4U0DA

Hexameric hiv-1 ca in complex with nup153 peptide, p212121 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
216
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 70
structure length 216
sequence length 219
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0dA02
3DPHA 4XFYA 1M9EC 3G0VA 4WYMA 2WLVB 1P7NA 3NTEA 4COCA 4INBA 2PWMA 3BP9A 4COPA 1A8OA 2JPRA 2EIAA 2PXRC 3G1GA 1L6NA 2JO0A 4PH0A 4PH1A 1M9YC 3DTJA 2GOLB 1AUMA 2X2DD 4M0IA 2XT1A 3P05A 2GONA 5DCKA 5HGKA 3DS1A 3G28A 1M9CC 2XV6A 2X82A 3DS4A 1EOQA 1M9DC 1E6JP 1G03A 5HGOA 1U7KA 2LF4A 3DS2A 2WLVA 4U0BA 1GWPA 4PH2A 3DS0A 1AFVA 3H4EA 2BUOA 2M8LA 2ONTA 2XGVA 2JYLA 4HTWA 2JYGA 2L6EA 2XGYA 4QNBA 4B4NA 4U0CA 4DGEC 2X83A 3G29A 4LQWC 1QRJA 3MGEA 4XRQA 2KGFA 3DS5A 4XROA 2PWOA 3G1IA 5HGMA 1EIAA 4XFXA 2M8PA 3H47A 4U0FA 5JPAA 1BAJA 4U0AA 4XFZA 1D1DA 4E91A 3G21A 1M9FC 5HGLA 4U0EA 3G26A 1M9XC 4IPYA 4PH3A 4NX4C 2KODA 3LRYA 5HGNA 1EM9A 1AK4C 2V4XA 2Y4ZA 4DGAC 2M8NA 2XGUA 3VRLC 1A43A 5I4TG 4J93A 4U0DA 4E92A 2XDEA 3DS3A 2XXMA
chains in the Genus database with same CATH superfamily
1M6NA 2OTLP 2EHSA 2OTJP 2N5HA 3NTEA 2QNWA 4INBA 2PWMA 2LPKA 4COPA 1NJIQ 1M9YC 3CD6P 3DTJA 1AUMA 2GZEA 3EJDA 4M0IA 2JQ4A 2EFJA 2FVFA 2DNWA 4CA3A 1RNIA 5HGOA 2WPTA 2LF4A 2XZ1C 1M90Q 3I56P 2GYKA 2PEIA 5BS1A 3EJEA 1YI2P 1NQ4A 2CQ8A 2BUOA 2FADA 2JYLA 2QA4P 1QVGO 4MRTC 2PENA 2VLNA 2PEKA 5F2KA 2GZJA 2KWLA 2KG6A 2KW2A 2VLPA 1YITP 2M5RA 3G1IA 2CG5B 1EIAA 2AFEA 5EJDA 2XZ0D 3H47A 2KGEA 1VQMP 1KC8Q 2LOLA 1X3OA 4H2WC 1D1DA 1M9FC 2MR7A 3G26A 2JB0A 1VQ5P 4PH3A 1Q7YQ 3CCQP 2V4XA 2Y4ZA 4DGAC 2GZGA 2VSQA 4F37A 1M6EX 4U0DA 1VQKP 3G6EP 1GXHA 3B5IA 2LKIA 1L0HA 4WYMA 2AF8A 3CE7A 3CC2P 5F2OA 2WLVB 4PXHB 1FR2A 3CPWO 3CCJP 3LMOA 5BS2A 4BPFA 7CEIA 1Q82Q 1F80D 3CCUP 4H2XC 5F2NA 1VQPP 1VQ7P 1L6NA 2JO0A 1L0IA 4PH1A 2FVAA 3CCEP 2JU1A 1VHNA 3CMAP 2XT1A 1YJ9P 5DCKA 1M9CC 1K8AQ 1K73Q 3GZMA 1AF8A 1U7KA 3HZQA 1GXGA 2KOPA 2ERHA 3DS2A 2WLVA 1GWPA 4PH2A 2FAEA 1ZNVA 2X2BA 3DS0A 1Q81Q 2N98A 1VQ9P 2PEMA 2M8LA 2VLOA 2E1MA 2CGQA 4HTWA 4U0CA 