4U0DA

Hexameric hiv-1 ca in complex with nup153 peptide, p212121 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
216
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 70
structure length 216
sequence length 219
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0dA02
4U0EA 2GOLB 4IPYA 1L6NA 2JO0A 4U0CA 5HGMA 2KGFA 4HTWA 5HGOA 3DS3A 2JYLA 4M0IA 1M9YC 1QRJA 5HGLA 1A8OA 1EM9A 4XFYA 4U0FA 3DS4A 4E91A 1BAJA 1A43A 2XGVA 4COCA 5HGNA 2WLVA 2L6EA 4XRQA 2JYGA 4PH2A 1AUMA 4WYMA 2X82A 3G21A 3DTJA 3LRYA 4DGEC 2PXRC 4PH3A 4J93A 3DS5A 3H47A 4LQWC 3G1IA 1AK4C 4B4NA 2XV6A 2XT1A 4E92A 4INBA 1U7KA 2M8NA 2X2DD 2KODA 3DS0A 3G28A 3P05A 1EOQA 1M9FC 1P7NA 3DPHA 2XGYA 4U0BA 2PWOA 2PWMA 1M9DC 2XXMA 3NTEA 4XFXA 5JPAA 4XROA 2XDEA 2EIAA 5DCKA 5I4TG 3DS1A 2ONTA 4PH1A 3G0VA 2M8LA 4QNBA 3VRLC 1E6JP 1EIAA 4PH0A 3MGEA 3BP9A 2LF4A 1M9EC 1D1DA 4U0AA 3G1GA 1G03A 2BUOA 2M8PA 5HGKA 2X83A 1AFVA 4XFZA 1GWPA 2Y4ZA 3DS2A 4COPA 1M9XC 2GONA 2XGUA 4U0DA 4DGAC 2JPRA 4NX4C 2WLVB 3H4EA 3G26A 3G29A 2V4XA 1M9CC
chains in the Genus database with same CATH superfamily
4U0EA 2GOLB 4U0CA 1K8AQ 1M1KQ 2JGPA 2MR8A 4PWVB 2QNWA 3CCUP 4HTWA 1RO2A 2FAEA 4M0IA 1K9MQ 2VLOA 4BPFA 2MVUA 2QA4P 3CC4P 1YITP 2XGVA 2L0QA 5EW5E 2FVFA 2K0YA 2FQ1A 2WLVA 3EJDA 4R0MA 4XRQA 2JYGA 2ERHA 2X82A 2N5HA 7CEIA 2FVEA 5KP6B 4PH3A 3LMOA 1IUQA 1AK4C 2DGYA 3RG6C 1FR2A 2XV6A 3HYBA 2AVAA 5EJDA 2PEIA 2GZEA 3H0DA 3P05A 1GXGA 1M9FC 3DPHA 2XGYA 2PEMA 2PWOA 1DNYA 1M9DC 3NTEA 2JU1A 4H2WC 1VQOP 2LOLA 5I4TG 3MGEA 1K30A 3BP9A 3CPWO 1VQKP 2LF4A 1G03A 2JBGA 1YJ9P 2M8PA 2PEQA 2PEKA 2GZFA 5KP8B 3B4QA 1AFVA 1VQNP 2JU2A 2N6ZA 5BS1A 1Q82Q 1AYIA 4NEOA 3DS2A 1Q86Q 2GONA 4H2YC 2KGAA 2VSQA 1HQBA 2N6YA 1L6NA 2N98A 5CZDB 1NQ4A 1Z6MA 2KGFA 1L0HA 2LPKA 5HGOA 3U43A 4CA3A 2GZJA 1M9YC 1QRJA 3B5IA 2XZ0D 4U0FA 3DS4A 1ZMBA 3EJEA 3I55P 2AFDA 2KOSA 1N8RQ 1A43A 2VLQA 1MZ8A 2PENA 2KGDA 2PY8A 1KQSO 1M6EX 1VQMP 2LTEA 1VQ5P 2AF8A 2KWLA 1VKUA 4J93A 3DS5A 2EHTA 2LL8A 3CMEP 2CWOA 4B4NA 1ZNVA 4INBA 1Q81Q 3I56P 3DS0A 2E1MA 2FQ2A 1AF8A 2MVVA 