LMLA 1M90Q 2AVAA 3GKLC 3BP9A 2WLVB 4PH2A 4E91A 2KOPA 3U43A 1NJIQ 2GZFA 2JYGA 2KGCA 1AYIA 2LKIA 1YITP 2KG9A 3CC4P 3CC2P 2EG5A 4PH1A 3G28A 1M74A 1Q7YQ 2BHVA 2M5RA 1DNYA 2EIAA 1RO0A 3OW2O 4XROA 1L0HA 4XFYA 1K30A 2KOOA 4PH0A 4U0BA 4H2XC 2JB0A 3CMAP 1VQPP 2LPKA 2JU1A 2JU2A 2XT1A 4PWVB 1AF8A 2PEIA 1G03A 1VQOP 1A8OA 4J93A 2FVEA 2KGEA 3NTEA 4U0AA 2KGDA 4B4NA 1M9FC 2JO0A 1YI2P 2ROQA 3G1GA 2FVAA 2VLQA 3CCMP 2PXRC 3CD6P 3I56P 1QVFO 2FQ1A 2PEJA 2L4BA 4IZ6A 2M8LA 2MR8A 1M6EX 2PY8A 4M0IA 2M8PA 3MGEA 1QRJA 3CC7P 4U0DA 1M6NA 1GPJA 2FAEA 3DTJA 3HYBA 3B5IA 1F80D 1DV5A 3I55P 1ACPA 2K0DX 5F2OA 2PENA 2KR5A 1N8RQ 2L9FA 1VQ4P 1Z6MA 2XDEA 2PWMA 1AK4C 3DS3A 3DPHA 2CQ8A 3LRYA 4COCA 2LIUA 1S72P 3CCQP 1RNIA 1M9YC 1M1KQ 3G4SP 1K9MQ 1VHNA 1Q86Q 2Z46A 4UHPB 2KW2A 2KGFA 5KP6B 2XZ0D 2QA4P 1A43A 3G71P 3H47A 1GWPA 1YJ9P 2AFEA 3H4EA 2JBGA 2N98A 4E92A 1YJWP 2OTLP 2K92A 3DS5A 2PWOA 2N5IA 3RG6C 5HVCA 2GZGA 3CE7A 2AFDA 3LMOA 2LF4A 1T8KA 1EIAA 2EHTA 5HGKA 3Q20A 2K5XA 1K73Q 2FQ0A 1BAJA 2PNGA 1EM9A 4GR6A 1L6NA 2XGVA 2KWLA 4DG9A 3HZQA 2L0QA 2JPRA 3M1MA 2ONTA 2KODA 1E0HA 2XXMA 7CEIA 4U0CA 1E6JP 1IMQA 2VLNA 1X3OA 3E2DA 2MVUA 5I4TG 3WBHA 1M9CC 1VQKP 3VRLC 4MRTC 2OARA 5HGLA 2M8NA 2CG5B 3G21A 3DS0A 1MZ8A 2PEMA 4U0FA 2GDWA 2GONA 2XGUA 3DS4A 2WPTA 3CPWO 1VQLP 1YJNP 5JPAA 2K2QA 1EOQA 2FQ2A 1QVGO 2FHSC 1YIJP 1VQ9P 2VSQA 1KC8Q 1GXHA 2JAZA 2N5HA 3P05A 2JYLA 5HGMA 2KOSA 2MVVA 2Z45A 2GDYA 2VLOA 2ERHA 4XFZA 3CXCO 4H2YC 2XGYA 5F2KA 5KP7B 2V4XA 1Q82Q 3CCVP 2LL8A 2OTJP 1P7NA 3G29A 2L6EA 5HGOA 3CCEP 4DGAC 1YHQP 1KD1Q 1IMPA 2CNRA 3EJDA 2KOQA 2FACA 3G26A 5HV8A 2N6ZA 2LTEA 2X2BA 2PEOA 1K8AQ 1D1DA 2QEXP 4COPA 2MD9A 4QNBA 2PEKA 5BS2A 4F37A 1RO2A 2MR7A 4WYMA 2WLVA 5CZDB 3DS2A 2GYKA 1ZNVA 1M9XC 1VKUA 2XZ1C 2MY5A 3CMEP 2FADA 1AFVA 2QNWA 3GZMA
chains in the Genus database with same CATH topology
