1M9YC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAAAPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 48
structure length 146
sequence length 146
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2002-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9yC00
4PH0A 1GWPA 1U7KA 2M8LA 1M9DC 4E91A 4U0FA 1AK4C 1M9EC 1P7NA 4U0BA 2LF4A 4XRQA 1L6NA 1M9XC 2Y4ZA 3H47A 5HGNA 1E6JP 2V4XA 4U0EA 2X83A 2XGYA 2EIAA 2PWOA 5HGKA 4NX4C 1M9YC 2M8PA 2WLVA 4DGAC 1QRJA 2X82A 4U0CA 4XFZA 4WYMA 2PWMA 1G03A 1M9CC 5JPAA 4B4NA 2GOLB 4DGEC 1EM9A 4LQWC 4J93A 4HTWA 4INBA 5HGMA 4XFXA 2KGFA 5HGOA 1AFVA 2GONA 2XGVA 4PH2A 4E92A 2XDEA 2PXRC 3P05A 2XGUA 4PH3A 2X2DD 4U0DA 4XROA 1EIAA 3NTEA 4U0AA 3MGEA 2M8NA 5HGLA 1M9FC 3BP9A 1D1DA 4QNBA 3H4EA 2WLVB 2JPRA 4XFYA
chains in the Genus database with same CATH superfamily
4PH0A 1GWPA 1U7KA 2M8LA 1M9DC 4E91A 4U0FA 1AK4C 1M9EC 1P7NA 4U0BA 2LF4A 4XRQA 1L6NA 1M9XC 2Y4ZA 3H47A 5HGNA 1E6JP 2V4XA 4U0EA 2X83A 2XGYA 2EIAA 2PWOA 5HGKA 4NX4C 1M9YC 2M8PA 2WLVA 4DGAC 1QRJA 2X82A 4U0CA 4XFZA 4WYMA 2PWMA 1G03A 1M9CC 5JPAA 4B4NA 2GOLB 4DGEC 1EM9A 4LQWC 4J93A 4HTWA 4INBA 5HGMA 4XFXA 2KGFA 5HGOA 1AFVA 2GONA 2XGVA 4PH2A 4E92A 2XDEA 2PXRC 3P05A 2XGUA 4PH3A 2X2DD 4U0DA 4XROA 1EIAA 3NTEA 4U0AA 3MGEA 2M8NA 5HGLA 1M9FC 3BP9A 1D1DA 4QNBA 3H4EA 2WLVB 2JPRA 4XFYA
chains in the Genus database with same CATH topology
4PH0A 1GWPA 1U7KA 2M8LA 1M9DC 4E91A 4U0FA 1AK4C 1M9EC 1P7NA 4U0BA 2LF4A 4XRQA 1L6NA 1M9XC 2Y4ZA 3H47A 5HGNA 1E6JP 2V4XA 4U0EA 2X83A 2XGYA 2EIAA 2PWOA 5HGKA 4NX4C 1M9YC 2M8PA 2WLVA 4DGAC 1QRJA 2X82A 4U0CA 4XFZA 4WYMA 2PWMA 1G03A 1M9CC 5JPAA 4B4NA 2GOLB 4DGEC 1EM9A 4LQWC 4J93A 4HTWA 4INBA 5HGMA 4XFXA 2KGFA 5HGOA 1AFVA 2GONA 2XGVA 4PH2A 4E92A 2XDEA 2PXRC 3P05A 2XGUA 4PH3A 2X2DD 4U0DA 4XROA 1EIAA 3NTEA 4U0AA 3MGEA 2M8NA 5HGLA 1M9FC 3BP9A 1D1DA 4QNBA 3H4EA 2WLVB 2JPRA 4XFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH0 A;  1GWP A;  1U7K A;  2M8L A;  1M9D C;  4E91 A;  4U0F A;  1AK4 C;  1M9E C;  1P7N A;  4U0B A;  2LF4 A;  4XRQ A;  1L6N A;  1M9X C;  2Y4Z A;  3H47 A;  5HGN A;  1E6J P;  2V4X A;  4U0E A;  2X83 A;  2XGY A;  2EIA A;  