1P7NA 3CE7A 2GYKA 2PWMA 1IMPA 2Z44A 2FACA 5DCKA 3CCJP 2WPTA 3DS1A 2ONTA 3G0VA 5HV8A 1NJIQ 2M8LA 2JAZA 3VRLC 2KOQA 1E6JP 1EIAA 2P9XA 1M9EC 3G1GA 3G4SP 2K93A 1IMQA 2OARA 2CNRA 2EHSA 2X83A 1YJWP 2MR7A 2VLPA 1GWPA 3E2DA 2KGCA 1EMVA 4GR6A 3EJBA 3CCVP 5HVCA 1DV5A 2KORA 1M9XC 2KG8A 4DGAC 3CCSP 4NX4C 1E0HA 2WLVB 3G26A 3G29A 1M9CC 3HZQA 5KP7B 4IPYA 1VQPP 2KG6A 3CXCO 2GDYA 2BHVA 2GZIA 2JQ4A 1RNIA 1T8KA 1KD1Q 2K5XA 3CCQP 3GZLA 2LKIA 1K73Q 2K0DX 2PEJA 1Q7YQ 5HGLA 1L0IA 2XZ1C 1VQ6P 1UNKA 4XFYA 4IZ6A 4E91A 1BAJA 2EFJA 4COCA 5HGNA 3OW2O 3GZMA 2VLNA 1AUMA 4WYMA 2PEOA 3WBHA 3LRYA 2KGEA 2PXRC 2N50A 3G6EP 3H47A 2FHSC 1JJ2O 1VQ7P 4MRTC 1YHQP 1U7KA 2X2DD 2KODA 3RG2A 4DG9A 3G28A 2DNWA 2KOOA 3M1MA 2M5RA 2KOPA 1VQ8P 4U0BA 2XXMA 4XROA 2OTLP 2K92A 2EIAA 2CG5B 1OR5A 4PH1A 4QNBA 4PH0A 2OTJP 1D1DA 4U0AA 2BUOA 1HY8A 2KR5A 3CCLP 4BPGA 2AFEA 2KG9A 1KC8Q 1QVGO 5F2KA 2MF4A 2PNGA 4U0DA 4PXHB 2Z46A 1M90Q 5BS2A 3CD6P 2FQ0A 2N5IA 5F2OA 2K0XA 2L9FA 2JO0A 2GDWA 5HGMA 2QEXP 4GR2A 3DS3A 2K2QA 2JYLA 2FADA 1VQLP 1YJNP 3GJNA 3Q20A 1A8OA 4F37A 3CCRP 3NY7B 1EM9A 1VHNA 1ACPA 3CC2P 1F80D 3CMAP 2K94A 1GPJA 2L6EA 2FVAA 1M74A 2L4BA 2ROQA 4PH2A 1VQ9P 2JB0A 2CQ8A 3GKLC 3G21A 3CCEP 3DTJA 4DGEC 1BXIA 2MD9A 2GZGA 4HKGA 5F2NA 3CC7P 4LQWC 3G1IA 1GXHA 1KLPA 2GDXA 2KW2A 2XT1A 4E92A 1YIJP 2M8NA 2LMLA 1S72P 2LIUA 4H2XC 1EOQA 4XFXA 5JPAA 1W2BO 2XDEA 2EG5A 1RO0A 2NO8A 2X2BA 1QVFO 4UHPB 1VQ4P 1M6NA 2LIWA 1UJZA 5HGKA 4QKOA 1X3OA 2L22A 4XFZA 3G71P 2CGQA 2Y4ZA 1CEIA 4BPHA 4COPA 2MY5A 2XGUA 2Z45A 2JPRA 3H4EA 2V4XA 1YI2P 3CCMP
chains in the Genus database with same CATH topology
4U0EA 2GOLB 4IPYA 1L6NA 1VQPP 2JO0A 3CXCO 4U0CA 5HGMA 1K8AQ 2BHVA 2KGFA 1M1KQ 2QEXP 1RNIA 4GR2A 3CCUP 4HTWA 5HGOA 3DS3A 1KD1Q 3CCQP 1RO2A 2JYLA 4M0IA 1K73Q 1K9MQ 1VQLP 1YJNP 2PEJA 1Q7YQ 1M9YC 1QRJA 5HGLA 3B5IA 3Q20A 1A8OA 1VQ6P 3CCRP 1YI2P 1EM9A 2QA4P 4XFYA 4U0FA 3DS4A 1ZMBA 3I55P 3CC4P 4E91A 1BAJA 2EFJA 1YITP 1N8RQ 1A43A 2XGVA 3CC2P 4COCA 5HGNA 3OW2O 3CMAP 2PENA 2PY8A 1KQSO 2WLVA 2L6EA 4XRQA 1M74A 2JYGA 1M6EX 1VQMP 4PH2A 