4U0BA

Hexamer hiv-1 ca in complex with cpsf6 peptide, p212121 crystal form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 75
structure length 208
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0bA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0bA02
4QNBA 1D1DA 1L6NA 2GOLB 2X2DD 5JPAA 2V4XA 4PH3A 4XROA 3DTJA 2XV6A 5HGOA 2LF4A 4PH1A 1M9YC 3G21A 2L6EA 4U0AA 5HGMA 2XGVA 1AK4C 4J93A 5DCKA 3VRLC 4XFYA 1A43A 2XT1A 2Y4ZA 2GONA 3BP9A 3DS4A 4XFZA 4NX4C 4E92A 2M8NA 4DGEC 2KODA 3G1IA 4PH0A 3DS0A 2PWMA 1G03A 3LRYA 4COPA 2PXRC 3P05A 2M8PA 2XGYA 1E6JP 1AUMA 1U7KA 5HGKA 3DPHA 4XFXA 3G28A 1EM9A 2BUOA 1M9DC 4XRQA 2EIAA 1AFVA 2M8LA 2XGUA 2KGFA 3DS5A 3DS3A 4PH2A 3H4EA 1M9XC 5HGNA 2XXMA 4U0CA 1P7NA 2X83A 3G0VA 4WYMA 3G26A 3G1GA 4DGAC 2WLVB 4LQWC 2JYLA 4U0BA 3DS2A 1BAJA 1EIAA 1GWPA 2JPRA 3NTEA 5I4TG 4U0FA 3H47A 4B4NA 5HGLA 4U0DA 3MGEA 2ONTA 2XDEA 4U0EA 3G29A 2PWOA 2JO0A 4COCA 1M9FC 1M9CC 2JYGA 4M0IA 2X82A 1A8OA 1M9EC 2WLVA 3DS1A 4INBA 4E91A 4IPYA 1EOQA 1QRJA 4HTWA
chains in the Genus database with same CATH superfamily
1L6NA 5KP8B 1NJIQ 2L9FA 5HGOA 3B5IA 3CMAP 3CCJP 3G4SP 4PH1A 3GZLA 5HGMA 2PNGA 1ZMBA 1M6EX 4BPGA 1AK4C 3CE7A 2EHSA 3CCVP 2CGQA 2GONA 1K30A 4NX4C 3CC4P 2LPKA 2PWMA 2OARA 2MR8A 2PXRC 2K2QA 5HGKA 2KOPA 4H2YC 1FR2A 3CCEP 2LL8A 5KP6B 2AF8A 2DGYA 3DS5A 3CMEP 1UNKA 2GDYA 1GXGA 2PEIA 1JJ2O 4U0CA 1RO2A 1ZNVA 2X83A 3NY7B 2GZGA 1T8KA 3DS2A 1KQSO 1VQPP 2P9XA 2PEMA 4U0FA 2PEQA 4UHPB 1VQ5P 1Q7YQ 3G29A 1M9FC 5CZDB 2KW2A 2WLVA 2GZEA 1YJNP 1Z6MA 4IPYA 1BXIA 1DNYA 2PEKA 1QRJA 1VQ7P 1D1DA 2GOLB 1VKUA 1GPJA 3WBHA 5JPAA 2WPTA 3DTJA 3CCMP 2Z45A 3CCSP 1VQOP 1VQ6P 2LMLA 3CD6P 2L6EA 3HYBA 4J93A 5DCKA 3EJDA 1A43A 1YHQP 3BP9A 5HV8A 2JBGA 4E92A 3DS0A 1VQLP 4MRTC 1M6NA 1E0HA 2M8PA 1L0HA 3EJEA 3GJNA 2FQ0A 1E6JP 4NEOA 2DNWA 2K94A 4BPFA 2LIWA 3G28A 1EM9A 2BUOA 2GZIA 1QVGO 3CC7P 5F2OA 1Q86Q 1M9DC 4XRQA 2KGDA 2K0XA 2KGFA 3DS3A 2JU2A 4F37A 1YI2P 5BS2A 2K92A 5HGNA 2AFDA 2N5HA 2VLNA 1P7NA 2K0YA 3G26A 2VLQA 3H0DA 2WLVB 4LQWC 2KGCA 1YITP 2FVEA 2LIUA 