4XFXA

Structure of the native full-length hiv-1 capsid protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
216
Chain Sequence
PIVQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 74
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfxA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfxA02
3G1IA 5JPAA 1QRJA 2EIAA 4LQWC 1P7NA 1EIAA 2KODA 3BP9A 2JO0A 5HGKA 1U7KA 2XGVA 3MGEA 4XROA 4E92A 2V4XA 1EM9A 1L6NA 4PH0A 2Y4ZA 3P05A 1GWPA 3G28A 1AK4C 2XV6A 3DS5A 2X82A 1M9YC 4PH3A 2L6EA 1M9FC 5I4TG 2PXRC 2XT1A 2M8LA 2LF4A 4E91A 4M0IA 2KGFA 3G0VA 1M9EC 3DS3A 5DCKA 2XGUA 4COCA 3G21A 2PWOA 3H47A 4U0FA 4PH2A 4J93A 4COPA 2WLVA 4U0AA 4INBA 3LRYA 3G1GA 2ONTA 3H4EA 2PWMA 4DGAC 1D1DA 1G03A 4IPYA 4U0EA 3G29A 1M9DC 2M8NA 2XXMA 4QNBA 4HTWA 1A8OA 2JYLA 2JYGA 1A43A 2X83A 2X2DD 4U0DA 4XFXA 5HGMA 1AUMA 3DS2A 2JPRA 1M9CC 5HGLA 1BAJA 4U0BA 3DS4A 3DS1A 4DGEC 4WYMA 4XRQA 1E6JP 2WLVB 5HGOA 3VRLC 4NX4C 4PH1A 4U0CA 2XDEA 2GONA 1EOQA 1M9XC 4XFZA 2M8PA 4XFYA 2GOLB 2XGYA 3DS0A 3DTJA 2BUOA 5HGNA 1AFVA 4B4NA 3DPHA 3NTEA 3G26A
chains in the Genus database with same CATH superfamily
2OTJP 3G1IA 3I56P 2GZEA 1KQSO 1KLPA 2EIAA 4DG9A 2WPTA 2FVAA 1NQ4A 1VQ9P 2PENA 3CCSP 2QNWA 1U7KA 2KOSA 2NO8A 3CCVP 2KGAA 2KOPA 4E92A 1Z6MA 4F37A 4R0MA 3P05A 2VSQA 1GWPA 3G28A 1AK4C 2JGPA 3DS5A 4BPHA 1Q82Q 1L0IA 1GXGA 1UJZA 2PXRC 2FVEA 2XT1A 2EG5A 3CCJP 5HVCA 4M0IA 2KGFA 5KP8B 2CNRA 3DS3A 5DCKA 5HV8A 1YI2P 2N6ZA 4H2XC 3G21A 3GZLA 2K0DX 4UHPB 4QKOA 2WLVA 2K0YA 3LRYA 2CWOA 2PEJA 1X3OA 2PNGA 3H4EA 2LTEA 4DGAC 2GZIA 2LPKA 3NY7B 3Q20A 1GPJA 2AFEA 2M8NA 5KP6B 4HTWA 2L22A 1IUQA 2JYGA 1A43A 2X83A 1K9MQ 2X2DD 1AF8A 2K0XA 3DS2A 1M9CC 2KOQA 2P9XA 1FR2A 1E6JP 2MVVA 4GR6A 4PH1A 4U0CA 3OW2O 2GONA 1M9XC 2M8PA 2KGCA 3CPWO 2BHVA 2LIWA 7CEIA 3WBHA 4CA3A 5HGNA 2AFDA 3DPHA 3B4QA 5F2NA 2GYKA 3G26A 1JJ2O 3H0DA 1VKUA 5JPAA 2MF4A 3CCEP 2FVFA 2KG8A 2L0QA 1VQOP 2L9FA 3CCRP 1YHQP 1W2BO 2VLNA 3MGEA 2PEMA 2V4XA 1QVGO 2L4BA 1HQBA 2X2BA 1M6NA 2X82A 1M9YC 2K93A 4PH3A 2L6EA 1YITP 1YJWP 1DNYA 1VQ5P 2LMLA 2AF8A 2FAEA 