4DGEC 2X83A 2KGAA 4PWVB 1K30A 1ZMBA 2GDWA 2CNRA 4LQWC 3CCLP 3HYBA 2MR8A 1VQ8P 4H2YC 2GDYA 2K2QA 1VKUA 3M1MA 2K0DX 2MF4A 4GR2A 2AFDA 2KG8A 2DGYA 2FVEA 1YJNP 1VQLP 3GJNA 2GZIA 4E91A 3G21A 5HGLA 4U0EA 4NX4C 2MVVA 2KODA 3LRYA 1AK4C 3VRLC 2XGUA 4QKOA 2FQ0A 2CWOA 5I4TG 4J93A 2K93A 2KOOA 3DS3A 2K92A 2JAZA 2KGCA 1M9EC 3G0VA 1K9MQ 3RG2A 2FACA 1P7NA 4R0MA 3BP9A 1A8OA 3GZLA 2KR5A 2JPRA 2LIWA 2N6ZA 3B4QA 2FHSC 2K0XA 2EIAA 2NO8A 2X2DD 5HGKA 5HVCA 1S72P 3G28A 1CEIA 1RO2A 2LIUA 2XV6A 2EHTA 2X82A 3CC4P 2K0YA 1E6JP 2JU2A 1IMPA 2Z45A 2KOQA 1DNYA 4U0BA 1IMQA 2KGDA 2GDXA 3H4EA 1GPJA 4IZ6A 3CCMP 2K5XA 2ROQA 2XGVA 2JYGA 2XGYA 4QNBA 1VQ4P 4BPHA 1ACPA 2GZFA 4NEOA 3WBHA 1VQOP 2Z44A 2N5IA 4XRQA 2Z46A 3DS5A 4UHPB 5EW5E 1VQNP 2QEXP 4XFXA 1QVFO 3CMEP 1E0HA 3CCRP 2L4BA 1BAJA 1Z6MA 3I55P 4XFZA 5KP8B 4IPYA 2JBGA 2OARA 2KOSA 5HGNA 1HY8A 3OW2O 4E92A 2P9XA 2XDEA 2XXMA 3DPHA 4XFYA 2K94A 3Q20A 1M1KQ 1N8RQ 2BHVA 1BXIA 4COCA 2MVUA 2JGPA 1HQBA 5HV8A 4DG9A 3U43A 2PXRC 3G1GA 3CCVP 4PH0A 2L22A 2GOLB 3H0DA 3P05A 2GONA 3DS1A 3GKLC 1DV5A 3DS4A 1YIJP 1KQSO 1Q86Q 1JJ2O 5KP7B 1EOQA 1M9DC 3CXCO 1G03A 1M74A 2MY5A 3RG6C 2AVAA 3CCSP 2LMLA 1AYIA 1YJWP 1AFVA 2KG9A 2EG5A 2ONTA 3E2DA 1RO0A 1KLPA 2PY8A 2L6EA 2N50A 5KP6B 3G4SP 4B4NA 4BPGA 1KD1Q 2FQ2A 3G29A 2L0QA 1QRJA 1UJZA 3MGEA 2LTEA 2KORA 2PEJA 5CZDB 2KGFA 3NY7B 4XROA 2L9FA 2LL8A 2PWOA 2FQ1A 2N6YA 5HGMA 4HKGA 2M8PA 2MD9A 3G71P 1VQ6P 1T8KA 4U0FA 2PEOA 5JPAA 1IUQA 2PEQA 3EJBA 4U0AA 2PNGA 1YHQP 3CC7P 1M9XC 1EM9A 1W2BO 2M8NA 2VLQA 1A43A 1MZ8A 1UNKA 1EMVA 4GR6A 1OR5A
chains in the Genus database with same CATH topology
3DPHA 4XFYA 1M9EC 3G0VA 1K9MQ 4WYMA 3Q20A 3CC2P 5F2OA 1M6NA 1M1KQ 2WLVB 1N8RQ 2OTLP 1P7NA 3CPWO 2OTJP 3NTEA 2BHVA 3CCJP 4COCA 5BS2A 4INBA 2PWMA 3BP9A 4COPA 1A8OA 1Q82Q 2JPRA 3CCUP 2EIAA 2PXRC 3G1GA 5F2NA 1VQPP 1VQ7P 1L6NA 2JO0A 3CCVP 1NJIQ 4PH0A 4PH1A 1M9YC 3CD6P 3DTJA 2GOLB 3CCEP 1AUMA 3H0DA 2X2DD 3CMAP 4M0IA 2XT1A 3P05A 2EFJA 1YJ9P 2GONA 5DCKA 5HGKA 3DS1A 1S72P 3G28A 1M9CC 1RO2A 2XV6A 2X82A 3DS4A 1YIJP 1RNIA 1Q86Q 1KQSO 