2P9XA 2OARA 5HGLA 3B5IA 2M8NA 1AUMA 3CCUP 4HTWA 1VQNP 3I55P 1ZMBA 1KQSO 3CCSP 2BUOA 5F2OA 2PENA 3G21A 3DS0A 2PEMA 2DGYA 4U0FA 3CCLP 2GONA 2XGUA 4DGEC 3G1IA 1N8RQ 1M90Q 3DS4A 3BP9A 2WLVB 3CPWO 4PH2A 1VQLP 1YJNP 4E91A 1VQ4P 5JPAA 2XDEA 1NJIQ 1EOQA 2PWMA 1AK4C 3DS3A 2JYGA 3CCJP 3DPHA 3DS1A 1YITP 3DTJA 3CC4P 1QVGO 3CC2P 2EG5A 1YIJP 4PH1A 3LRYA 3G28A 1M74A 4COCA 1Q7YQ 1VQ9P 2X83A 4INBA 2BHVA 1Q81Q 1S72P 4PH3A 3CCQP 1RNIA 2EIAA 1RO0A 1M9YC 1KC8Q 1VQ6P 1IUQA 1M1KQ 3G4SP 3CCRP 2E1MA 3P05A 2JYLA 1K9MQ 5HGMA 3OW2O 4XROA 1Q86Q 4XFYA 2Z46A 1K30A 2Z45A 2KGFA 4XFXA 4PH0A 4XRQA 2EFJA 4U0BA 5HGNA 2QA4P 1A43A 5F2NA 3G71P 3H47A 1GWPA 3CMAP 1VQPP 1YJ9P 4XFZA 3CXCO 3H4EA 2XT1A 5DCKA 1M9DC 2XGYA 5F2KA 2V4XA 1M9EC 1Q82Q 3CCVP 1VQ8P 4E92A 2OTJP 1YJWP 2PEIA 1P7NA 1G03A 4U0EA 3G0VA 3G29A 2OTLP 3DS5A 1VQOP 2PWOA 1A8OA 4J93A 3RG6C 1U7KA 2L6EA 5HGOA 2PEQA 3CCEP 3NTEA 4DGAC 2Z44A 1VQ5P 1YHQP 1KD1Q 4U0AA 2CWOA 2LF4A 4B4NA 1VQMP 1M9FC 2JO0A 1YI2P 1EIAA 4LQWC 3G26A 3G1GA 5HGKA 3CCMP 2PXRC 3CD6P 2PEOA 3I56P 3Q20A 1K8AQ 1K73Q 1QVFO 5BS1A 1D1DA 1BAJA 2QEXP 1EM9A 4GR6A 2PEJA 1L6NA 4QNBA 4COPA 1JJ2O 2XGVA 2PEKA 5BS2A 2X82A 3HZQA 2GOLB 1RO2A 2JPRA 2M8LA 1VQ7P 1M6EX 4WYMA 2WLVA 2PY8A 3M1MA 4M0IA 4GR2A 2M8PA 2XV6A 3DS2A 2ONTA 2KODA 2X2DD 3MGEA 2XXMA 1W2BO 1M9XC 1QRJA 4U0CA 4U0DA 1E6JP 3CC7P 3E2DA 1M6NA 3G6EP 3CMEP 5I4TG 3WBHA 1M9CC 1AFVA 4NX4C 1VQKP 4IPYA 2Y4ZA 3HYBA 3VRLC 3H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGL A;  2M8N A;  1AUM A;  4HTW A;  2BUO A;  3G21 A;  3DS0 A;  4U0F A;  2GON A;  2XGU A;  4DGE C;  3G1I A;  3DS4 A;  3BP9 A;  2WLV B;  4PH2 A;  4E91 A;  5JPA A;  2XDE A;  1EOQ A;  2PWM A;  1AK4 C;  3DS3 A;  2JYG A;  3DPH A;  3DS1 A;  3DTJ A;  4PH1 A;  3LRY A;  3G28 A;  4COC A;  2X83 A;  4INB A;  4PH3 A;  2EIA A;  1M9Y C;  3P05 A;  2JYL A;  5HGM A;  4XRO A;  4XFY A;  2KGF A;  4XFX A;  4PH0 A;  4XRQ A;  4U0B A;  5HGN A;  1A43 A;  3H47 A;  1GWP A;  4XFZ A;  3H4E A;  2XT1 A;  5DCK A;  1M9D C;  2XGY A;  2V4X A;  1M9E C;  4E92 A;  1P7N A;  1G03 A;  4U0E A;  3G0V A;  3G29 A;  3DS5 A;  2PWO A;  1A8O A;  4J93 A;  1U7K A;  2L6E A;  5HGO A;  3NTE A;  4DGA C;  4U0A A;  2LF4 A;  4B4N A;  1M9F C;  2JO0 A;  1EIA A;  4LQW C;  3G26 A;  3G1G A;  5HGK A;  2PXR C;  1D1D A;  1BAJ A;  1EM9 A;  4COP A;  1L6N A;  4QNB A;  2XGV A;  2X82 A;  2GOL B;  2JPR A;  2M8L A;  4WYM A;  2WLV A;  4M0I A;  2M8P A;  2XV6 A;  3DS2 A;  2ONT A;  2KOD A;  2X2D D;  3MGE A;  2XXM A;  1M9X C;  1QRJ A;  4U0C A;  4U0D A;  1E6J P;  5I4T G;  1M9C C;  1AFV A;  4NX4 C;  4IPY A;  2Y4Z A;  3VRL C; 
