4U0DA

Hexameric hiv-1 ca in complex with nup153 peptide, p212121 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
216
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 70
structure length 216
sequence length 219
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0dA02
2GONA 5HGNA 4LQWC 2X83A 2XGVA 3BP9A 3DS3A 2WLVA 3G0VA 4XFXA 4U0DA 2GOLB 4NX4C 5HGLA 4HTWA 3NTEA 1EM9A 4U0AA 1AK4C 2KODA 5HGMA 1M9FC 1M9DC 3H4EA 2M8NA 4E91A 3H47A 1EOQA 4U0BA 4IPYA 3VRLC 4U0CA 4E92A 2ONTA 2XDEA 2XT1A 1U7KA 3G26A 1P7NA 2XGYA 2M8PA 4DGAC 2JPRA 3DS1A 3LRYA 3DPHA 1QRJA 1A8OA 2BUOA 2JYLA 2XGUA 5HGKA 5I4TG 2KGFA 1AUMA 4DGEC 4PH3A 3DS2A 4QNBA 2PWMA 1M9YC 3DS0A 5HGOA 2JYGA 4PH1A 4COPA 2JO0A 1M9XC 2PWOA 2X82A 4B4NA 3P05A 1BAJA 2PXRC 2LF4A 2Y4ZA 4PH0A 3G29A 4XROA 1A43A 4U0FA 1D1DA 1L6NA 2EIAA 4XFZA 3DS4A 2XV6A 3G21A 2V4XA 5JPAA 2L6EA 4M0IA 2X2DD 3G1IA 1EIAA 3G28A 3MGEA 4INBA 1G03A 4WYMA 4XFYA 4J93A 4COCA 2M8LA 4PH2A 1M9EC 1E6JP 3G1GA 1M9CC 3DS5A 3DTJA 2XXMA 2WLVB 4U0EA 5DCKA 4XRQA 1AFVA 1GWPA
chains in the Genus database with same CATH superfamily
2KR5A 2K5XA 1Q81Q 2X83A 2XGVA 3BP9A 1E0HA 2WLVA 1YJNP 4XFXA 2GZGA 2VLOA 2K0XA 3WBHA 3I56P 4GR6A 1RO2A 2MY5A 3NTEA 2FHSC 1ACPA 1EM9A 2FVEA 2ERHA 2EFJA 5HGMA 4IZ6A 1K8AQ 3H4EA 2WPTA 2CWOA 4IPYA 2PEKA 2XT1A 2AVAA 2Z44A 3B5IA 1MZ8A 2FQ2A 2M8PA 2KGDA 2JYLA 2XGUA 1Q86Q 5HGKA 1QVFO 2CNRA 3DS2A 2KG8A 5HGOA 1K73Q 1VHNA 2JB0A 2JU2A 2JO0A 2LL8A 3GJNA 3P05A 4BPHA 4QKOA 1AYIA 3G6EP 4PH0A 2KGCA 2AFDA 4NEOA 1K9MQ 2XV6A 1M90Q 2KOPA 2E1MA 3RG2A 4H2YC 4J93A 3CCVP 3CCUP 4PH2A 1L0HA 1M9EC 3DS5A 3DTJA 5F2NA 2N98A 2EHSA 1F80D 4XRQA 1AFVA 3CCSP 4F37A 2KG6A 5HGNA 1NQ4A 5KP7B 2MVUA 5HV8A 3G0VA 3CE7A 2GDWA 1UJZA 1YITP 2LPKA 2GOLB 2P9XA 2PEQA 4HTWA 4H2XC 1M6NA 2GDXA 1W2BO 2XZ0D 3E2DA 1M9DC 2M8NA 4E91A 3H47A 1EOQA 1UNKA 3VRLC 1N8RQ 4HKGA 2XDEA 5F2OA 2FACA 2GZJA 3G26A 2XGYA 4DGAC 3LRYA 1KD1Q 3DPHA 2XZ1C 2N6YA 2DNWA 4PH3A 3G71P 2PWMA 1VQOP 1M9YC 2KOQA 2EHTA 2JYGA 2L0QA 4COPA 1ZMBA 1CEIA 4B4NA 1EMVA 1BAJA 2LF4A 2Y4ZA 3G29A 2MR8A 