3G0VA 1M9EC 1Q86Q 2DGYA 3CE7A 1M90Q 1ACPA 3CD6P 2N5IA 4IZ6A 1HY8A 2PWOA 3GZMA 3H47A 4PH2A 2K94A 4COPA 2VLPA 3EJDA 2Z45A 2ONTA 2FHSC 2VLQA 4U0EA 4HKGA 2EHTA 2KG9A 3U43A 2LKIA 2MY5A 1M74A 4XFXA 5HGMA 1CEIA 2JPRA 2QEXP 1VQ6P 5HGLA 2PY8A 2KGEA 2QA4P 3DS4A 3DS1A 3CMAP 4NX4C 2XDEA 3CCUP 1N8RQ 4XFYA 2FQ2A 2CQ8A 2KW2A 3LMOA 1L0HA 1YJ9P 2LL8A 1K8AQ 4B4NA 1K73Q 3G1GA 3NTEA 1KC8Q 1VQ8P 4NEOA 1QRJA 2MR7A 1P7NA 1AYIA 1EIAA 2KODA 2VLOA 1YIJP 3BP9A 2JU1A 2E1MA 3G4SP 2ERHA 1VQ7P 2XGVA 4XROA 2KGDA 2PEKA 3CC4P 1EM9A 5BS1A 4PH0A 1DV5A 2Y4ZA 1RO0A 2XV6A 2PEQA 1BXIA 1M9FC 5I4TG 2LF4A 4E91A 2LOLA 2K5XA 2JU2A 2MR8A 2KG6A 3M1MA 2LIUA 2ROQA 4U0FA 1YJNP 4J93A 2CGQA 5EW5E 2PEOA 4INBA 1ZNVA 4IPYA 1D1DA 3EJEA 2GDWA 1K30A 1OR5A 1VQMP 2XXMA 1NJIQ 3GKLC 5BS2A 4BPFA 1RO2A 2KOOA 4GR2A 2M5RA 1BAJA 1ZMBA 4U0BA 2KORA 4DGEC 4WYMA 5HGOA 3G71P 1RNIA 2DNWA 2Z46A 1S72P 1IMQA 1EOQA 1VQNP 4XFZA 2GOLB 3DS0A 2BUOA 1E0HA 3RG2A 1EMVA 1AFVA 2N50A 1F80D 4LQWC 4H2YC 4BPGA 1VHNA 2XZ0D 3EJBA 1IMPA 3CCQP 2JO0A 5HGKA 1Q7YQ 1MZ8A 3CMEP 3CCMP 1VQLP 1VQKP 2N98A 1L6NA 2MVUA 2XZ1C 1KD1Q 4PWVB 3GJNA 4PXHB 2N6YA 1QVFO 3HZQA 5CZDB 3I55P 2M8LA 2JBGA 1UNKA 3RG6C 3CCLP 2Z44A 2JQ4A 3E2DA 5KP7B 2XGUA 4COCA 2FQ1A 2KR5A 1VQ4P 4MRTC 4U0AA 3CC7P 2JAZA 3G6EP 1T8KA 3CXCO 2MD9A 2OARA 2FADA 4H2WC 2GDYA 2PWMA 1G03A 1Q81Q 5F2OA 2CG5B 3G29A 2N5HA 1M9DC 3B5IA 4QNBA 1A8OA 2JYLA 4U0DA 2PEIA 2KWLA 3CC2P 2OTLP 1AUMA 2GZJA 5F2KA 2K92A 1M1KQ 4XRQA 2WLVB 2GZFA 3VRLC 2EFJA 2GZGA 1M6EX 5EJDA 2JB0A 2EHSA 2XGYA 2FQ0A 2FACA 1GXHA 1VQPP 2GDXA 3DTJA 2K2QA 3HYBA 2AVAA
chains in the Genus database with same CATH topology
1JJ2O 3H0DA 1KC8Q 2OTJP 3G1IA 3I56P 5JPAA 1KQSO 1VQ8P 1QRJA 2EIAA 4LQWC 3CCEP 1P7NA 1EIAA 2KODA 1VQOP 1VQ9P 2PENA 3CCSP 3CCQP 1YIJP 3BP9A 2E1MA 2JO0A 5HGKA 3CCRP 3G4SP 1Q7YQ 1U7KA 1YHQP 1W2BO 1VQ7P 2XGVA 3CCMP 3MGEA 1VQLP 3CCVP 2PEMA 1VQKP 3CMEP 4XROA 2PEKA 3CC4P 4E92A 2V4XA 1EM9A 5BS1A 1L6NA 4PH0A 1KD1Q 2Y4ZA 3P05A 1QVGO 1GWPA 1RO0A 3G28A 1AK4C 1M6NA 2XV6A 3DS5A 2X82A 1M9YC 2PEQA 1QVFO 4PH3A 2L6EA 3HZQA 