1AUMA 1VQ9P 4WYMA 2X82A 2PEOA 3G21A 1VQ5P 3CCEP 3WBHA 3DTJA 3LRYA 4DGEC 2PXRC 3G6EP 4PH3A 5F2NA 4J93A 3DS5A 3H47A 3CC7P 4LQWC 3G1IA 1IUQA 1AK4C 2DGYA 1JJ2O 3RG6C 2CWOA 3CMEP 1VQ7P 4B4NA 2XV6A 3HYBA 2XT1A 1YHQP 4E92A 4INBA 1U7KA 2M8NA 2X2DD 1YIJP 1S72P 1Q81Q 2PEIA 2KODA 3I56P 3H0DA 3DS0A 3G28A 2E1MA 3P05A 3M1MA 1EOQA 1M9FC 1P7NA 3DPHA 2XGYA 4U0BA 2PEMA 1VQ8P 2PWOA 2PWMA 1M9DC 2XXMA 3NTEA 4XFXA 1VQOP 5JPAA 4XROA 2Z44A 1W2BO 2OTLP 2XDEA 2EG5A 2EIAA 5DCKA 1RO0A 3CCJP 5I4TG 3DS1A 2ONTA 4PH1A 3G0VA 1QVFO 1NJIQ 2M8LA 4QNBA 3VRLC 1VQ4P 1E6JP 1EIAA 4PH0A 3MGEA 1K30A 2P9XA 3BP9A 3CPWO 1VQKP 2OTJP 2LF4A 1M9EC 1D1DA 4U0AA 1M6NA 3G1GA 3G4SP 1G03A 2BUOA 1YJ9P 2M8PA 2OARA 2PEQA 2PEKA 5HGKA 2X83A 3CCLP 1AFVA 1VQNP 5BS1A 1YJWP 4XFZA 1GWPA 3E2DA 3G71P 2Y4ZA 4GR6A 1Q82Q 3CCVP 1KC8Q 1QVGO 3DS2A 1Q86Q 4COPA 1M9XC 5F2KA 2GONA 2XGUA 4U0DA 4DGAC 2Z45A 3CCSP 2JPRA 2Z46A 4NX4C 1M90Q 2WLVB 3H4EA 3G26A 5BS2A 3CD6P 3G29A 2V4XA 1M9CC 5F2OA 3HZQA 3CCMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0E A;  2GOL B;  4IPY A;  1L6N A;  2JO0 A;  4U0C A;  5HGM A;  2KGF A;  4HTW A;  5HGO A;  3DS3 A;  2JYL A;  4M0I A;  1M9Y C;  1QRJ A;  5HGL A;  1A8O A;  1EM9 A;  4XFY A;  4U0F A;  3DS4 A;  4E91 A;  1BAJ A;  1A43 A;  2XGV A;  4COC A;  5HGN A;  2WLV A;  2L6E A;  4XRQ A;  2JYG A;  4PH2 A;  1AUM A;  4WYM A;  2X82 A;  3G21 A;  3DTJ A;  3LRY A;  4DGE C;  2PXR C;  4PH3 A;  4J93 A;  3DS5 A;  3H47 A;  4LQW C;  3G1I A;  1AK4 C;  4B4N A;  2XV6 A;  2XT1 A;  4E92 A;  4INB A;  1U7K A;  2M8N A;  2X2D D;  2KOD A;  3DS0 A;  3G28 A;  3P05 A;  1EOQ A;  1M9F C;  1P7N A;  3DPH A;  2XGY A;  4U0B A;  2PWO A;  2PWM A;  1M9D C;  2XXM A;  3NTE A;  4XFX A;  5JPA A;  4XRO A;  2XDE A;  2EIA A;  5DCK A;  5I4T G;  3DS1 A;  2ONT A;  4PH1 A;  3G0V A;  2M8L A;  4QNB A;  3VRL C;  1E6J P;  1EIA A;  4PH0 A;  3MGE A;  3BP9 A;  2LF4 A;  1M9E C;  1D1D A;  4U0A A;  3G1G A;  1G03 A;  2BUO A;  2M8P A;  5HGK A;  2X83 A;  1AFV A;  4XFZ A;  1GWP A;  2Y4Z A;  3DS2 A;  4COP A;  1M9X C;  2GON A;  2XGU A;  4U0D A;  4DGA C;  2JPR A;  4NX4 C;  2WLV B;  3H4E A;  3G26 A;  3G29 A;  2V4X A;  1M9C C; 