#chains in the Genus database with same CATH topology
 1CEI A;  1UJZ A;  3CCU P;  2K94 A;  1VQN P;  1ZMB A;  2L22 A;  2JGP A;  2JQ4 A;  3CCS P;  2BUO A;  3NY7 B;  1GXG A;  3CCL P;  2LIW A;  4DGE C;  3G1I A;  2VLP A;  4BPG A;  4HKG A;  3CCJ P;  3DS1 A;  4PXH B;  2X83 A;  2KG8 A;  4INB A;  1Q81 Q;  1BXI A;  4PH3 A;  1VQ6 P;  1IUQ A;  2GDX A;  2NO8 A;  3CCR P;  2E1M A;  3GJN A;  2GZI A;  3B4Q A;  4BPH A;  4XFX A;  4XRQ A;  2EFJ A;  5HGN A;  5F2N A;  2KGA A;  5EJD A;  4R0M A;  4CA3 A;  4QKO A;  5DCK A;  1M9D C;  1M9E C;  5KP8 B;  3EJB A;  3RG2 A;  1VQ8 P;  1UNK A;  4U0E A;  3G0V A;  1KLP A;  2MF4 A;  4BPF A;  1U7K A;  2PEQ A;  2Z44 A;  1VQ5 P;  2CWO A;  2CGQ A;  1VQM P;  3GZL A;  1EMV A;  4LQW C;  2N50 A;  1L0I A;  5BS1 A;  1HY8 A;  1JJ2 O;  2X82 A;  2GOL B;  2DNW A;  1VQ7 P;  2K93 A;  4GR2 A;  1OR5 A;  2K0Y A;  2XV6 A;  2X2D D;  2K0X A;  2KG6 A;  1W2B O;  4H2W C;  2GZJ A;  2EHS A;  3G6E P;  4NX4 C;  4NEO A;  4IPY A;  2N6Y A;  2Y4Z A;  2GZE A;  3H0D A;  2P9X A;  2FVF A;  1AUM A;  2AF8 A;  4HTW A;  2KOR A;  1HQB A;  1KQS O;  1FR2 A;  1NQ4 A;  5EW5 E;  3EJE A;  2DGY A;  2LOL A;  2LML A;  1M90 Q;  2AVA A;  3GKL C;  3BP9 A;  2WLV B;  4PH2 A;  4E91 A;  2KOP A;  3U43 A;  1NJI Q;  2GZF A;  2JYG A;  2KGC A;  1AYI A;  2LKI A;  1YIT P;  2KG9 A;  3CC4 P;  3CC2 P;  2EG5 A;  4PH1 A;  3G28 A;  1M74 A;  1Q7Y Q;  2BHV A;  2M5R A;  1DNY A;  2EIA A;  1RO0 A;  3OW2 O;  4XRO A;  1L0H A;  4XFY A;  1K30 A;  2KOO A;  4PH0 A;  4U0B A;  4H2X C;  2JB0 A;  3CMA P;  1VQP P;  2LPK A;  2JU1 A;  2JU2 A;  2XT1 A;  4PWV B;  1AF8 A;  2PEI A;  1G03 A;  1VQO P;  1A8O A;  4J93 A;  2FVE A;  2KGE A;  3NTE A;  4U0A A;  2KGD A;  4B4N A;  1M9F C;  2JO0 A;  1YI2 P;  2ROQ A;  3G1G A;  2FVA A;  2VLQ A;  3CCM P;  2PXR C;  3CD6 P;  3I56 P;  1QVF O;  2FQ1 A;  2PEJ A;  2L4B A;  4IZ6 A;  2M8L A;  2MR8 A;  