1Q82Q 1VQNP 1YITP 1YJWP 1M9FC 5I4TG 3I55P 2PXRC 2XT1A 2M8LA 2EG5A 2LF4A 4E91A 1VQ5P 3CCJP 4M0IA 2KGFA 3RG6C 3G0VA 1M9EC 1Q86Q 3M1MA 2DGYA 3CCLP 2Z44A 3DS3A 5DCKA 3E2DA 1M90Q 1YI2P 3CD6P 2XGUA 4COCA 3G21A 2PWOA 3H47A 4U0FA 4PH2A 1VQ4P 1YJNP 4J93A 4COPA 2WLVA 4U0AA 2PEOA 3CC7P 4INBA 3LRYA 2CWOA 2PEJA 3G1GA 3G6EP 2Z45A 3CXCO 2ONTA 2OARA 3H4EA 2PWMA 4DGAC 1D1DA 1G03A 4IPYA 1Q81Q 4U0EA 5F2OA 3Q20A 3G29A 1K30A 1VQMP 1S72P 1M9DC 2M8NA 2XXMA 3B5IA 4QNBA 4HTWA 1A8OA 2JYLA 1IUQA 2JYGA 1A43A 2X83A 1M74A 1NJIQ 1K9MQ 2X2DD 4U0DA 2PEIA 4XFXA 5BS2A 5HGMA 3CC2P 2OTLP 1AUMA 1RO2A 3DS2A 2JPRA 4GR2A 1M9CC 2QEXP 1VQ6P 5HGLA 2PY8A 2P9XA 1BAJA 1ZMBA 5F2KA 2QA4P 4U0BA 3DS4A 3DS1A 4DGEC 4WYMA 1M1KQ 4XRQA 1E6JP 2WLVB 5HGOA 3VRLC 3CMAP 4GR6A 3G71P 4NX4C 1RNIA 2EFJA 4PH1A 4U0CA 2Z46A 2XDEA 2GONA 1EOQA 3CCUP 1M9XC 1M6EX 4XFZA 2M8PA 3OW2O 1N8RQ 4XFYA 2GOLB 2XGYA 3DS0A 1VQPP 3CPWO 2BHVA 3DTJA 2BUOA 3HYBA 1YJ9P 3WBHA 1K8AQ 5HGNA 1AFVA 4B4NA 3DPHA 1K73Q 5F2NA 3NTEA 3G26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1I A;  5JPA A;  1QRJ A;  2EIA A;  4LQW C;  1P7N A;  1EIA A;  2KOD A;  3BP9 A;  2JO0 A;  5HGK A;  1U7K A;  2XGV A;  3MGE A;  4XRO A;  4E92 A;  2V4X A;  1EM9 A;  1L6N A;  4PH0 A;  2Y4Z A;  3P05 A;  1GWP A;  3G28 A;  1AK4 C;  2XV6 A;  3DS5 A;  2X82 A;  1M9Y C;  4PH3 A;  2L6E A;  1M9F C;  5I4T G;  2PXR C;  2XT1 A;  2M8L A;  2LF4 A;  4E91 A;  4M0I A;  2KGF A;  3G0V A;  1M9E C;  3DS3 A;  5DCK A;  2XGU A;  4COC A;  3G21 A;  2PWO A;  3H47 A;  4U0F A;  4PH2 A;  4J93 A;  4COP A;  2WLV A;  4U0A A;  4INB A;  3LRY A;  3G1G A;  2ONT A;  3H4E A;  2PWM A;  4DGA C;  1D1D A;  1G03 A;  4IPY A;  4U0E A;  3G29 A;  1M9D C;  2M8N A;  2XXM A;  4QNB A;  4HTW A;  1A8O A;  2JYL A;  2JYG A;  1A43 A;  2X83 A;  2X2D D;  4U0D A;  4XFX A;  5HGM A;  1AUM A;  3DS2 A;  2JPR A;  1M9C C;  5HGL A;  1BAJ A;  4U0B A;  3DS4 A;  3DS1 A;  4DGE C;  4WYM A;  4XRQ A;  1E6J P;  2WLV B;  5HGO A;  3VRL C;  4NX4 C;  4PH1 A;  4U0C A;  2XDE A;  2GON A;  1EOQ A;  1M9X C;  4XFZ A;  2M8P A;  4XFY A;  2GOL B;  2XGY A;  3DS0 A;  3DTJ A;  2BUO A;  5HGN A;  1AFV A;  4B4N A;  3DPH A;  3NTE A;  3G26 A; 