3EJDA 1AF8A 2JAZA 1D1DA 2PEIA 2EIAA 4BPFA 3HZQA 4MRTC 4XFZA 2JQ4A 2GZFA 2VLQA 3G21A 3CC7P 2L6EA 4M0IA 3CPWO 2X2DD 2K2QA 3B4QA 2CGQA 3EJEA 2NO8A 3CCQP 5F2KA 1RNIA 3CCLP 2FADA 2JBGA 2KGAA 5KP8B 1M9CC 1RO0A 5DCKA 1S72P 2ROQA 1ZNVA 1KLPA 1IMQA 3GZLA 1HQBA 3DS3A 1VQ4P 2JU1A 1VKUA 1VQ8P 1DNYA 1FR2A 2L22A 2KGEA 3CD6P 2L4BA 2OARA 4UHPB 4U0AA 3Q20A 5BS2A 1Z6MA 3H0DA 2KODA 2GZIA 4U0BA 4E92A 2ONTA 1U7KA 1VQNP 2MD9A 2QNWA 3HYBA 2KOSA 1QRJA 2Z45A 3GZMA 1VQKP 2DGYA 5I4TG 3CCRP 1AUMA 1IMPA 4H2WC 1T8KA 3DS0A 2OTJP 4PH1A 3CMAP 1VQ9P 1IUQA 3CC4P 2VLNA 2FVAA 1M9XC 2PWOA 2X82A 2K92A 1X3OA 1M74A 2FVFA 2LMLA 2VLPA 2PXRC 2GYKA 2M5RA 1VQ6P 2K0YA 2N6ZA 1GXHA 5BS1A 3CCJP 4U0FA 1L6NA 2MF4A 5JPAA 1VQ7P 2PEJA 3G1IA 2CG5B 3G28A 1HY8A 2PNGA 4INBA 2FQ1A 1G03A 4XFYA 2PEMA 5HVCA 1Q7YQ 2FQ0A 5EW5E 2LKIA 4COCA 4R0MA 1BXIA 3NY7B 2QEXP 2FAEA 2M8LA 2K0DX 4GR2A 3G1GA 1YJ9P 1KQSO 1VQMP 2XXMA 4PXHB 3U43A 2N50A 2QA4P 1GWPA 2K94A 2GONA 2X2BA 4LQWC 5EJDA 2KW2A 2EG5A 1YHQP 2LIWA 4U0DA 1K30A 3LMOA 3RG6C 2LTEA 1VQPP 4NX4C 5HGLA 1OR5A 2KG9A 4CA3A 1AK4C 3I55P 1M9FC 1QVGO 1KC8Q 4U0CA 1GPJA 2KORA 3G4SP 1M6EX 2PENA 1JJ2O 1GXGA 1NJIQ 1Q82Q 2KWLA 2VSQA 1P7NA 2LOLA 2AFEA 2JPRA 2MVVA 3CC2P 3DS1A 2MR7A 1A8OA 1YI2P 2GZEA 2BUOA 5CZDB 3EJBA 2KGFA 4DGEC 2PY8A 2L9FA 4QNBA 3CCMP 7CEIA 2CQ8A 3CMEP 1VQLP 2N5IA 1L0IA 2GDYA 4XROA 1A43A 2AF8A 2PEOA 2JGPA 2KOOA 3DS4A 4DG9A 2K93A 1YIJP 2V4XA 5KP6B 1EIAA 3M1MA 3MGEA 3GKLC 3OW2O 2N5HA 4WYMA 1YJWP 3CCEP 3CXCO 2LIUA 1VQ5P 2BHVA 1E6JP 1M1KQ 2OTLP 4BPGA 2Z46A 2WLVB 4U0EA 4PWVB 1DV5A
chains in the Genus database with same CATH topology
2GONA 5HGNA 4LQWC 1Q81Q 2X83A 2XGVA 3BP9A 3DS3A 1VQ4P 2EG5A 2WLVA 3G0VA 1YJNP 1VQ8P 1YHQP 1YITP 4XFXA 4U0DA 1K30A 3WBHA 3CD6P 3I56P 3RG6C 2GOLB 2OARA 4NX4C 5HGLA 2P9XA 2PEQA 4GR6A 1RO2A 1VQPP 4HTWA 3NTEA 1M6NA 1EM9A 4U0AA 3Q20A 5BS2A 3H0DA 1AK4C 2KODA 2EFJA 3E2DA 1W2BO 3I55P 5HGMA 1K8AQ 1M9FC 1M9DC 3H4EA 2M8NA 4E91A 3H47A 1EOQA 4U0BA 2CWOA 2PEKA 4IPYA 3VRLC 1N8RQ 1KC8Q 4U0CA 3G4SP 4E92A 2ONTA 2XDEA 1M6EX 2PENA 2XT1A 1JJ2O 