1JJ2O 1K8AQ 1K73Q 1EOQA 1M9DC 3CXCO 3CC4P 1E6JP 1G03A 1M74A 5HGOA 1U7KA 3HZQA 2Z45A 3RG6C 2LF4A 3DS2A 2WLVA 4U0BA 1M90Q 3I56P 2PEIA 5BS1A 3CCSP 1GWPA 1YI2P 1YJWP 4PH2A 1Q81Q 3DS0A 1AFVA 3H4EA 2BUOA 3CCMP 1VQ9P 2PEMA 2M8LA 2EG5A 2ONTA 2XGVA 2E1MA 2JYLA 3E2DA 1RO0A 4HTWA 2JYGA 2PY8A 2L6EA 2QA4P 2XGYA 4QNBA 3G4SP 4B4NA 4U0CA 1VQ4P 4DGEC 2X83A 1QVGO 1KD1Q 2PENA 1K30A 1ZMBA 3G29A 4LQWC 2PEKA 5F2KA 1QRJA 3CCLP 3WBHA 1VQOP 3MGEA 2Z44A 3HYBA 1VQ8P 1YITP 2PEJA 4XRQA 2KGFA 2Z46A 3DS5A 4XROA 3M1MA 2PWOA 3G1IA 1VQNP 5HGMA 1EIAA 2QEXP 4XFXA 1QVFO 2M8PA 3G71P 4GR2A 3CMEP 1VQ6P 2P9XA 3H47A 1VQMP 3CCRP 4U0FA 2PEOA 1KC8Q 2DGYA 5JPAA 1BAJA 3I55P 1IUQA 2PEQA 4U0AA 4XFZA 1YJNP 1VQLP 1YHQP 1D1DA 4E91A 3G21A 1M9FC 5HGLA 4U0EA 3G26A 1M9XC 3CC7P 4IPYA 1VQ5P 4PH3A 4NX4C 2OARA 1Q7YQ 2KODA 3CCQP 3LRYA 5HGNA 1EM9A 1AK4C 2V4XA 2Y4ZA 4DGAC 2M8NA 2XGUA 3VRLC 1A43A 1W2BO 3OW2O 1M6EX 2CWOA 5I4TG 4J93A 4U0DA 4E92A 1VQKP 4GR6A 3G6EP 2XDEA 3DS3A 3B5IA 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPH A;  4XFY A;  1M9E C;  3G0V A;  4WYM A;  2WLV B;  1P7N A;  3NTE A;  4COC A;  4INB A;  2PWM A;  3BP9 A;  4COP A;  1A8O A;  2JPR A;  2EIA A;  2PXR C;  3G1G A;  1L6N A;  2JO0 A;  4PH0 A;  4PH1 A;  1M9Y C;  3DTJ A;  2GOL B;  1AUM A;  2X2D D;  4M0I A;  2XT1 A;  3P05 A;  2GON A;  5DCK A;  5HGK A;  3DS1 A;  3G28 A;  1M9C C;  2XV6 A;  2X82 A;  3DS4 A;  1EOQ A;  1M9D C;  1E6J P;  1G03 A;  5HGO A;  1U7K A;  2LF4 A;  3DS2 A;  2WLV A;  4U0B A;  1GWP A;  4PH2 A;  3DS0 A;  1AFV A;  3H4E A;  2BUO A;  2M8L A;  2ONT A;  2XGV A;  2JYL A;  4HTW A;  2JYG A;  2L6E A;  2XGY A;  4QNB A;  4B4N A;  4U0C A;  4DGE C;  2X83 A;  3G29 A;  4LQW C;  1QRJ A;  3MGE A;  4XRQ A;  2KGF A;  3DS5 A;  4XRO A;  2PWO A;  3G1I A;  5HGM A;  1EIA A;  4XFX A;  2M8P A;  3H47 A;  4U0F A;  5JPA A;  1BAJ A;  4U0A A;  4XFZ A;  1D1D A;  4E91 A;  3G21 A;  1M9F C;  5HGL A;  4U0E A;  3G26 A;  1M9X C;  4IPY A;  4PH3 A;  4NX4 C;  2KOD A;  3LRY A;  5HGN A;  1EM9 A;  1AK4 C;  2V4X A;  2Y4Z A;  4DGA C;  2M8N A;  2XGU A;  3VRL C;  1A43 A;  5I4T G;  4J93 A;  4U0D A;  4E92 A;  2XDE A;  3DS3 A;  2XXM A; 