#chains in the Genus database with same CATH topology
 4U0E A;  2GOL B;  4U0C A;  1K8A Q;  1M1K Q;  2JGP A;  2MR8 A;  4PWV B;  2QNW A;  3CCU P;  4HTW A;  1RO2 A;  2FAE A;  4M0I A;  1K9M Q;  2VLO A;  4BPF A;  2MVU A;  2QA4 P;  3CC4 P;  1YIT P;  2XGV A;  2L0Q A;  5EW5 E;  2FVF A;  2K0Y A;  2FQ1 A;  2WLV A;  3EJD A;  4R0M A;  4XRQ A;  2JYG A;  2ERH A;  2X82 A;  2N5H A;  7CEI A;  2FVE A;  5KP6 B;  4PH3 A;  3LMO A;  1IUQ A;  1AK4 C;  2DGY A;  3RG6 C;  1FR2 A;  2XV6 A;  3HYB A;  2AVA A;  5EJD A;  2PEI A;  2GZE A;  3H0D A;  3P05 A;  1GXG A;  1M9F C;  3DPH A;  2XGY A;  2PEM A;  2PWO A;  1DNY A;  1M9D C;  3NTE A;  2JU1 A;  4H2W C;  1VQO P;  2LOL A;  5I4T G;  3MGE A;  1K30 A;  3BP9 A;  3CPW O;  1VQK P;  2LF4 A;  1G03 A;  2JBG A;  1YJ9 P;  2M8P A;  2PEQ A;  2PEK A;  2GZF A;  5KP8 B;  3B4Q A;  1AFV A;  1VQN P;  2JU2 A;  2N6Z A;  5BS1 A;  1Q82 Q;  1AYI A;  4NEO A;  3DS2 A;  1Q86 Q;  2GON A;  4H2Y C;  2KGA A;  2VSQ A;  1HQB A;  2N6Y A;  1L6N A;  2N98 A;  5CZD B;  1NQ4 A;  1Z6M A;  2KGF A;  1L0H A;  2LPK A;  5HGO A;  3U43 A;  4CA3 A;  2GZJ A;  1M9Y C;  1QRJ A;  3B5I A;  2XZ0 D;  4U0F A;  3DS4 A;  1ZMB A;  3EJE A;  3I55 P;  2AFD A;  2KOS A;  1N8R Q;  1A43 A;  2VLQ A;  1MZ8 A;  2PEN A;  2KGD A;  2PY8 A;  1KQS O;  1M6E X;  1VQM P;  2LTE A;  1VQ5 P;  2AF8 A;  2KWL A;  1VKU A;  4J93 A;  3DS5 A;  2EHT A;  2LL8 A;  3CME P;  2CWO A;  4B4N A;  1ZNV A;  4INB A;  1Q81 Q;  3I56 P;  3DS0 A;  2E1M A;  2FQ2 A;  1AF8 A;  2MVV A;  1P7N A;  3CE7 A;  2GYK A;  2PWM A;  1IMP A;  2Z44 A;  2FAC A;  5DCK A;  3CCJ P;  2WPT A;  3DS1 A;  2ONT A;  3G0V A;  5HV8 A;  1NJI Q;  2M8L A;  2JAZ A;  3VRL C;  2KOQ A;  1E6J P;  1EIA A;  2P9X A;  1M9E C;  3G1G A;  3G4S P;  2K93 A;  1IMQ A;  2OAR A;  2CNR A;  2EHS A;  2X83 A;  1YJW P;  2MR7 A;  2VLP A;  1GWP A;  3E2D A;  2KGC A;  1EMV A;  4GR6 A;  3EJB A;  3CCV P;  5HVC A;  1DV5 A;  2KOR A;  1M9X C;  2KG8 A;  4DGA C;  3CCS P;  4NX4 C;  1E0H A;  