1U7KA 1VQNP 5F2OA 3G26A 1NJIQ 1Q82Q 2Z44A 3B5IA 3HYBA 1P7NA 2XGYA 2M8PA 4DGAC 2JPRA 3CC2P 3DS1A 3LRYA 1KD1Q 3DPHA 1QRJA 1A8OA 1YI2P 2Z45A 1VQKP 2BUOA 2JYLA 2XGUA 1Q86Q 5HGKA 2DGYA 5I4TG 1QVFO 2KGFA 3CCRP 1AUMA 4DGEC 2PY8A 4PH3A 3DS2A 4QNBA 3G71P 2PWMA 3CCMP 1VQOP 1M9YC 1QVGO 3DS0A 5HGOA 2JYGA 2OTJP 4PH1A 1K73Q 3CMAP 4COPA 1IUQA 1VQ9P 3CC4P 1ZMBA 2JO0A 1M9XC 2PWOA 2X82A 4B4NA 3P05A 1M74A 3CMEP 1BAJA 3G6EP 1VQLP 2PXRC 2LF4A 2Y4ZA 4PH0A 3G29A 1VQ6P 4XROA 1A43A 5BS1A 3CCJP 4U0FA 1D1DA 2PEOA 1L6NA 2EIAA 2PEIA 3HZQA 4XFZA 3DS4A 1K9MQ 2XV6A 3G21A 1YIJP 1M90Q 3CC7P 2V4XA 5JPAA 2L6EA 4M0IA 1VQ7P 3CPWO 2X2DD 2PEJA 1EIAA 3G1IA 3M1MA 3G28A 3MGEA 4INBA 1G03A 3OW2O 4WYMA 4XFYA 2E1MA 1YJWP 3CCEP 2PEMA 1Q7YQ 4J93A 3CXCO 4COCA 3CCQP 3CCVP 5F2KA 1RNIA 2QEXP 3CCLP 1VQ5P 2M8LA 3CCUP 2BHVA 4PH2A 1M9EC 1E6JP 3G1GA 4GR2A 1M1KQ 2OTLP 1YJ9P 1KQSO 1M9CC 1VQMP 2Z46A 3DS5A 3DTJA 2XXMA 2WLVB 4U0EA 1RO0A 5F2NA 5DCKA 4XRQA 1S72P 1AFVA 3CCSP 2QA4P 1GWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GON A;  5HGN A;  4LQW C;  2X83 A;  2XGV A;  3BP9 A;  3DS3 A;  2WLV A;  3G0V A;  4XFX A;  4U0D A;  2GOL B;  4NX4 C;  5HGL A;  4HTW A;  3NTE A;  1EM9 A;  4U0A A;  1AK4 C;  2KOD A;  5HGM A;  1M9F C;  1M9D C;  3H4E A;  2M8N A;  4E91 A;  3H47 A;  1EOQ A;  4U0B A;  4IPY A;  3VRL C;  4U0C A;  4E92 A;  2ONT A;  2XDE A;  2XT1 A;  1U7K A;  3G26 A;  1P7N A;  2XGY A;  2M8P A;  4DGA C;  2JPR A;  3DS1 A;  3LRY A;  3DPH A;  1QRJ A;  1A8O A;  2BUO A;  2JYL A;  2XGU A;  5HGK A;  5I4T G;  2KGF A;  1AUM A;  4DGE C;  4PH3 A;  3DS2 A;  4QNB A;  2PWM A;  1M9Y C;  3DS0 A;  5HGO A;  2JYG A;  4PH1 A;  4COP A;  2JO0 A;  1M9X C;  2PWO A;  2X82 A;  4B4N A;  3P05 A;  1BAJ A;  2PXR C;  2LF4 A;  2Y4Z A;  4PH0 A;  3G29 A;  4XRO A;  1A43 A;  4U0F A;  1D1D A;  1L6N A;  2EIA A;  4XFZ A;  3DS4 A;  2XV6 A;  3G21 A;  2V4X A;  5JPA A;  2L6E A;  4M0I A;  2X2D D;  3G1I A;  1EIA A;  3G28 A;  3MGE A;  4INB A;  1G03 A;  4WYM A;  4XFY A;  4J93 A;  4COC A;  2M8L A;  4PH2 A;  1M9E C;  1E6J P;  3G1G A;  1M9C C;  3DS5 A;  3DTJ A;  2XXM A;  2WLV B;  4U0E A;  5DCK A;  4XRQ A;  1AFV A;  1GWP A; 