#chains in the Genus database with same CATH topology
 1M6N A;  2OTL P;  2EHS A;  2OTJ P;  2N5H A;  3NTE A;  2QNW A;  4INB A;  2PWM A;  2LPK A;  4COP A;  1NJI Q;  1M9Y C;  3CD6 P;  3DTJ A;  1AUM A;  2GZE A;  3EJD A;  4M0I A;  2JQ4 A;  2EFJ A;  2FVF A;  2DNW A;  4CA3 A;  1RNI A;  5HGO A;  2WPT A;  2LF4 A;  2XZ1 C;  1M90 Q;  3I56 P;  2GYK A;  2PEI A;  5BS1 A;  3EJE A;  1YI2 P;  1NQ4 A;  2CQ8 A;  2BUO A;  2FAD A;  2JYL A;  2QA4 P;  1QVG O;  4MRT C;  2PEN A;  2VLN A;  2PEK A;  5F2K A;  2GZJ A;  2KWL A;  2KG6 A;  2KW2 A;  2VLP A;  1YIT P;  2M5R A;  3G1I A;  2CG5 B;  1EIA A;  2AFE A;  5EJD A;  2XZ0 D;  3H47 A;  2KGE A;  1VQM P;  1KC8 Q;  2LOL A;  1X3O A;  4H2W C;  1D1D A;  1M9F C;  2MR7 A;  3G26 A;  2JB0 A;  1VQ5 P;  4PH3 A;  1Q7Y Q;  3CCQ P;  2V4X A;  2Y4Z A;  4DGA C;  2GZG A;  2VSQ A;  4F37 A;  1M6E X;  4U0D A;  1VQK P;  3G6E P;  1GXH A;  3B5I A;  2LKI A;  1L0H A;  4WYM A;  2AF8 A;  3CE7 A;  3CC2 P;  5F2O A;  2WLV B;  4PXH B;  1FR2 A;  3CPW O;  3CCJ P;  3LMO A;  5BS2 A;  4BPF A;  7CEI A;  1Q82 Q;  1F80 D;  3CCU P;  4H2X C;  5F2N A;  1VQP P;  1VQ7 P;  1L6N A;  2JO0 A;  1L0I A;  4PH1 A;  2FVA A;  3CCE P;  2JU1 A;  1VHN A;  3CMA P;  2XT1 A;  1YJ9 P;  5DCK A;  1M9C C;  1K8A Q;  1K73 Q;  3GZM A;  1AF8 A;  1U7K A;  3HZQ A;  1GXG A;  2KOP A;  2ERH A;  3DS2 A;  2WLV A;  1GWP A;  4PH2 A;  2FAE A;  1ZNV A;  2X2B A;  3DS0 A;  1Q81 Q;  2N98 A;  1VQ9 P;  2PEM A;  2M8L A;  2VLO A;  2E1M A;  2CGQ A;  4HTW A;  4U0C A;  4DGE C;  2X83 A;  2KGA A;  4PWV B;  1K30 A;  1ZMB A;  2GDW A;  2CNR A;  4LQW C;  3CCL P;  3HYB A;  2MR8 A;  1VQ8 P;  4H2Y C;  2GDY A;  2K2Q A;  1VKU A;  3M1M A;  2K0D X;  2MF4 A;  4GR2 A;  2AFD A;  2KG8 A;  2DGY A;  2FVE A;  1YJN P;  1VQL P;  3GJN A;  2GZI A;  4E91 A;  3G21 A;  5HGL A;  4U0E A;  4NX4 C;  2MVV A;  2KOD A;  3LRY A;  1AK4 C;  3VRL C;  2XGU A;  4QKO A;  2FQ0 A;  2CWO A;  5I4T G;  4J93 A;  2K93 A;  2KOO A;  3DS3 A;  2K92 A;  2JAZ A;  