1M9YC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAAAPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
molecule keywords Cyclophilin A
total genus 48
structure length 146
sequence length 146
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2002-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9yC00
4E91A 1P7NA 2M8NA 4WYMA 1M9CC 3H4EA 2XGYA 3NTEA 2PXRC 4J93A 4XFYA 2LF4A 2M8LA 5JPAA 4INBA 2V4XA 4B4NA 4PH2A 1E6JP 1M9DC 2GONA 3H47A 1AK4C 4U0EA 4U0DA 5HGLA 1M9EC 2XGVA 1AFVA 2X83A 2PWMA 4DGAC 5HGNA 2XDEA 2M8PA 4DGEC 4U0CA 5HGMA 4U0AA 4E92A 2EIAA 2XGUA 2GOLB 2KGFA 1U7KA 1M9XC 2PWOA 4NX4C 4U0BA 4XFZA 4LQWC 4XRQA 1M9YC 1L6NA 1EIAA 1D1DA 2X2DD 2Y4ZA 4XROA 3BP9A 4PH0A 2WLVA 3MGEA 3P05A 1M9FC 4QNBA 4U0FA 1G03A 5HGKA 4HTWA 4XFXA 4PH3A 1QRJA 2WLVB 5HGOA 1GWPA 2JPRA 1EM9A 2X82A
chains in the Genus database with same CATH superfamily
4E91A 1P7NA 2M8NA 4WYMA 1M9CC 3H4EA 2XGYA 3NTEA 2PXRC 4J93A 4XFYA 2LF4A 2M8LA 5JPAA 4INBA 2V4XA 4B4NA 4PH2A 1E6JP 1M9DC 2GONA 3H47A 1AK4C 4U0EA 4U0DA 5HGLA 1M9EC 2XGVA 1AFVA 2X83A 2PWMA 4DGAC 5HGNA 2XDEA 2M8PA 4DGEC 4U0CA 5HGMA 4U0AA 4E92A 2EIAA 2XGUA 2GOLB 2KGFA 1U7KA 1M9XC 2PWOA 4NX4C 4U0BA 4XFZA 4LQWC 4XRQA 1M9YC 1L6NA 1EIAA 1D1DA 2X2DD 2Y4ZA 4XROA 3BP9A 4PH0A 2WLVA 3MGEA 3P05A 1M9FC 4QNBA 4U0FA 1G03A 5HGKA 4HTWA 4XFXA 4PH3A 1QRJA 2WLVB 5HGOA 1GWPA 2JPRA 1EM9A 2X82A
chains in the Genus database with same CATH topology
4E91A 1P7NA 2M8NA 4WYMA 1M9CC 3H4EA 2XGYA 3NTEA 2PXRC 4J93A 4XFYA 2LF4A 2M8LA 5JPAA 4INBA 2V4XA 4B4NA 4PH2A 1E6JP 1M9DC 2GONA 3H47A 1AK4C 4U0EA 4U0DA 5HGLA 1M9EC 2XGVA 1AFVA 2X83A 2PWMA 4DGAC 5HGNA 2XDEA 2M8PA 4DGEC 4U0CA 5HGMA 4U0AA 4E92A 2EIAA 2XGUA 2GOLB 2KGFA 1U7KA 1M9XC 2PWOA 4NX4C 4U0BA 4XFZA 4LQWC 4XRQA 1M9YC 1L6NA 1EIAA 1D1DA 2X2DD 2Y4ZA 4XROA 3BP9A 4PH0A 2WLVA 3MGEA 3P05A 1M9FC 4QNBA 4U0FA 1G03A 5HGKA 4HTWA 4XFXA 4PH3A 1QRJA 2WLVB 5HGOA 1GWPA 2JPRA 1EM9A 2X82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E91 A;  1P7N A;  2M8N A;  4WYM A;  1M9C C;  3H4E A;  2XGY A;  3NTE A;  2PXR C;  4J93 A;  4XFY A;  2LF4 A;  2M8L A;  5JPA A;  4INB A;  2V4X A;  4B4N A;  4PH2 A;  1E6J P;  1M9D C;  2GON A;  3H47 