1M9YC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAAAPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/viral protein
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 146
sequence length 146
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2002-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9yC00
1E6JP 1M9YC 4HTWA 5HGNA 4XROA 5HGMA 4DGEC 1P7NA 4WYMA 2X83A 1GWPA 1U7KA 2PXRC 5HGLA 5JPAA 4E91A 2X2DD 1M9FC 3H4EA 3P05A 4NX4C 4U0EA 4XFXA 1EM9A 2JPRA 3BP9A 2WLVB 1EIAA 2Y4ZA 4PH0A 3MGEA 2KGFA 1AFVA 5HGOA 2V4XA 1G03A 2XGUA 4E92A 2XDEA 2XGYA 2WLVA 3NTEA 4QNBA 5HGKA 2EIAA 2XGVA 4XRQA 4XFZA 4U0BA 4LQWC 1M9DC 1QRJA 3H47A 1AK4C 2LF4A 2GOLB 2M8NA 4PH2A 4PH3A 2PWOA 1M9XC 4J93A 2GONA 1D1DA 2X82A 2PWMA 4U0CA 1M9CC 4B4NA 4U0AA 1L6NA 2M8LA 4DGAC 4INBA 1M9EC 2M8PA 4XFYA 4U0FA 4U0DA
chains in the Genus database with same CATH superfamily
1E6JP 1M9YC 4HTWA 5HGNA 4XROA 5HGMA 4DGEC 1P7NA 4WYMA 2X83A 1GWPA 1U7KA 2PXRC 5HGLA 5JPAA 4E91A 2X2DD 1M9FC 3H4EA 3P05A 4NX4C 4U0EA 4XFXA 1EM9A 2JPRA 3BP9A 2WLVB 1EIAA 2Y4ZA 4PH0A 3MGEA 2KGFA 1AFVA 5HGOA 2V4XA 1G03A 2XGUA 4E92A 2XDEA 2XGYA 2WLVA 3NTEA 4QNBA 5HGKA 2EIAA 2XGVA 4XRQA 4XFZA 4U0BA 4LQWC 1M9DC 1QRJA 3H47A 1AK4C 2LF4A 2GOLB 2M8NA 4PH2A 4PH3A 2PWOA 1M9XC 4J93A 2GONA 1D1DA 2X82A 2PWMA 4U0CA 1M9CC 4B4NA 4U0AA 1L6NA 2M8LA 4DGAC 4INBA 1M9EC 2M8PA 4XFYA 4U0FA 4U0DA
chains in the Genus database with same CATH topology
1E6JP 1M9YC 4HTWA 5HGNA 4XROA 5HGMA 4DGEC 1P7NA 4WYMA 2X83A 1GWPA 1U7KA 2PXRC 5HGLA 5JPAA 4E91A 2X2DD 1M9FC 3H4EA 3P05A 4NX4C 4U0EA 4XFXA 1EM9A 2JPRA 3BP9A 2WLVB 1EIAA 2Y4ZA 4PH0A 3MGEA 2KGFA 1AFVA 5HGOA 2V4XA 1G03A 2XGUA 4E92A 2XDEA 2XGYA 2WLVA 3NTEA 4QNBA 5HGKA 2EIAA 2XGVA 4XRQA 4XFZA 4U0BA 4LQWC 1M9DC 1QRJA 3H47A 1AK4C 2LF4A 2GOLB 2M8NA 4PH2A 4PH3A 2PWOA 1M9XC 4J93A 2GONA 1D1DA 2X82A 2PWMA 4U0CA 1M9CC 4B4NA 4U0AA 1L6NA 2M8LA 4DGAC 4INBA 1M9EC 2M8PA 4XFYA 4U0FA 4U0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6J P;  1M9Y C;  4HTW A;  5HGN A;  4XRO A;  5HGM A;  4DGE C;  1P7N A;  4WYM A;  2X83 A;  1GWP A;  1U7K A;  2PXR C;  5HGL A;  5JPA A;  4E91 A;  2X2D D;  1M9F C;  3H4E A;  3P05 A;  4NX4 C;  4U0E A;  4XFX A;  1EM9 A;  2JPR A;  3BP9 A;  2WLV B;  1EIA A;  2Y4Z A;  4PH0 A;  3MGE A;  2KGF A;  1AFV A;  5HGO A;  2V4X A;  1G03 A;  2XGU A;  4E92 A;  2XDE A;  2XGY A;  2WLV A;  3NTE A;  4QNB A;  5HGK A;  2EIA A;  2XGV A;  4XRQ A;  4XFZ A;  4U0B A;  4LQW C;  1M9D C;  1QRJ A;  3H47 A;  1AK4 C;  2LF4 A;  2GOL B;  2M8N A;  4PH2 A;  4PH3 A;  2PWO A;  1M9X C;  4J93 A;  2GON A;  1D1D A;  2X82 A;  2PWM A;  4U0C A;  1M9C C;  4B4N A;  4U0A A;  1L6N A;  2M8L A;  4DGA C;  4INB A;  1M9E C;  2M8P A;  4XFY A;  4U0F A;  4U0D A; 
#chains in the Genus database with same CATH topology
 1E6J P;  1M9Y C;  4HTW A;  5HGN A;  4XRO A;  5HGM A;  4DGE C;  1P7N A;  4WYM A;  2X83 A;  1GWP A;  1U7K A;  2PXR C;  5HGL A;  5JPA A;  4E91 A;  2X2D D;  1M9F C;  3H4E A;  3P05 A;  4NX4 C;  4U0E A;  4XFX A;  1EM9 A;  2JPR A;  3BP9 A;  2WLV B;  1EIA A;  2Y4Z A;  4PH0 A;  3MGE A;  2KGF A;  1AFV A;  5HGO A;  2V4X A;  1G03 A;  2XGU A;  4E92 A;  2XDE A;  2XGY A;  2WLV A;  3NTE A;  4QNB A;  5HGK A;  2EIA A;  2XGV A;  4XRQ A;  4XFZ A;  4U0B A;  4LQW C;  1M9D C;  1QRJ A;  3H47 A;  1AK4 C;  2LF4 A;  2GOL B;  2M8N A;  4PH2 A;  4PH3 A;  2PWO A;  1M9X C;  4J93 A;  2GON A;  1D1D A;  2X82 A;  2PWM A;  4U0C A;  1M9C C;  4B4N A;  4U0A A;  1L6N A;  2M8L A;  4DGA C;  4INB A;  1M9E C;  2M8P A;  4XFY A;  4U0F A;  4U0D A; 
#chains in the Genus database with same CATH homology
 1E6J P;  1M9Y C;  4HTW A;  5HGN A;  4XRO A;  5HGM A;  4DGE C;  1P7N A;  4WYM A;  2X83 A;  1GWP A;  1U7K A;  2PXR C;  5HGL A;  5JPA A;  4E91 A;  2X2D D;  1M9F C;  3H4E A;  3P05 A;  4NX4 C;  4U0E A;  4XFX A;  1EM9 A;  2JPR A;  3BP9 A;  2WLV B;  1EIA A;  2Y4Z A;  4PH0 A;  3MGE A;  2KGF A;  1AFV A;  5HGO A;  2V4X A;  1G03 A;  2XGU A;  4E92 A;  2XDE A;  2XGY A;  2WLV A;  3NTE A;  4QNB A;  5HGK A;  2EIA A;  2XGV A;  4XRQ A;  4XFZ A;  4U0B A;  4LQW C;  1M9D C;  1QRJ A;  3H47 A;  1AK4 C;  2LF4 A;  2GOL B;  2M8N A;  4PH2 A;  4PH3 A;  2PWO A;  1M9X C;  4J93 A;  2GON A;  1D1D A;  2X82 A;  2PWM A;  4U0C A;  1M9C C;  4B4N A;  4U0A A;  1L6N A;  2M8L A;  4DGA C;  4INB A;  1M9E C;  2M8P A;  4XFY A;  4U0F A;  4U0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...