3RG6C 2VLPA 2X2BA 2K93A 3U43A 2KG6A 2Z46A 5F2KA 3H47A 4B4NA 3MGEA 2KOSA 4H2XC 1W2BO 2MF4A 5F2NA 4COCA 3GKLC 1IMQA 2JU1A 1Q81Q 2PENA 2JYGA 2L22A 5EJDA 2CG5B 1A8OA 1M9EC 2KWLA 3DS1A 3B4QA 4IZ6A 2GDXA 4E91A 1K73Q 1EOQA 2CWOA 4QNBA 2X2DD 2JGPA 1VQMP 1VQ8P 2XV6A 2LF4A 1L0IA 4QKOA 1F80D 2GZJA 1M9YC 2VLOA 1RNIA 4U0AA 1EMVA 3Q20A 3G71P 2XGVA 1QVFO 3VRLC 2XT1A 2FAEA 2Y4ZA 2N98A 4XFZA 2M8NA 4DGEC 2KODA 1G03A 2L4BA 2N6ZA 2XZ1C 1MZ8A 2GZFA 1CEIA 2XZ0D 4HTWA 2XGYA 1AUMA 2FADA 2QNWA 1U7KA 4GR2A 3DPHA 1VQ9P 2FVFA 3CCRP 2XGUA 2MVUA 1IMPA 2GDWA 2K5XA 2MR7A 3I55P 3H4EA 2FQ1A 1VQ4P 1N8RQ 4PWVB 4R0MA 2XXMA 1KLPA 3G0VA 1M74A 2N5IA 1HQBA 2FHSC 2NO8A 2E1MA 2PEOA 1BAJA 4BPHA 1EIAA 3CXCO 1GWPA 5I4TG 5EW5E 4HKGA 5HGLA 2FQ2A 2ONTA 2XDEA 2KR5A 3E2DA 2QEXP 2KGAA 1S72P 1OR5A 2AFEA 2X82A 2JAZA 1KC8Q 1X3OA 2VSQA 2QA4P 5HVCA 4DG9A 2EG5A 1VQKP 2JB0A 1IUQA 4H2WC 1VQNP 1YIJP 2MY5A 2LKIA 2V4XA 4PH3A 4XROA 2MVVA 1M90Q 1M1KQ 2KG8A 2KGEA 5BS1A 3G21A 2FVAA 2LOLA 3M1MA 2LTEA 2M5RA 3CCQP 4XFYA 1K9MQ 1YJWP 3DS4A 3EJBA 1NQ4A 3G1IA 3HZQA 4PH0A 1KD1Q 3LRYA 1VHNA 3CC2P 1AYIA 4COPA 3OW2O 2BHVA 1ACPA 3P05A 2KOOA 3RG2A 2L0QA 1YJ9P 2KG9A 2ERHA 3G6EP 4XFXA 2KORA 7CEIA 3CCLP 2AVAA 2PY8A 2EIAA 1AFVA 2FACA 2M8LA 2OTJP 4PH2A 2Z44A 2JQ4A 1M9XC 2EHTA 3LMOA 1HY8A 5KP7B 3CCUP 4WYMA 1GXHA 3G1GA 4DGAC 2MD9A 2JYLA 1K8AQ 4U0BA 4CA3A 2OTLP 2JPRA 3NTEA 1UJZA 3CPWO 1RO0A 3I56P 4U0DA 2N6YA 4U0EA 1Q82Q 2KOQA 2PWOA 4GR6A 2JO0A 2PEJA 1M9CC 4PXHB 4M0IA 2CQ8A 2K0DX 3GZMA 4INBA 2GYKA 2CNRA 1DV5A 2EFJA 1AF8A 2N50A 2ROQA
chains in the Genus database with same CATH topology
1IUQA 4QNBA 1D1DA 1L6NA 2GOLB 2X2DD 1VQNP 1VQMP 3WBHA 1YIJP 1NJIQ 5JPAA 2V4XA 4PH3A 4XROA 3DTJA 3CCMP 1VQ8P 2XV6A 2Z45A 1M90Q 5HGOA 3B5IA 2LF4A 3CMAP 3CCJP 3G4SP 4PH1A 3CCSP 1VQOP 1M1KQ 1VQ6P 5BS1A 1M9YC 3G21A 3CD6P 2L6EA 3M1MA 1RNIA 4U0AA 5HGMA 1ZMBA 3HYBA 1M6EX 3Q20A 3G71P 2XGVA 1AK4C 4J93A 1QVFO 5DCKA 3VRLC 3CCQP 3CCVP 4XFYA 1A43A 2XT1A 1K9MQ 1YJWP 2Y4ZA 2GONA 3BP9A 3DS4A 1YHQP 1K30A 4XFZA 4NX4C 4E92A 2M8NA 4DGEC 3CC4P 2KODA 