2WLV B;  3G26 A;  3G29 A;  1M9C C;  3HZQ A;  5KP7 B;  4IPY A;  1VQP P;  2KG6 A;  3CXC O;  2GDY A;  2BHV A;  2GZI A;  2JQ4 A;  1RNI A;  1T8K A;  1KD1 Q;  2K5X A;  3CCQ P;  3GZL A;  2LKI A;  1K73 Q;  2K0D X;  2PEJ A;  1Q7Y Q;  5HGL A;  1L0I A;  2XZ1 C;  1VQ6 P;  1UNK A;  4XFY A;  4IZ6 A;  4E91 A;  1BAJ A;  2EFJ A;  4COC A;  5HGN A;  3OW2 O;  3GZM A;  2VLN A;  1AUM A;  4WYM A;  2PEO A;  3WBH A;  3LRY A;  2KGE A;  2PXR C;  2N50 A;  3G6E P;  3H47 A;  2FHS C;  1JJ2 O;  1VQ7 P;  4MRT C;  1YHQ P;  1U7K A;  2X2D D;  2KOD A;  3RG2 A;  4DG9 A;  3G28 A;  2DNW A;  2KOO A;  3M1M A;  2M5R A;  2KOP A;  1VQ8 P;  4U0B A;  2XXM A;  4XRO A;  2OTL P;  2K92 A;  2EIA A;  2CG5 B;  1OR5 A;  4PH1 A;  4QNB A;  4PH0 A;  2OTJ P;  1D1D A;  4U0A A;  2BUO A;  1HY8 A;  2KR5 A;  3CCL P;  4BPG A;  2AFE A;  2KG9 A;  1KC8 Q;  1QVG O;  5F2K A;  2MF4 A;  2PNG A;  4U0D A;  4PXH B;  2Z46 A;  1M90 Q;  5BS2 A;  3CD6 P;  2FQ0 A;  2N5I A;  5F2O A;  2K0X A;  2L9F A;  2JO0 A;  2GDW A;  5HGM A;  2QEX P;  4GR2 A;  3DS3 A;  2K2Q A;  2JYL A;  2FAD A;  1VQL P;  1YJN P;  3GJN A;  3Q20 A;  1A8O A;  4F37 A;  3CCR P;  3NY7 B;  1EM9 A;  1VHN A;  1ACP A;  3CC2 P;  1F80 D;  3CMA P;  2K94 A;  1GPJ A;  2L6E A;  2FVA A;  1M74 A;  2L4B A;  2ROQ A;  4PH2 A;  1VQ9 P;  2JB0 A;  2CQ8 A;  3GKL C;  3G21 A;  3CCE P;  3DTJ A;  4DGE C;  1BXI A;  2MD9 A;  2GZG A;  4HKG A;  5F2N A;  3CC7 P;  4LQW C;  3G1I A;  1GXH A;  1KLP A;  2GDX A;  2KW2 A;  2XT1 A;  4E92 A;  1YIJ P;  2M8N A;  2LML A;  1S72 P;  2LIU A;  4H2X C;  1EOQ A;  4XFX A;  5JPA A;  1W2B O;  2XDE A;  2EG5 A;  1RO0 A;  2NO8 A;  2X2B A;  1QVF O;  4UHP B;  1VQ4 P;  1M6N A;  2LIW A;  1UJZ A;  5HGK A;  4QKO A;  1X3O A;  2L22 A;  4XFZ A;  3G71 P;  2CGQ A;  2Y4Z A;  1CEI A;  4BPH A;  4COP A;  2MY5 A;  2XGU A;  2Z45 A;  2JPR A;  3H4E A;  2V4X A;  1YI2 P;  3CCM P; 
#chains in the Genus database with same CATH homology