#chains in the Genus database with same CATH topology
 2OTJ P;  3G1I A;  3I56 P;  2GZE A;  1KQS O;  1KLP A;  2EIA A;  4DG9 A;  2WPT A;  2FVA A;  1NQ4 A;  1VQ9 P;  2PEN A;  3CCS P;  2QNW A;  1U7K A;  2KOS A;  2NO8 A;  3CCV P;  2KGA A;  2KOP A;  4E92 A;  1Z6M A;  4F37 A;  4R0M A;  3P05 A;  2VSQ A;  1GWP A;  3G28 A;  1AK4 C;  2JGP A;  3DS5 A;  4BPH A;  1Q82 Q;  1L0I A;  1GXG A;  1UJZ A;  2PXR C;  2FVE A;  2XT1 A;  2EG5 A;  3CCJ P;  5HVC A;  4M0I A;  2KGF A;  5KP8 B;  2CNR A;  3DS3 A;  5DCK A;  5HV8 A;  1YI2 P;  2N6Z A;  4H2X C;  3G21 A;  3GZL A;  2K0D X;  4UHP B;  4QKO A;  2WLV A;  2K0Y A;  3LRY A;  2CWO A;  2PEJ A;  1X3O A;  2PNG A;  3H4E A;  2LTE A;  4DGA C;  2GZI A;  2LPK A;  3NY7 B;  3Q20 A;  1GPJ A;  2AFE A;  2M8N A;  5KP6 B;  4HTW A;  2L22 A;  1IUQ A;  2JYG A;  1A43 A;  2X83 A;  1K9M Q;  2X2D D;  1AF8 A;  2K0X A;  3DS2 A;  1M9C C;  2KOQ A;  2P9X A;  1FR2 A;  1E6J P;  2MVV A;  4GR6 A;  4PH1 A;  4U0C A;  3OW2 O;  2GON A;  1M9X C;  2M8P A;  2KGC A;  3CPW O;  2BHV A;  2LIW A;  7CEI A;  3WBH A;  4CA3 A;  5HGN A;  2AFD A;  3DPH A;  3B4Q A;  5F2N A;  2GYK A;  3G26 A;  1JJ2 O;  3H0D A;  1VKU A;  5JPA A;  2MF4 A;  3CCE P;  2FVF A;  2KG8 A;  2L0Q A;  1VQO P;  2L9F A;  3CCR P;  1YHQ P;  1W2B O;  2VLN A;  3MGE A;  2PEM A;  2V4X A;  1QVG O;  2L4B A;  1HQB A;  2X2B A;  1M6N A;  2X82 A;  1M9Y C;  2K93 A;  4PH3 A;  2L6E A;  1YIT P;  1YJW P;  1DNY A;  1VQ5 P;  2LML A;  2AF8 A;  2FAE A;  3G0V A;  1M9E C;  1Q86 Q;  2DGY A;  3CE7 A;  1M90 Q;  1ACP A;  3CD6 P;  2N5I A;  4IZ6 A;  1HY8 A;  2PWO A;  3GZM A;  3H47 A;  4PH2 A;  2K94 A;  4COP A;  2VLP A;  3EJD A;  2Z45 A;  2ONT A;  2FHS C;  2VLQ A;  4U0E A;  4HKG A;  2EHT A;  2KG9 A;  3U43 A;  2LKI A;  2MY5 A;  1M74 A;  4XFX A;  5HGM A;  1CEI A;  2JPR A;  2QEX P;  1VQ6 P;  5HGL A;  2PY8 A;  2KGE A;  2QA4 P;  3DS4 A;  3DS1 A;  3CMA P;  4NX4 C;  2XDE A;  3CCU P;  1N8R Q;  4XFY A;  2FQ2 A;  2CQ8 A;  2KW2 A;  