2KGC A;  1M9E C;  3G0V A;  1K9M Q;  3RG2 A;  2FAC A;  1P7N A;  4R0M A;  3BP9 A;  1A8O A;  3GZL A;  2KR5 A;  2JPR A;  2LIW A;  2N6Z A;  3B4Q A;  2FHS C;  2K0X A;  2EIA A;  2NO8 A;  2X2D D;  5HGK A;  5HVC A;  1S72 P;  3G28 A;  1CEI A;  1RO2 A;  2LIU A;  2XV6 A;  2EHT A;  2X82 A;  3CC4 P;  2K0Y A;  1E6J P;  2JU2 A;  1IMP A;  2Z45 A;  2KOQ A;  1DNY A;  4U0B A;  1IMQ A;  2KGD A;  2GDX A;  3H4E A;  1GPJ A;  4IZ6 A;  3CCM P;  2K5X A;  2ROQ A;  2XGV A;  2JYG A;  2XGY A;  4QNB A;  1VQ4 P;  4BPH A;  1ACP A;  2GZF A;  4NEO A;  3WBH A;  1VQO P;  2Z44 A;  2N5I A;  4XRQ A;  2Z46 A;  3DS5 A;  4UHP B;  5EW5 E;  1VQN P;  2QEX P;  4XFX A;  1QVF O;  3CME P;  1E0H A;  3CCR P;  2L4B A;  1BAJ A;  1Z6M A;  3I55 P;  4XFZ A;  5KP8 B;  4IPY A;  2JBG A;  2OAR A;  2KOS A;  5HGN A;  1HY8 A;  3OW2 O;  4E92 A;  2P9X A;  2XDE A;  2XXM A;  3DPH A;  4XFY A;  2K94 A;  3Q20 A;  1M1K Q;  1N8R Q;  2BHV A;  1BXI A;  4COC A;  2MVU A;  2JGP A;  1HQB A;  5HV8 A;  4DG9 A;  3U43 A;  2PXR C;  3G1G A;  3CCV P;  4PH0 A;  2L22 A;  2GOL B;  3H0D A;  3P05 A;  2GON A;  3DS1 A;  3GKL C;  1DV5 A;  3DS4 A;  1YIJ P;  1KQS O;  1Q86 Q;  1JJ2 O;  5KP7 B;  1EOQ A;  1M9D C;  3CXC O;  1G03 A;  1M74 A;  2MY5 A;  3RG6 C;  2AVA A;  3CCS P;  2LML A;  1AYI A;  1YJW P;  1AFV A;  2KG9 A;  2EG5 A;  2ONT A;  3E2D A;  1RO0 A;  1KLP A;  2PY8 A;  2L6E A;  2N50 A;  5KP6 B;  3G4S P;  4B4N A;  4BPG A;  1KD1 Q;  2FQ2 A;  3G29 A;  2L0Q A;  1QRJ A;  1UJZ A;  3MGE A;  2LTE A;  2KOR A;  2PEJ A;  5CZD B;  2KGF A;  3NY7 B;  4XRO A;  2L9F A;  2LL8 A;  2PWO A;  2FQ1 A;  2N6Y A;  5HGM A;  4HKG A;  2M8P A;  2MD9 A;  3G71 P;  1VQ6 P;  1T8K A;  4U0F A;  2PEO A;  5JPA A;  1IUQ A;  2PEQ A;  3EJB A;  4U0A A;  2PNG A;  1YHQ P;  3CC7 P;  1M9X C;  1EM9 A;  1W2B O;  2M8N A;  2VLQ A;  1A43 A;  1MZ8 A;  1UNK A;  1EMV A;  4GR6 A;  1OR5 A; 
#chains in the Genus database with same CATH homology