A;  1AK4 C;  4U0E A;  4U0D A;  5HGL A;  1M9E C;  2XGV A;  1AFV A;  2X83 A;  2PWM A;  4DGA C;  5HGN A;  2XDE A;  2M8P A;  4DGE C;  4U0C A;  5HGM A;  4U0A A;  4E92 A;  2EIA A;  2XGU A;  2GOL B;  2KGF A;  1U7K A;  1M9X C;  2PWO A;  4NX4 C;  4U0B A;  4XFZ A;  4LQW C;  4XRQ A;  1M9Y C;  1L6N A;  1EIA A;  1D1D A;  2X2D D;  2Y4Z A;  4XRO A;  3BP9 A;  4PH0 A;  2WLV A;  3MGE A;  3P05 A;  1M9F C;  4QNB A;  4U0F A;  1G03 A;  5HGK A;  4HTW A;  4XFX A;  4PH3 A;  1QRJ A;  2WLV B;  5HGO A;  1GWP A;  2JPR A;  1EM9 A;  2X82 A; 
#chains in the Genus database with same CATH topology
 4E91 A;  1P7N A;  2M8N A;  4WYM A;  1M9C C;  3H4E A;  2XGY A;  3NTE A;  2PXR C;  4J93 A;  4XFY A;  2LF4 A;  2M8L A;  5JPA A;  4INB A;  2V4X A;  4B4N A;  4PH2 A;  1E6J P;  1M9D C;  2GON A;  3H47 A;  1AK4 C;  4U0E A;  4U0D A;  5HGL A;  1M9E C;  2XGV A;  1AFV A;  2X83 A;  2PWM A;  4DGA C;  5HGN A;  2XDE A;  2M8P A;  4DGE C;  4U0C A;  5HGM A;  4U0A A;  4E92 A;  2EIA A;  2XGU A;  2GOL B;  2KGF A;  1U7K A;  1M9X C;  2PWO A;  4NX4 C;  4U0B A;  4XFZ A;  4LQW C;  4XRQ A;  1M9Y C;  1L6N A;  1EIA A;  1D1D A;  2X2D D;  2Y4Z A;  4XRO A;  3BP9 A;  4PH0 A;  2WLV A;  3MGE A;  3P05 A;  1M9F C;  4QNB A;  4U0F A;  1G03 A;  5HGK A;  4HTW A;  4XFX A;  4PH3 A;  1QRJ A;  2WLV B;  5HGO A;  1GWP A;  2JPR A;  1EM9 A;  2X82 A; 
#chains in the Genus database with same CATH homology
 4E91 A;  1P7N A;  2M8N A;  4WYM A;  1M9C C;  3H4E A;  2XGY A;  3NTE A;  2PXR C;  4J93 A;  4XFY A;  2LF4 A;  2M8L A;  5JPA A;  4INB A;  2V4X A;  4B4N A;  4PH2 A;  1E6J P;  1M9D C;  2GON A;  3H47 A;  1AK4 C;  4U0E A;  4U0D A;  5HGL A;  1M9E C;  2XGV A;  1AFV A;  2X83 A;  2PWM A;  4DGA C;  5HGN A;  2XDE A;  2M8P A;  4DGE C;  4U0C A;  5HGM A;  4U0A A;  4E92 A;  2EIA A;  2XGU A;  2GOL B;  2KGF A;  1U7K A;  1M9X C;  2PWO A;  4NX4 C;  4U0B A;  4XFZ A;  4LQW C;  4XRQ A;  1M9Y C;  1L6N A;  1EIA A;  1D1D A;  2X2D D;  2Y4Z A;  4XRO A;  3BP9 A;  4PH0 A;  2WLV A;  3MGE A;  3P05 A;  1M9F C;  4QNB A;  4U0F A;  1G03 A;  5HGK A;  4HTW A;  4XFX A;  4PH3 A;  1QRJ A;  2WLV B;  5HGO A;  1GWP A;  2JPR A;  1EM9 A;  2X82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...