1M6E X;  2PY8 A;  4M0I A;  2M8P A;  3MGE A;  1QRJ A;  3CC7 P;  4U0D A;  1M6N A;  1GPJ A;  2FAE A;  3DTJ A;  3HYB A;  3B5I A;  1F80 D;  1DV5 A;  3I55 P;  1ACP A;  2K0D X;  5F2O A;  2PEN A;  2KR5 A;  1N8R Q;  2L9F A;  1VQ4 P;  1Z6M A;  2XDE A;  2PWM A;  1AK4 C;  3DS3 A;  3DPH A;  2CQ8 A;  3LRY A;  4COC A;  2LIU A;  1S72 P;  3CCQ P;  1RNI A;  1M9Y C;  1M1K Q;  3G4S P;  1K9M Q;  1VHN A;  1Q86 Q;  2Z46 A;  4UHP B;  2KW2 A;  2KGF A;  5KP6 B;  2XZ0 D;  2QA4 P;  1A43 A;  3G71 P;  3H47 A;  1GWP A;  1YJ9 P;  2AFE A;  3H4E A;  2JBG A;  2N98 A;  4E92 A;  1YJW P;  2OTL P;  2K92 A;  3DS5 A;  2PWO A;  2N5I A;  3RG6 C;  5HVC A;  2GZG A;  3CE7 A;  2AFD A;  3LMO A;  2LF4 A;  1T8K A;  1EIA A;  2EHT A;  5HGK A;  3Q20 A;  2K5X A;  1K73 Q;  2FQ0 A;  1BAJ A;  2PNG A;  1EM9 A;  4GR6 A;  1L6N A;  2XGV A;  2KWL A;  4DG9 A;  3HZQ A;  2L0Q A;  2JPR A;  3M1M A;  2ONT A;  2KOD A;  1E0H A;  2XXM A;  7CEI A;  4U0C A;  1E6J P;  1IMQ A;  2VLN A;  1X3O A;  3E2D A;  2MVU A;  5I4T G;  3WBH A;  1M9C C;  1VQK P;  3VRL C;  4MRT C;  2OAR A;  5HGL A;  2M8N A;  2CG5 B;  3G21 A;  3DS0 A;  1MZ8 A;  2PEM A;  4U0F A;  2GDW A;  2GON A;  2XGU A;  3DS4 A;  2WPT A;  3CPW O;  1VQL P;  1YJN P;  5JPA A;  2K2Q A;  1EOQ A;  2FQ2 A;  1QVG O;  2FHS C;  1YIJ P;  1VQ9 P;  2VSQ A;  1KC8 Q;  1GXH A;  2JAZ A;  2N5H A;  3P05 A;  2JYL A;  5HGM A;  2KOS A;  2MVV A;  2Z45 A;  2GDY A;  2VLO A;  2ERH A;  4XFZ A;  3CXC O;  4H2Y C;  2XGY A;  5F2K A;  5KP7 B;  2V4X A;  1Q82 Q;  3CCV P;  2LL8 A;  2OTJ P;  1P7N A;  3G29 A;  2L6E A;  5HGO A;  3CCE P;  4DGA C;  1YHQ P;  1KD1 Q;  1IMP A;  2CNR A;  3EJD A;  2KOQ A;  2FAC A;  3G26 A;  5HV8 A;  2N6Z A;  2LTE A;  2X2B A;  2PEO A;  1K8A Q;  1D1D A;  2QEX P;  4COP A;  2MD9 A;  4QNB A;  2PEK A;  5BS2 A;  4F37 A;  1RO2 A;  2MR7 A;  4WYM A;  2WLV A;  5CZD B;  3DS2 A;  2GYK A;  1ZNV A;  1M9X C;  1VKU A;  2XZ1 C;  2MY5 A;  3CME P;  2FAD A;  1AFV A;  2QNW A;  3GZM A; 
#chains in the Genus database with same CATH homology