3G1IA 3HZQA 4PH0A 3DS0A 1KD1Q 2PWMA 1G03A 3LRYA 1VQLP 3CC2P 2OARA 4COPA 1M6NA 3OW2O 2BHVA 2PXRC 3P05A 2M8PA 2XGYA 1E6JP 1AUMA 1YJ9P 1U7KA 4GR2A 5HGKA 3DPHA 3G6EP 4XFXA 3G28A 1EM9A 2BUOA 1QVGO 3CC7P 5F2OA 1Q86Q 1M9DC 4XRQA 3CCLP 1VQ9P 2PY8A 2EIAA 1AFVA 3CCEP 3CCRP 2M8LA 2XGUA 2KGFA 2OTJP 2DGYA 3DS3A 3DS5A 1YI2P 5BS2A 3CMEP 3I55P 4PH2A 3H4EA 2Z44A 2PEIA 1VQ4P 1M9XC 1N8RQ 5HGNA 1JJ2O 2XXMA 4U0CA 1RO2A 1P7NA 2X83A 3G0VA 3CCUP 4WYMA 3G26A 3G1GA 4DGAC 1M74A 3H0DA 2WLVB 4LQWC 2JYLA 1K8AQ 1YITP 2E1MA 3RG6C 4U0BA 2PEOA 3DS2A 1BAJA 1KQSO 2OTLP 1EIAA 3CXCO 2Z46A 1GWPA 2JPRA 3NTEA 2P9XA 2PEMA 4U0FA 5F2KA 5I4TG 1VQPP 1RO0A 3H47A 4B4NA 5HGLA 2PEQA 3I56P 3CPWO 4U0DA 3MGEA 2ONTA 2XDEA 1VQ5P 4U0EA 3E2DA 1Q7YQ 2QEXP 1Q82Q 3G29A 1W2BO 1S72P 2PWOA 4GR6A 5F2NA 2JO0A 2PEJA 4COCA 1Q81Q 1M9FC 1M9CC 2PENA 2JYGA 4M0IA 2X82A 1KC8Q 1A8OA 1M9EC 2WLVA 3DS1A 4INBA 1YJNP 2QA4P 4E91A 2EFJA 1K73Q 2EG5A 4IPYA 1VQKP 1EOQA 2CWOA 2PEKA 1QRJA 1VQ7P 4HTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNB A;  1D1D A;  1L6N A;  2GOL B;  2X2D D;  5JPA A;  2V4X A;  4PH3 A;  4XRO A;  3DTJ A;  2XV6 A;  5HGO A;  2LF4 A;  4PH1 A;  1M9Y C;  3G21 A;  2L6E A;  4U0A A;  5HGM A;  2XGV A;  1AK4 C;  4J93 A;  5DCK A;  3VRL C;  4XFY A;  1A43 A;  2XT1 A;  2Y4Z A;  2GON A;  3BP9 A;  3DS4 A;  4XFZ A;  4NX4 C;  4E92 A;  2M8N A;  4DGE C;  2KOD A;  3G1I A;  4PH0 A;  3DS0 A;  2PWM A;  1G03 A;  3LRY A;  4COP A;  2PXR C;  3P05 A;  2M8P A;  2XGY A;  1E6J P;  1AUM A;  1U7K A;  5HGK A;  3DPH A;  4XFX A;  3G28 A;  1EM9 A;  2BUO A;  1M9D C;  4XRQ A;  2EIA A;  1AFV A;  2M8L A;  2XGU A;  2KGF A;  3DS5 A;  3DS3 A;  4PH2 A;  3H4E A;  1M9X C;  5HGN A;  2XXM A;  4U0C A;  1P7N A;  2X83 A;  3G0V A;  4WYM A;  3G26 A;  3G1G A;  4DGA C;  2WLV B;  4LQW C;  2JYL A;  4U0B A;  3DS2 A;  1BAJ A;  1EIA A;  1GWP A;  2JPR A;  3NTE A;  5I4T G;  4U0F A;  3H47 A;  4B4N A;  5HGL A;  4U0D A;  3MGE A;  2ONT A;  2XDE A;  4U0E A;  3G29 A;  2PWO A;  2JO0 A;  4COC A;  1M9F C;  1M9C C;  2JYG A;  4M0I A;  2X82 A;  1A8O A;  1M9E C;  2WLV A;  3DS1 A;  4INB A;  4E91 A;  4IPY A;  1EOQ A;  1QRJ A;  4HTW A; 