#chains in the Genus database with same CATH topology
 2KR5 A;  2K5X A;  1Q81 Q;  2X83 A;  2XGV A;  3BP9 A;  1E0H A;  2WLV A;  1YJN P;  4XFX A;  2GZG A;  2VLO A;  2K0X A;  3WBH A;  3I56 P;  4GR6 A;  1RO2 A;  2MY5 A;  3NTE A;  2FHS C;  1ACP A;  1EM9 A;  2FVE A;  2ERH A;  2EFJ A;  5HGM A;  4IZ6 A;  1K8A Q;  3H4E A;  2WPT A;  2CWO A;  4IPY A;  2PEK A;  2XT1 A;  2AVA A;  2Z44 A;  3B5I A;  1MZ8 A;  2FQ2 A;  2M8P A;  2KGD A;  2JYL A;  2XGU A;  1Q86 Q;  5HGK A;  1QVF O;  2CNR A;  3DS2 A;  2KG8 A;  5HGO A;  1K73 Q;  1VHN A;  2JB0 A;  2JU2 A;  2JO0 A;  2LL8 A;  3GJN A;  3P05 A;  4BPH A;  4QKO A;  1AYI A;  3G6E P;  4PH0 A;  2KGC A;  2AFD A;  4NEO A;  1K9M Q;  2XV6 A;  1M90 Q;  2KOP A;  2E1M A;  3RG2 A;  4H2Y C;  4J93 A;  3CCV P;  3CCU P;  4PH2 A;  1L0H A;  1M9E C;  3DS5 A;  3DTJ A;  5F2N A;  2N98 A;  2EHS A;  1F80 D;  4XRQ A;  1AFV A;  3CCS P;  4F37 A;  2KG6 A;  5HGN A;  1NQ4 A;  5KP7 B;  2MVU A;  5HV8 A;  3G0V A;  3CE7 A;  2GDW A;  1UJZ A;  1YIT P;  2LPK A;  2GOL B;  2P9X A;  2PEQ A;  4HTW A;  4H2X C;  1M6N A;  2GDX A;  1W2B O;  2XZ0 D;  3E2D A;  1M9D C;  2M8N A;  4E91 A;  3H47 A;  1EOQ A;  1UNK A;  3VRL C;  1N8R Q;  4HKG A;  2XDE A;  5F2O A;  2FAC A;  2GZJ A;  3G26 A;  2XGY A;  4DGA C;  3LRY A;  1KD1 Q;  3DPH A;  2XZ1 C;  2N6Y A;  2DNW A;  4PH3 A;  3G71 P;  2PWM A;  1VQO P;  1M9Y C;  2KOQ A;  2EHT A;  2JYG A;  2L0Q A;  4COP A;  1ZMB A;  1CEI A;  4B4N A;  1EMV A;  1BAJ A;  2LF4 A;  2Y4Z A;  3G29 A;  2MR8 A;  3EJD A;  1AF8 A;  2JAZ A;  1D1D A;  2PEI A;  2EIA A;  4BPF A;  3HZQ A;  4MRT C;  4XFZ A;  2JQ4 A;  2GZF A;  2VLQ A;  3G21 A;  3CC7 P;  2L6E A;  4M0I A;  3CPW O;  2X2D D;  2K2Q A;  3B4Q A;  2CGQ A;  3EJE A;  2NO8 A;  3CCQ P;  5F2K A;  1RNI A;  3CCL P;  2FAD A;  2JBG A;  2KGA A;  5KP8 B;  1M9C C;  1RO0 A;  5DCK A;  1S72 P;  2ROQ A;  1ZNV A;  1KLP A;  1IMQ A;  3GZL A;  1HQB A;  3DS3 A;  1VQ4 P;  2JU1 A;  1VKU A;  1VQ8 P;  1DNY A;  1FR2 A;  2L22 A;  