 3DPH A;  4XFY A;  1M9E C;  3G0V A;  1K9M Q;  4WYM A;  3Q20 A;  3CC2 P;  5F2O A;  1M6N A;  1M1K Q;  2WLV B;  1N8R Q;  2OTL P;  1P7N A;  3CPW O;  2OTJ P;  3NTE A;  2BHV A;  3CCJ P;  4COC A;  5BS2 A;  4INB A;  2PWM A;  3BP9 A;  4COP A;  1A8O A;  1Q82 Q;  2JPR A;  3CCU P;  2EIA A;  2PXR C;  3G1G A;  5F2N A;  1VQP P;  1VQ7 P;  1L6N A;  2JO0 A;  3CCV P;  1NJI Q;  4PH0 A;  4PH1 A;  1M9Y C;  3CD6 P;  3DTJ A;  2GOL B;  3CCE P;  1AUM A;  3H0D A;  2X2D D;  3CMA P;  4M0I A;  2XT1 A;  3P05 A;  2EFJ A;  1YJ9 P;  2GON A;  5DCK A;  5HGK A;  3DS1 A;  1S72 P;  3G28 A;  1M9C C;  1RO2 A;  2XV6 A;  2X82 A;  3DS4 A;  1YIJ P;  1RNI A;  1Q86 Q;  1KQS O;  1JJ2 O;  1K8A Q;  1K73 Q;  1EOQ A;  1M9D C;  3CXC O;  3CC4 P;  1E6J P;  1G03 A;  1M74 A;  5HGO A;  1U7K A;  3HZQ A;  2Z45 A;  3RG6 C;  2LF4 A;  3DS2 A;  2WLV A;  4U0B A;  1M90 Q;  3I56 P;  2PEI A;  5BS1 A;  3CCS P;  1GWP A;  1YI2 P;  1YJW P;  4PH2 A;  1Q81 Q;  3DS0 A;  1AFV A;  3H4E A;  2BUO A;  3CCM P;  1VQ9 P;  2PEM A;  2M8L A;  2EG5 A;  2ONT A;  2XGV A;  2E1M A;  2JYL A;  3E2D A;  1RO0 A;  4HTW A;  2JYG A;  2PY8 A;  2L6E A;  2QA4 P;  2XGY A;  4QNB A;  3G4S P;  4B4N A;  4U0C A;  1VQ4 P;  4DGE C;  2X83 A;  1QVG O;  1KD1 Q;  2PEN A;  1K30 A;  1ZMB A;  3G29 A;  4LQW C;  2PEK A;  5F2K A;  1QRJ A;  3CCL P;  3WBH A;  1VQO P;  3MGE A;  2Z44 A;  3HYB A;  1VQ8 P;  1YIT P;  2PEJ A;  4XRQ A;  2KGF A;  2Z46 A;  3DS5 A;  4XRO A;  3M1M A;  2PWO A;  3G1I A;  1VQN P;  5HGM A;  1EIA A;  2QEX P;  4XFX A;  1QVF O;  2M8P A;  3G71 P;  4GR2 A;  3CME P;  1VQ6 P;  2P9X A;  3H47 A;  1VQM P;  3CCR P;  4U0F A;  2PEO A;  1KC8 Q;  2DGY A;  5JPA A;  1BAJ A;  3I55 P;  1IUQ A;  2PEQ A;  4U0A A;  4XFZ A;  1YJN P;  1VQL P;  1YHQ P;  1D1D A;  4E91 A;  3G21 A;  1M9F C;  5HGL A;  4U0E A;  3G26 A;  1M9X C;  3CC7 P;  4IPY A;  1VQ5 P;  4PH3 A;  4NX4 C;  2OAR A;  1Q7Y Q;  2KOD A;  3CCQ P;  3LRY A;  5HGN A;  1EM9 A;  1AK4 C;  2V4X A;  2Y4Z A;  4DGA C;  2M8N A;  2XGU A;  3VRL C;  1A43 A;  1W2B O;  3OW2 O;  1M6E X;  2CWO A;  5I4T G;  4J93 A;  4U0D A;  4E92 A;  1VQK P;  4GR6 A;  3G6E P;  2XDE A;  3DS3 A;  3B5I A;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...