1M9YC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAAAPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 48
structure length 146
sequence length 146
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2002-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9yC00
1P7NA 2XGUA 1QRJA 2LF4A 3H4EA 5HGOA 2X83A 1L6NA 4E91A 4DGEC 2M8PA 2GONA 2EIAA 4U0FA 3H47A 4INBA 4XROA 1EM9A 1EIAA 3P05A 1E6JP 1M9XC 2KGFA 2XGVA 2GOLB 2X2DD 4NX4C 5HGMA 4XFYA 5JPAA 2Y4ZA 2PXRC 4LQWC 5HGLA 1U7KA 4XFZA 4PH3A 4QNBA 2WLVB 4J93A 1M9YC 2XGYA 2XDEA 5HGKA 1AK4C 1G03A 4U0AA 3NTEA 2JPRA 4DGAC 3MGEA 4PH2A 5HGNA 2PWMA 4HTWA 2X82A 4PH0A 1M9EC 2PWOA 1AFVA 1GWPA 4E92A 4U0CA 2WLVA 4XFXA 3BP9A 4U0EA 4B4NA 4WYMA 1M9CC 4U0BA 2V4XA 1M9FC 4XRQA 1M9DC 1D1DA 2M8LA 2M8NA 4U0DA
chains in the Genus database with same CATH superfamily
1P7NA 2XGUA 1QRJA 2LF4A 3H4EA 5HGOA 2X83A 1L6NA 4E91A 4DGEC 2M8PA 2GONA 2EIAA 4U0FA 3H47A 4INBA 4XROA 1EM9A 1EIAA 3P05A 1E6JP 1M9XC 2KGFA 2XGVA 2GOLB 2X2DD 4NX4C 5HGMA 4XFYA 5JPAA 2Y4ZA 2PXRC 4LQWC 5HGLA 1U7KA 4XFZA 4PH3A 4QNBA 2WLVB 4J93A 1M9YC 2XGYA 2XDEA 5HGKA 1AK4C 1G03A 4U0AA 3NTEA 2JPRA 4DGAC 3MGEA 4PH2A 5HGNA 2PWMA 4HTWA 2X82A 4PH0A 1M9EC 2PWOA 1AFVA 1GWPA 4E92A 4U0CA 2WLVA 4XFXA 3BP9A 4U0EA 4B4NA 4WYMA 1M9CC 4U0BA 2V4XA 1M9FC 4XRQA 1M9DC 1D1DA 2M8LA 2M8NA 4U0DA
chains in the Genus database with same CATH topology
1P7NA 2XGUA 1QRJA 2LF4A 3H4EA 5HGOA 2X83A 1L6NA 4E91A 4DGEC 2M8PA 2GONA 2EIAA 4U0FA 3H47A 4INBA 4XROA 1EM9A 1EIAA 3P05A 1E6JP 1M9XC 2KGFA 2XGVA 2GOLB 2X2DD 4NX4C 5HGMA 4XFYA 5JPAA 2Y4ZA 2PXRC 4LQWC 5HGLA 1U7KA 4XFZA 4PH3A 4QNBA 2WLVB 4J93A 1M9YC 2XGYA 2XDEA 5HGKA 1AK4C 1G03A 4U0AA 3NTEA 2JPRA 4DGAC 3MGEA 4PH2A 5HGNA 2PWMA 4HTWA 2X82A 4PH0A 1M9EC 2PWOA 1AFVA 1GWPA 4E92A 4U0CA 2WLVA 4XFXA 3BP9A 4U0EA 4B4NA 4WYMA 1M9CC 4U0BA 2V4XA 1M9FC 4XRQA 1M9DC 1D1DA 2M8LA 2M8NA 4U0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7N A;  2XGU A;  1QRJ A;  2LF4 A;  3H4E A;  5HGO A;  2X83 A;  1L6N A;  4E91 A;  4DGE C;  2M8P A;  2GON A;  2EIA A;  4U0F A;  3H47 A;  4INB A;  4XRO A;  1EM9 A;  1EIA A;  3P05 A;  1E6J P;  1M9X C;  2KGF A;  2XGV A;  