 4U0E A;  2GOL B;  4IPY A;  1L6N A;  1VQP P;  2JO0 A;  3CXC O;  4U0C A;  5HGM A;  1K8A Q;  2BHV A;  2KGF A;  1M1K Q;  2QEX P;  1RNI A;  4GR2 A;  3CCU P;  4HTW A;  5HGO A;  3DS3 A;  1KD1 Q;  3CCQ P;  1RO2 A;  2JYL A;  4M0I A;  1K73 Q;  1K9M Q;  1VQL P;  1YJN P;  2PEJ A;  1Q7Y Q;  1M9Y C;  1QRJ A;  5HGL A;  3B5I A;  3Q20 A;  1A8O A;  1VQ6 P;  3CCR P;  1YI2 P;  1EM9 A;  2QA4 P;  4XFY A;  4U0F A;  3DS4 A;  1ZMB A;  3I55 P;  3CC4 P;  4E91 A;  1BAJ A;  2EFJ A;  1YIT P;  1N8R Q;  1A43 A;  2XGV A;  3CC2 P;  4COC A;  5HGN A;  3OW2 O;  3CMA P;  2PEN A;  2PY8 A;  1KQS O;  2WLV A;  2L6E A;  4XRQ A;  1M74 A;  2JYG A;  1M6E X;  1VQM P;  4PH2 A;  1AUM A;  1VQ9 P;  4WYM A;  2X82 A;  2PEO A;  3G21 A;  1VQ5 P;  3CCE P;  3WBH A;  3DTJ A;  3LRY A;  4DGE C;  2PXR C;  3G6E P;  4PH3 A;  5F2N A;  4J93 A;  3DS5 A;  3H47 A;  3CC7 P;  4LQW C;  3G1I A;  1IUQ A;  1AK4 C;  2DGY A;  1JJ2 O;  3RG6 C;  2CWO A;  3CME P;  1VQ7 P;  4B4N A;  2XV6 A;  3HYB A;  2XT1 A;  1YHQ P;  4E92 A;  4INB A;  1U7K A;  2M8N A;  2X2D D;  1YIJ P;  1S72 P;  1Q81 Q;  2PEI A;  2KOD A;  3I56 P;  3H0D A;  3DS0 A;  3G28 A;  2E1M A;  3P05 A;  3M1M A;  1EOQ A;  1M9F C;  1P7N A;  3DPH A;  2XGY A;  4U0B A;  2PEM A;  1VQ8 P;  2PWO A;  2PWM A;  1M9D C;  2XXM A;  3NTE A;  4XFX A;  1VQO P;  5JPA A;  4XRO A;  2Z44 A;  1W2B O;  2OTL P;  2XDE A;  2EG5 A;  2EIA A;  5DCK A;  1RO0 A;  3CCJ P;  5I4T G;  3DS1 A;  2ONT A;  4PH1 A;  3G0V A;  1QVF O;  1NJI Q;  2M8L A;  4QNB A;  3VRL C;  1VQ4 P;  1E6J P;  1EIA A;  4PH0 A;  3MGE A;  1K30 A;  2P9X A;  3BP9 A;  3CPW O;  1VQK P;  2OTJ P;  2LF4 A;  1M9E C;  1D1D A;  4U0A A;  1M6N A;  3G1G A;  3G4S P;  1G03 A;  2BUO A;  1YJ9 P;  2M8P A;  2OAR A;  2PEQ A;  2PEK A;  5HGK A;  2X83 A;  3CCL P;  1AFV A;  1VQN P;  5BS1 A;  1YJW P;  4XFZ A;  1GWP A;  3E2D A;  3G71 P;  2Y4Z A;  4GR6 A;  1Q82 Q;  3CCV P;  1KC8 Q;  1QVG O;  3DS2 A;  1Q86 Q;  4COP A;  1M9X C;  5F2K A;  2GON A;  2XGU A;  4U0D A;  4DGA C;  2Z45 A;  3CCS P;  2JPR A;  2Z46 A;  4NX4 C;  1M90 Q;  2WLV B;  3H4E A;  3G26 A;  5BS2 A;  3CD6 P;  3G29 A;  2V4X A;  1M9C C;  5F2O A;  3HZQ A;  3CCM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...