#chains in the Genus database with same CATH topology
 1L6N A;  5KP8 B;  1NJI Q;  2L9F A;  5HGO A;  3B5I A;  3CMA P;  3CCJ P;  3G4S P;  4PH1 A;  3GZL A;  5HGM A;  2PNG A;  1ZMB A;  1M6E X;  4BPG A;  1AK4 C;  3CE7 A;  2EHS A;  3CCV P;  2CGQ A;  2GON A;  1K30 A;  4NX4 C;  3CC4 P;  2LPK A;  2PWM A;  2OAR A;  2MR8 A;  2PXR C;  2K2Q A;  5HGK A;  2KOP A;  4H2Y C;  1FR2 A;  3CCE P;  2LL8 A;  5KP6 B;  2AF8 A;  2DGY A;  3DS5 A;  3CME P;  1UNK A;  2GDY A;  1GXG A;  2PEI A;  1JJ2 O;  4U0C A;  1RO2 A;  1ZNV A;  2X83 A;  3NY7 B;  2GZG A;  1T8K A;  3DS2 A;  1KQS O;  1VQP P;  2P9X A;  2PEM A;  4U0F A;  2PEQ A;  4UHP B;  1VQ5 P;  1Q7Y Q;  3G29 A;  1M9F C;  5CZD B;  2KW2 A;  2WLV A;  2GZE A;  1YJN P;  1Z6M A;  4IPY A;  1BXI A;  1DNY A;  2PEK A;  1QRJ A;  1VQ7 P;  1D1D A;  2GOL B;  1VKU A;  1GPJ A;  3WBH A;  5JPA A;  2WPT A;  3DTJ A;  3CCM P;  2Z45 A;  3CCS P;  1VQO P;  1VQ6 P;  2LML A;  3CD6 P;  2L6E A;  3HYB A;  4J93 A;  5DCK A;  3EJD A;  1A43 A;  1YHQ P;  3BP9 A;  5HV8 A;  2JBG A;  4E92 A;  3DS0 A;  1VQL P;  4MRT C;  1M6N A;  1E0H A;  2M8P A;  1L0H A;  3EJE A;  3GJN A;  2FQ0 A;  1E6J P;  4NEO A;  2DNW A;  2K94 A;  4BPF A;  2LIW A;  3G28 A;  1EM9 A;  2BUO A;  2GZI A;  1QVG O;  3CC7 P;  5F2O A;  1Q86 Q;  1M9D C;  4XRQ A;  2KGD A;  2K0X A;  2KGF A;  3DS3 A;  2JU2 A;  4F37 A;  1YI2 P;  5BS2 A;  2K92 A;  5HGN A;  2AFD A;  2N5H A;  2VLN A;  1P7N A;  2K0Y A;  3G26 A;  2VLQ A;  3H0D A;  2WLV B;  4LQW C;  2KGC A;  1YIT P;  2FVE A;  2LIU A;  3RG6 C;  2VLP A;  2X2B A;  2K93 A;  3U43 A;  2KG6 A;  2Z46 A;  5F2K A;  3H47 A;  4B4N A;  3MGE A;  2KOS A;  4H2X C;  1W2B O;  2MF4 A;  5F2N A;  4COC A;  3GKL C;  1IMQ A;  2JU1 A;  1Q81 Q;  2PEN A;  2JYG A;  2L22 A;  5EJD A;  2CG5 B;  1A8O A;  1M9E C;  2KWL A;  3DS1 A;  3B4Q A;  4IZ6 A;  2GDX A;  4E91 A;  1K73 Q;  1EOQ A;  2CWO A;  4QNB A;  2X2D D;  2JGP A;  1VQM P;  1VQ8 P;  2XV6 A;  2LF4 A;  1L0I A;  4QKO A;  1F80 D;  2GZJ A;  1M9Y C;  2VLO A;  1RNI A;  4U0A A;  1EMV A;  3Q20 A;  3G71 P;  2XGV A;  1QVF O;  3VRL C;  2XT1 A;  2FAE A;  2Y4Z A;  2N98 A;  4XFZ A;  2M8N A;  4DGE C;  2KOD A;  1G03 A;  2L4B A;  2N6Z A;  2XZ1 C;  1MZ8 A;  2GZF A;  1CEI A;  2XZ0 D;  4HTW A;  2XGY A;  1AUM A;  2FAD A;  2QNW A;  1U7K A;  4GR2 A;  3DPH A;  1VQ9 P;  2FVF A;  3CCR P;  2XGU A;  2MVU A;  1IMP A;  2GDW A;  2K5X A;  2MR7 A;  3I55 P;  3H4E A;  2FQ1 A;  1VQ4 P;  1N8R Q;  4PWV B;  4R0M A;  2XXM A;  1KLP A;  3G0V A;  1M74 A;  2N5I A;  1HQB A;  2FHS C;  2NO8 A;  2E1M A;  2PEO A;  1BAJ A;  4BPH A;  1EIA A;  3CXC O;  1GWP A;  5I4T G;  5EW5 E;  4HKG A;  5HGL A;  2FQ2 A;  2ONT A;  2XDE A;  2KR5 A;  3E2D A;  2QEX P;  2KGA A;  1S72 P;  1OR5 A;  2AFE A;  2X82 A;  2JAZ A;  1KC8 Q;  1X3O A;  2VSQ A;  2QA4 P;  5HVC A;  4DG9 A;  2EG5 A;  1VQK P;  2JB0 A;  1IUQ A;  4H2W C;  1VQN P;  1YIJ P;  2MY5 A;  2LKI A;  2V4X A;  4PH3 A;  4XRO A;  2MVV A;  1M90 Q;  1M1K Q;  2KG8 A;  2KGE A;  5BS1 A;  3G21 A;  2FVA A;  2LOL A;  3M1M A;  2LTE A;  2M5R A;  3CCQ P;  4XFY A;  1K9M Q;  1YJW P;  3DS4 A;  3EJB A;  1NQ4 A;  3G1I A;  3HZQ A;  4PH0 A;  1KD1 Q;  3LRY A;  1VHN A;  3CC2 P;  1AYI A;  4COP A;  3OW2 O;  2BHV A;  1ACP A;  3P05 A;  2KOO A;  3RG2 A;  2L0Q A;  1YJ9 P;  2KG9 A;  2ERH A;  3G6E P;  4XFX A;  2KOR A;  7CEI A;  3CCL P;  2AVA A;  2PY8 A;  2EIA A;  1AFV A;  2FAC A;  2M8L A;  2OTJ P;  4PH2 A;  2Z44 A;  2JQ4 A;  1M9X C;  2EHT A;  3LMO A;  1HY8 A;  5KP7 B;  3CCU P;  4WYM A;  1GXH A;  3G1G A;  4DGA C;  2MD9 A;  2JYL A;  1K8A Q;  4U0B A;  4CA3 A;  2OTL P;  2JPR A;  3NTE A;  1UJZ A;  3CPW O;  1RO0 A;  3I56 P;  4U0D A;  2N6Y A;  4U0E A;  1Q82 Q;  2KOQ A;  2PWO A;  4GR6 A;  2JO0 A;  2PEJ A;  1M9C C;  4PXH B;  4M0I A;  2CQ8 A;  2K0D X;  3GZM A;  4INB A;  2GYK A;  2CNR A;  1DV5 A;  2EFJ A;  1AF8 A;  2N50 A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 1IUQ A;  4QNB A;  1D1D A;  1L6N A;  2GOL B;  2X2D D;  1VQN P;  1VQM P;  3WBH A;  1YIJ P;  1NJI Q;  5JPA A;  2V4X A;  4PH3 A;  4XRO A;  3DTJ A;  3CCM P;  1VQ8 P;  2XV6 A;  2Z45 A;  1M90 Q;  5HGO A;  3B5I A;  2LF4 A;  3CMA P;  3CCJ P;  3G4S P;  4PH1 A;  3CCS P;  1VQO P;  1M1K Q;  1VQ6 P;  5BS1 A;  1M9Y C;  3G21 A;  3CD6 P;  2L6E A;  3M1M A;  1RNI A;  4U0A A;  5HGM A;  1ZMB A;  3HYB A;  1M6E X;  3Q20 A;  3G71 P;  2XGV A;  1AK4 C;  4J93 A;  1QVF O;  5DCK A;  3VRL C;  3CCQ P;  3CCV P;  4XFY A;  1A43 A;  2XT1 A;  1K9M Q;  1YJW P;  2Y4Z A;  2GON A;  3BP9 A;  3DS4 A;  1YHQ P;  1K30 A;  4XFZ A;  4NX4 C;  4E92 A;  2M8N A;  4DGE C;  3CC4 P;  2KOD A;  3G1I A;  3HZQ A;  4PH0 A;  3DS0 A;  1KD1 Q;  2PWM A;  1G03 A;  3LRY A;  1VQL P;  3CC2 P;  2OAR A;  4COP A;  1M6N A;  3OW2 O;  2BHV A;  2PXR C;  3P05 A;  2M8P A;  2XGY A;  1E6J P;  1AUM A;  1YJ9 P;  1U7K A;  4GR2 A;  5HGK A;  3DPH A;  3G6E P;  4XFX A;  3G28 A;  1EM9 A;  2BUO A;  1QVG O;  3CC7 P;  5F2O A;  1Q86 Q;  1M9D C;  4XRQ A;  3CCL P;  1VQ9 P;  2PY8 A;  2EIA A;  1AFV A;  3CCE P;  3CCR P;  2M8L A;  2XGU A;  2KGF A;  2OTJ P;  2DGY A;  3DS3 A;  3DS5 A;  1YI2 P;  5BS2 A;  3CME P;  3I55 P;  4PH2 A;  3H4E A;  2Z44 A;  2PEI A;  1VQ4 P;  1M9X C;  1N8R Q;  5HGN A;  1JJ2 O;  2XXM A;  4U0C A;  1RO2 A;  1P7N A;  2X83 A;  3G0V A;  3CCU P;  4WYM A;  3G26 A;  3G1G A;  4DGA C;  1M74 A;  3H0D A;  2WLV B;  4LQW C;  2JYL A;  1K8A Q;  1YIT P;  2E1M A;  3RG6 C;  4U0B A;  2PEO A;  3DS2 A;  1BAJ A;  1KQS O;  2OTL P;  1EIA A;  3CXC O;  2Z46 A;  1GWP A;  2JPR A;  3NTE A;  2P9X A;  2PEM A;  4U0F A;  5F2K A;  5I4T G;  1VQP P;  1RO0 A;  3H47 A;  4B4N A;  5HGL A;  2PEQ A;  3I56 P;  3CPW O;  4U0D A;  3MGE A;  2ONT A;  2XDE A;  1VQ5 P;  4U0E A;  3E2D A;  1Q7Y Q;  2QEX P;  1Q82 Q;  3G29 A;  1W2B O;  1S72 P;  2PWO A;  4GR6 A;  5F2N A;  2JO0 A;  2PEJ A;  4COC A;  1Q81 Q;  1M9F C;  1M9C C;  2PEN A;  2JYG A;  4M0I A;  2X82 A;  1KC8 Q;  1A8O A;  1M9E C;  2WLV A;  3DS1 A;  4INB A;  1YJN P;  2QA4 P;  4E91 A;  2EFJ A;  1K73 Q;  2EG5 A;  4IPY A;  1VQK P;  1EOQ A;  2CWO A;  2PEK A;  1QRJ A;  1VQ7 P;  4HTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...