2KGE A;  3CD6 P;  2L4B A;  2OAR A;  4UHP B;  4U0A A;  3Q20 A;  5BS2 A;  1Z6M A;  3H0D A;  2KOD A;  2GZI A;  4U0B A;  4E92 A;  2ONT A;  1U7K A;  1VQN P;  2MD9 A;  2QNW A;  3HYB A;  2KOS A;  1QRJ A;  2Z45 A;  3GZM A;  1VQK P;  2DGY A;  5I4T G;  3CCR P;  1AUM A;  1IMP A;  4H2W C;  1T8K A;  3DS0 A;  2OTJ P;  4PH1 A;  3CMA P;  1VQ9 P;  1IUQ A;  3CC4 P;  2VLN A;  2FVA A;  1M9X C;  2PWO A;  2X82 A;  2K92 A;  1X3O A;  1M74 A;  2FVF A;  2LML A;  2VLP A;  2PXR C;  2GYK A;  2M5R A;  1VQ6 P;  2K0Y A;  2N6Z A;  1GXH A;  5BS1 A;  3CCJ P;  4U0F A;  1L6N A;  2MF4 A;  5JPA A;  1VQ7 P;  2PEJ A;  3G1I A;  2CG5 B;  3G28 A;  1HY8 A;  2PNG A;  4INB A;  2FQ1 A;  1G03 A;  4XFY A;  2PEM A;  5HVC A;  1Q7Y Q;  2FQ0 A;  5EW5 E;  2LKI A;  4COC A;  4R0M A;  1BXI A;  3NY7 B;  2QEX P;  2FAE A;  2M8L A;  2K0D X;  4GR2 A;  3G1G A;  1YJ9 P;  1KQS O;  1VQM P;  2XXM A;  4PXH B;  3U43 A;  2N50 A;  2QA4 P;  1GWP A;  2K94 A;  2GON A;  2X2B A;  4LQW C;  5EJD A;  2KW2 A;  2EG5 A;  1YHQ P;  2LIW A;  4U0D A;  1K30 A;  3LMO A;  3RG6 C;  2LTE A;  1VQP P;  4NX4 C;  5HGL A;  1OR5 A;  2KG9 A;  4CA3 A;  1AK4 C;  3I55 P;  1M9F C;  1QVG O;  1KC8 Q;  4U0C A;  1GPJ A;  2KOR A;  3G4S P;  1M6E X;  2PEN A;  1JJ2 O;  1GXG A;  1NJI Q;  1Q82 Q;  2KWL A;  2VSQ A;  1P7N A;  2LOL A;  2AFE A;  2JPR A;  2MVV A;  3CC2 P;  3DS1 A;  2MR7 A;  1A8O A;  1YI2 P;  2GZE A;  2BUO A;  5CZD B;  3EJB A;  2KGF A;  4DGE C;  2PY8 A;  2L9F A;  4QNB A;  3CCM P;  7CEI A;  2CQ8 A;  3CME P;  1VQL P;  2N5I A;  1L0I A;  2GDY A;  4XRO A;  1A43 A;  2AF8 A;  2PEO A;  2JGP A;  2KOO A;  3DS4 A;  4DG9 A;  2K93 A;  1YIJ P;  2V4X A;  5KP6 B;  1EIA A;  3M1M A;  3MGE A;  3GKL C;  3OW2 O;  2N5H A;  4WYM A;  1YJW P;  3CCE P;  3CXC O;  2LIU A;  1VQ5 P;  2BHV A;  1E6J P;  1M1K Q;  2OTL P;  4BPG A;  2Z46 A;  2WLV B;  4U0E A;  4PWV B;  1DV5 A; 
#chains in the Genus database with same CATH homology