2PWO A;  5HGK A;  4NX4 C;  1M9Y C;  2M8P A;  2WLV A;  4DGA C;  1QRJ A;  2X82 A;  4U0C A;  4XFZ A;  4WYM A;  2PWM A;  1G03 A;  1M9C C;  5JPA A;  4B4N A;  2GOL B;  4DGE C;  1EM9 A;  4LQW C;  4J93 A;  4HTW A;  4INB A;  5HGM A;  4XFX A;  2KGF A;  5HGO A;  1AFV A;  2GON A;  2XGV A;  4PH2 A;  4E92 A;  2XDE A;  2PXR C;  3P05 A;  2XGU A;  4PH3 A;  2X2D D;  4U0D A;  4XRO A;  1EIA A;  3NTE A;  4U0A A;  3MGE A;  2M8N A;  5HGL A;  1M9F C;  3BP9 A;  1D1D A;  4QNB A;  3H4E A;  2WLV B;  2JPR A;  4XFY A; 
#chains in the Genus database with same CATH topology
 4PH0 A;  1GWP A;  1U7K A;  2M8L A;  1M9D C;  4E91 A;  4U0F A;  1AK4 C;  1M9E C;  1P7N A;  4U0B A;  2LF4 A;  4XRQ A;  1L6N A;  1M9X C;  2Y4Z A;  3H47 A;  5HGN A;  1E6J P;  2V4X A;  4U0E A;  2X83 A;  2XGY A;  2EIA A;  2PWO A;  5HGK A;  4NX4 C;  1M9Y C;  2M8P A;  2WLV A;  4DGA C;  1QRJ A;  2X82 A;  4U0C A;  4XFZ A;  4WYM A;  2PWM A;  1G03 A;  1M9C C;  5JPA A;  4B4N A;  2GOL B;  4DGE C;  1EM9 A;  4LQW C;  4J93 A;  4HTW A;  4INB A;  5HGM A;  4XFX A;  2KGF A;  5HGO A;  1AFV A;  2GON A;  2XGV A;  4PH2 A;  4E92 A;  2XDE A;  2PXR C;  3P05 A;  2XGU A;  4PH3 A;  2X2D D;  4U0D A;  4XRO A;  1EIA A;  3NTE A;  4U0A A;  3MGE A;  2M8N A;  5HGL A;  1M9F C;  3BP9 A;  1D1D A;  4QNB A;  3H4E A;  2WLV B;  2JPR A;  4XFY A; 
#chains in the Genus database with same CATH homology
 4PH0 A;  1GWP A;  1U7K A;  2M8L A;  1M9D C;  4E91 A;  4U0F A;  1AK4 C;  1M9E C;  1P7N A;  4U0B A;  2LF4 A;  4XRQ A;  1L6N A;  1M9X C;  2Y4Z A;  3H47 A;  5HGN A;  1E6J P;  2V4X A;  4U0E A;  2X83 A;  2XGY A;  2EIA A;  2PWO A;  5HGK A;  4NX4 C;  1M9Y C;  2M8P A;  2WLV A;  4DGA C;  1QRJ A;  2X82 A;  4U0C A;  4XFZ A;  4WYM A;  2PWM A;  1G03 A;  1M9C C;  5JPA A;  4B4N A;  2GOL B;  4DGE C;  1EM9 A;  4LQW C;  4J93 A;  4HTW A;  4INB A;  5HGM A;  4XFX A;  2KGF A;  5HGO A;  1AFV A;  2GON A;  2XGV A;  4PH2 A;  4E92 A;  2XDE A;  2PXR C;  3P05 A;  2XGU A;  4PH3 A;  2X2D D;  4U0D A;  4XRO A;  1EIA A;  3NTE A;  4U0A A;  3MGE A;  2M8N A;  5HGL A;  1M9F C;  3BP9 A;  1D1D A;  4QNB A;  3H4E A;  2WLV B;  2JPR A;  4XFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...