 2P9X A;  2OAR A;  5HGL A;  3B5I A;  2M8N A;  1AUM A;  3CCU P;  4HTW A;  1VQN P;  3I55 P;  1ZMB A;  1KQS O;  3CCS P;  2BUO A;  5F2O A;  2PEN A;  3G21 A;  3DS0 A;  2PEM A;  2DGY A;  4U0F A;  3CCL P;  2GON A;  2XGU A;  4DGE C;  3G1I A;  1N8R Q;  1M90 Q;  3DS4 A;  3BP9 A;  2WLV B;  3CPW O;  4PH2 A;  1VQL P;  1YJN P;  4E91 A;  1VQ4 P;  5JPA A;  2XDE A;  1NJI Q;  1EOQ A;  2PWM A;  1AK4 C;  3DS3 A;  2JYG A;  3CCJ P;  3DPH A;  3DS1 A;  1YIT P;  3DTJ A;  3CC4 P;  1QVG O;  3CC2 P;  2EG5 A;  1YIJ P;  4PH1 A;  3LRY A;  3G28 A;  1M74 A;  4COC A;  1Q7Y Q;  1VQ9 P;  2X83 A;  4INB A;  2BHV A;  1Q81 Q;  1S72 P;  4PH3 A;  3CCQ P;  1RNI A;  2EIA A;  1RO0 A;  1M9Y C;  1KC8 Q;  1VQ6 P;  1IUQ A;  1M1K Q;  3G4S P;  3CCR P;  2E1M A;  3P05 A;  2JYL A;  1K9M Q;  5HGM A;  3OW2 O;  4XRO A;  1Q86 Q;  4XFY A;  2Z46 A;  1K30 A;  2Z45 A;  2KGF A;  4XFX A;  4PH0 A;  4XRQ A;  2EFJ A;  4U0B A;  5HGN A;  2QA4 P;  1A43 A;  5F2N A;  3G71 P;  3H47 A;  1GWP A;  3CMA P;  1VQP P;  1YJ9 P;  4XFZ A;  3CXC O;  3H4E A;  2XT1 A;  5DCK A;  1M9D C;  2XGY A;  5F2K A;  2V4X A;  1M9E C;  1Q82 Q;  3CCV P;  1VQ8 P;  4E92 A;  2OTJ P;  1YJW P;  2PEI A;  1P7N A;  1G03 A;  4U0E A;  3G0V A;  3G29 A;  2OTL P;  3DS5 A;  1VQO P;  2PWO A;  1A8O A;  4J93 A;  3RG6 C;  1U7K A;  2L6E A;  5HGO A;  2PEQ A;  3CCE P;  3NTE A;  4DGA C;  2Z44 A;  1VQ5 P;  1YHQ P;  1KD1 Q;  4U0A A;  2CWO A;  2LF4 A;  4B4N A;  1VQM P;  1M9F C;  2JO0 A;  1YI2 P;  1EIA A;  4LQW C;  3G26 A;  3G1G A;  5HGK A;  3CCM P;  2PXR C;  3CD6 P;  2PEO A;  3I56 P;  3Q20 A;  1K8A Q;  1K73 Q;  1QVF O;  5BS1 A;  1D1D A;  1BAJ A;  2QEX P;  1EM9 A;  4GR6 A;  2PEJ A;  1L6N A;  4QNB A;  4COP A;  1JJ2 O;  2XGV A;  2PEK A;  5BS2 A;  2X82 A;  3HZQ A;  2GOL B;  1RO2 A;  2JPR A;  2M8L A;  1VQ7 P;  1M6E X;  4WYM A;  2WLV A;  2PY8 A;  3M1M A;  4M0I A;  4GR2 A;  2M8P A;  2XV6 A;  3DS2 A;  2ONT A;  2KOD A;  2X2D D;  3MGE A;  2XXM A;  1W2B O;  1M9X C;  1QRJ A;  4U0C A;  4U0D A;  1E6J P;  3CC7 P;  3E2D A;  1M6N A;  3G6E P;  3CME P;  5I4T G;  3WBH A;  1M9C C;  1AFV A;  4NX4 C;  1VQK P;  4IPY A;  2Y4Z A;  3HYB A;  3VRL C;  3H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...