 2GON A;  5HGN A;  4LQW C;  1Q81 Q;  2X83 A;  2XGV A;  3BP9 A;  3DS3 A;  1VQ4 P;  2EG5 A;  2WLV A;  3G0V A;  1YJN P;  1VQ8 P;  1YHQ P;  1YIT P;  4XFX A;  4U0D A;  1K30 A;  3WBH A;  3CD6 P;  3I56 P;  3RG6 C;  2GOL B;  2OAR A;  4NX4 C;  5HGL A;  2P9X A;  2PEQ A;  4GR6 A;  1RO2 A;  1VQP P;  4HTW A;  3NTE A;  1M6N A;  1EM9 A;  4U0A A;  3Q20 A;  5BS2 A;  3H0D A;  1AK4 C;  2KOD A;  2EFJ A;  3E2D A;  1W2B O;  3I55 P;  5HGM A;  1K8A Q;  1M9F C;  1M9D C;  3H4E A;  2M8N A;  4E91 A;  3H47 A;  1EOQ A;  4U0B A;  2CWO A;  2PEK A;  4IPY A;  3VRL C;  1N8R Q;  1KC8 Q;  4U0C A;  3G4S P;  4E92 A;  2ONT A;  2XDE A;  1M6E X;  2PEN A;  2XT1 A;  1JJ2 O;  1U7K A;  1VQN P;  5F2O A;  3G26 A;  1NJI Q;  1Q82 Q;  2Z44 A;  3B5I A;  3HYB A;  1P7N A;  2XGY A;  2M8P A;  4DGA C;  2JPR A;  3CC2 P;  3DS1 A;  3LRY A;  1KD1 Q;  3DPH A;  1QRJ A;  1A8O A;  1YI2 P;  2Z45 A;  1VQK P;  2BUO A;  2JYL A;  2XGU A;  1Q86 Q;  5HGK A;  2DGY A;  5I4T G;  1QVF O;  2KGF A;  3CCR P;  1AUM A;  4DGE C;  2PY8 A;  4PH3 A;  3DS2 A;  4QNB A;  3G71 P;  2PWM A;  3CCM P;  1VQO P;  1M9Y C;  1QVG O;  3DS0 A;  5HGO A;  2JYG A;  2OTJ P;  4PH1 A;  1K73 Q;  3CMA P;  4COP A;  1IUQ A;  1VQ9 P;  3CC4 P;  1ZMB A;  2JO0 A;  1M9X C;  2PWO A;  2X82 A;  4B4N A;  3P05 A;  1M74 A;  3CME P;  1BAJ A;  3G6E P;  1VQL P;  2PXR C;  2LF4 A;  2Y4Z A;  4PH0 A;  3G29 A;  1VQ6 P;  4XRO A;  1A43 A;  5BS1 A;  3CCJ P;  4U0F A;  1D1D A;  2PEO A;  1L6N A;  2EIA A;  2PEI A;  3HZQ A;  4XFZ A;  3DS4 A;  1K9M Q;  2XV6 A;  3G21 A;  1YIJ P;  1M90 Q;  3CC7 P;  2V4X A;  5JPA A;  2L6E A;  4M0I A;  1VQ7 P;  3CPW O;  2X2D D;  2PEJ A;  1EIA A;  3G1I A;  3M1M A;  3G28 A;  3MGE A;  4INB A;  1G03 A;  3OW2 O;  4WYM A;  4XFY A;  2E1M A;  1YJW P;  3CCE P;  2PEM A;  1Q7Y Q;  4J93 A;  3CXC O;  4COC A;  3CCQ P;  3CCV P;  5F2K A;  1RNI A;  2QEX P;  3CCL P;  1VQ5 P;  2M8L A;  3CCU P;  2BHV A;  4PH2 A;  1M9E C;  1E6J P;  3G1G A;  4GR2 A;  1M1K Q;  2OTL P;  1YJ9 P;  1KQS O;  1M9C C;  1VQM P;  2Z46 A;  3DS5 A;  3DTJ A;  2XXM A;  2WLV B;  4U0E A;  1RO0 A;  5F2N A;  5DCK A;  4XRQ A;  1S72 P;  1AFV A;  3CCS P;  2QA4 P;  1GWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...