3LMO A;  1L0H A;  1YJ9 P;  2LL8 A;  1K8A Q;  4B4N A;  1K73 Q;  3G1G A;  3NTE A;  1KC8 Q;  1VQ8 P;  4NEO A;  1QRJ A;  2MR7 A;  1P7N A;  1AYI A;  1EIA A;  2KOD A;  2VLO A;  1YIJ P;  3BP9 A;  2JU1 A;  2E1M A;  3G4S P;  2ERH A;  1VQ7 P;  2XGV A;  4XRO A;  2KGD A;  2PEK A;  3CC4 P;  1EM9 A;  5BS1 A;  4PH0 A;  1DV5 A;  2Y4Z A;  1RO0 A;  2XV6 A;  2PEQ A;  1BXI A;  1M9F C;  5I4T G;  2LF4 A;  4E91 A;  2LOL A;  2K5X A;  2JU2 A;  2MR8 A;  2KG6 A;  3M1M A;  2LIU A;  2ROQ A;  4U0F A;  1YJN P;  4J93 A;  2CGQ A;  5EW5 E;  2PEO A;  4INB A;  1ZNV A;  4IPY A;  1D1D A;  3EJE A;  2GDW A;  1K30 A;  1OR5 A;  1VQM P;  2XXM A;  1NJI Q;  3GKL C;  5BS2 A;  4BPF A;  1RO2 A;  2KOO A;  4GR2 A;  2M5R A;  1BAJ A;  1ZMB A;  4U0B A;  2KOR A;  4DGE C;  4WYM A;  5HGO A;  3G71 P;  1RNI A;  2DNW A;  2Z46 A;  1S72 P;  1IMQ A;  1EOQ A;  1VQN P;  4XFZ A;  2GOL B;  3DS0 A;  2BUO A;  1E0H A;  3RG2 A;  1EMV A;  1AFV A;  2N50 A;  1F80 D;  4LQW C;  4H2Y C;  4BPG A;  1VHN A;  2XZ0 D;  3EJB A;  1IMP A;  3CCQ P;  2JO0 A;  5HGK A;  1Q7Y Q;  1MZ8 A;  3CME P;  3CCM P;  1VQL P;  1VQK P;  2N98 A;  1L6N A;  2MVU A;  2XZ1 C;  1KD1 Q;  4PWV B;  3GJN A;  4PXH B;  2N6Y A;  1QVF O;  3HZQ A;  5CZD B;  3I55 P;  2M8L A;  2JBG A;  1UNK A;  3RG6 C;  3CCL P;  2Z44 A;  2JQ4 A;  3E2D A;  5KP7 B;  2XGU A;  4COC A;  2FQ1 A;  2KR5 A;  1VQ4 P;  4MRT C;  4U0A A;  3CC7 P;  2JAZ A;  3G6E P;  1T8K A;  3CXC O;  2MD9 A;  2OAR A;  2FAD A;  4H2W C;  2GDY A;  2PWM A;  1G03 A;  1Q81 Q;  5F2O A;  2CG5 B;  3G29 A;  2N5H A;  1M9D C;  3B5I A;  4QNB A;  1A8O A;  2JYL A;  4U0D A;  2PEI A;  2KWL A;  3CC2 P;  2OTL P;  1AUM A;  2GZJ A;  5F2K A;  2K92 A;  1M1K Q;  4XRQ A;  2WLV B;  2GZF A;  3VRL C;  2EFJ A;  2GZG A;  1M6E X;  5EJD A;  2JB0 A;  2EHS A;  2XGY A;  2FQ0 A;  2FAC A;  1GXH A;  1VQP P;  2GDX A;  3DTJ A;  2K2Q A;  3HYB A;  2AVA A; 
#chains in the Genus database with same CATH homology
 1JJ2 O;  3H0D A;  1KC8 Q;  2OTJ P;  3G1I A;  3I56 P;  5JPA A;  1KQS O;  1VQ8 P;  1QRJ A;  2EIA A;  4LQW C;  3CCE P;  1P7N A;  1EIA A;  2KOD A;  1VQO P;  1VQ9 P;  2PEN A;  3CCS P;  3CCQ P;  1YIJ P;  3BP9 A;  2E1M A;  2JO0 A;  5HGK A;  3CCR P;  3G4S P;  1Q7Y Q;  1U7K A;  1YHQ P;  1W2B O;  1VQ7 P;  2XGV A;  3CCM P;  3MGE A;  1VQL P;  3CCV P;  2PEM A;  1VQK P;  3CME P;  4XRO A;  2PEK A;  3CC4 P;  4E92 A;  2V4X A;  1EM9 A;  5BS1 A;  1L6N A;  4PH0 A;  1KD1 Q;  2Y4Z A;  3P05 A;  1QVG O;  1GWP A;  1RO0 A;  3G28 A;  1AK4 C;  1M6N A;  2XV6 A;  3DS5 A;  2X82 A;  1M9Y C;  2PEQ A;  1QVF O;  4PH3 A;  2L6E A;  3HZQ A;  1Q82 Q;  1VQN P;  1YIT P;  1YJW P;  1M9F C;  5I4T G;  3I55 P;  2PXR C;  2XT1 A;  2M8L A;  2EG5 A;  2LF4 A;  4E91 A;  1VQ5 P;  3CCJ P;  4M0I A;  2KGF A;  3RG6 C;  3G0V A;  1M9E C;  1Q86 Q;  3M1M A;  2DGY A;  3CCL P;  2Z44 A;  3DS3 A;  5DCK A;  3E2D A;  1M90 Q;  1YI2 P;  3CD6 P;  2XGU A;  4COC A;  3G21 A;  2PWO A;  3H47 A;  4U0F A;  4PH2 A;  1VQ4 P;  1YJN P;  4J93 A;  4COP A;  2WLV A;  4U0A A;  2PEO A;  3CC7 P;  4INB A;  3LRY A;  2CWO A;  2PEJ A;  3G1G A;  3G6E P;  2Z45 A;  3CXC O;  2ONT A;  2OAR A;  3H4E A;  2PWM A;  4DGA C;  1D1D A;  1G03 A;  4IPY A;  1Q81 Q;  4U0E A;  5F2O A;  3Q20 A;  3G29 A;  1K30 A;  1VQM P;  1S72 P;  1M9D C;  2M8N A;  2XXM A;  3B5I A;  4QNB A;  4HTW A;  1A8O A;  2JYL A;  1IUQ A;  2JYG A;  1A43 A;  2X83 A;  1M74 A;  1NJI Q;  1K9M Q;  2X2D D;  4U0D A;  2PEI A;  4XFX A;  5BS2 A;  5HGM A;  3CC2 P;  2OTL P;  1AUM A;  1RO2 A;  3DS2 A;  2JPR A;  4GR2 A;  1M9C C;  2QEX P;  1VQ6 P;  5HGL A;  2PY8 A;  2P9X A;  1BAJ A;  1ZMB A;  5F2K A;  2QA4 P;  4U0B A;  3DS4 A;  3DS1 A;  4DGE C;  4WYM A;  1M1K Q;  4XRQ A;  1E6J P;  2WLV B;  5HGO A;  3VRL C;  3CMA P;  4GR6 A;  3G71 P;  4NX4 C;  1RNI A;  2EFJ A;  4PH1 A;  4U0C A;  2Z46 A;  2XDE A;  2GON A;  1EOQ A;  3CCU P;  1M9X C;  1M6E X;  4XFZ A;  2M8P A;  3OW2 O;  1N8R Q;  4XFY A;  2GOL B;  2XGY A;  3DS0 A;  1VQP P;  3CPW O;  2BHV A;  3DTJ A;  2BUO A;  3HYB A;  1YJ9 P;  3WBH A;  1K8A Q;  5HGN A;  1AFV A;  4B4N A;  3DPH A;  1K73 Q;  5F2N A;  3NTE A;  3G26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...