2GOL B;  2X2D D;  4NX4 C;  5HGM A;  4XFY A;  5JPA A;  2Y4Z A;  2PXR C;  4LQW C;  5HGL A;  1U7K A;  4XFZ A;  4PH3 A;  4QNB A;  2WLV B;  4J93 A;  1M9Y C;  2XGY A;  2XDE A;  5HGK A;  1AK4 C;  1G03 A;  4U0A A;  3NTE A;  2JPR A;  4DGA C;  3MGE A;  4PH2 A;  5HGN A;  2PWM A;  4HTW A;  2X82 A;  4PH0 A;  1M9E C;  2PWO A;  1AFV A;  1GWP A;  4E92 A;  4U0C A;  2WLV A;  4XFX A;  3BP9 A;  4U0E A;  4B4N A;  4WYM A;  1M9C C;  4U0B A;  2V4X A;  1M9F C;  4XRQ A;  1M9D C;  1D1D A;  2M8L A;  2M8N A;  4U0D A; 
#chains in the Genus database with same CATH topology
 1P7N A;  2XGU A;  1QRJ A;  2LF4 A;  3H4E A;  5HGO A;  2X83 A;  1L6N A;  4E91 A;  4DGE C;  2M8P A;  2GON A;  2EIA A;  4U0F A;  3H47 A;  4INB A;  4XRO A;  1EM9 A;  1EIA A;  3P05 A;  1E6J P;  1M9X C;  2KGF A;  2XGV A;  2GOL B;  2X2D D;  4NX4 C;  5HGM A;  4XFY A;  5JPA A;  2Y4Z A;  2PXR C;  4LQW C;  5HGL A;  1U7K A;  4XFZ A;  4PH3 A;  4QNB A;  2WLV B;  4J93 A;  1M9Y C;  2XGY A;  2XDE A;  5HGK A;  1AK4 C;  1G03 A;  4U0A A;  3NTE A;  2JPR A;  4DGA C;  3MGE A;  4PH2 A;  5HGN A;  2PWM A;  4HTW A;  2X82 A;  4PH0 A;  1M9E C;  2PWO A;  1AFV A;  1GWP A;  4E92 A;  4U0C A;  2WLV A;  4XFX A;  3BP9 A;  4U0E A;  4B4N A;  4WYM A;  1M9C C;  4U0B A;  2V4X A;  1M9F C;  4XRQ A;  1M9D C;  1D1D A;  2M8L A;  2M8N A;  4U0D A; 
#chains in the Genus database with same CATH homology
 1P7N A;  2XGU A;  1QRJ A;  2LF4 A;  3H4E A;  5HGO A;  2X83 A;  1L6N A;  4E91 A;  4DGE C;  2M8P A;  2GON A;  2EIA A;  4U0F A;  3H47 A;  4INB A;  4XRO A;  1EM9 A;  1EIA A;  3P05 A;  1E6J P;  1M9X C;  2KGF A;  2XGV A;  2GOL B;  2X2D D;  4NX4 C;  5HGM A;  4XFY A;  5JPA A;  2Y4Z A;  2PXR C;  4LQW C;  5HGL A;  1U7K A;  4XFZ A;  4PH3 A;  4QNB A;  2WLV B;  4J93 A;  1M9Y C;  2XGY A;  2XDE A;  5HGK A;  1AK4 C;  1G03 A;  4U0A A;  3NTE A;  2JPR A;  4DGA C;  3MGE A;  4PH2 A;  5HGN A;  2PWM A;  4HTW A;  2X82 A;  4PH0 A;  1M9E C;  2PWO A;  1AFV A;  1GWP A;  4E92 A;  4U0C A;  2WLV A;  4XFX A;  3BP9 A;  4U0E A;  4B4N A;  4WYM A;  1M9C C;  4U0B A;  2V4X A;  1M9F C;  4XRQ A;  1M9D C;  1D1D A;  2M8L A;  2M8N A;  4U0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...