4XFXA

Structure of the native full-length hiv-1 capsid protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
216
Chain Sequence
PIVQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 74
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfxA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfxA02
5JPAA 5HGKA 2M8NA 4DGEC 4PH3A 3LRYA 4DGAC 2KGFA 1P7NA 1GWPA 2M8PA 2Y4ZA 4HTWA 1M9YC 2BUOA 2PWOA 2ONTA 2WLVA 3VRLC 2XV6A 5I4TG 2KODA 4COCA 2JYGA 4XFXA 3G1IA 1BAJA 1E6JP 4U0CA 4U0BA 3DS2A 3G26A 3DS0A 3G1GA 5HGMA 4XRQA 2X83A 1U7KA 2GONA 2LF4A 4J93A 1D1DA 3BP9A 4PH0A 4U0DA 5HGLA 3DPHA 1EOQA 3G28A 4QNBA 2WLVB 1EIAA 4WYMA 4U0EA 2L6EA 2V4XA 3G29A 2XT1A 4PH2A 1EM9A 2X82A 5DCKA 1M9XC 4M0IA 1M9FC 4PH1A 2M8LA 3H4EA 3G21A 1L6NA 4LQWC 2XDEA 3P05A 2XGUA 2PXRC 3DS4A 2XGVA 4B4NA 4NX4C 2JPRA 5HGOA 3DTJA 3G0VA 1M9EC 4INBA 4XFYA 1A43A 4E92A 1AFVA 4XROA 4U0AA 1M9CC 2XXMA 1G03A 1AUMA 2X2DD 3H47A 1QRJA 3DS3A 4COPA 3DS5A 2GOLB 1A8OA 4U0FA 3MGEA 2JYLA 4E91A 4XFZA 2PWMA 5HGNA 3NTEA 2EIAA 1M9DC 4IPYA 1AK4C 2XGYA 2JO0A 3DS1A
chains in the Genus database with same CATH superfamily
3M1MA 5JPAA 1E0HA 2VLPA 2P9XA 2VSQA 4PH3A 3CCMP 1K73Q 2KGFA 1VQOP 2M8PA 2BUOA 1OR5A 2FQ1A 4R0MA 1K30A 2Z46A 3HYBA 2ROQA 3VRLC 2GZGA 1FR2A 1YHQP 1UNKA 3G1IA 3OW2O 2N5IA 2KOSA 2K92A 1E6JP 1ACPA 1IUQA 1GPJA 1HY8A 2X2BA 1F80D 1T8KA 4XRQA 4UHPB 1RNIA 3GJNA 3NY7B 2FADA 2L4BA 3G6EP 5KP7B 2PNGA 2AF8A 3GKLC 4MRTC 1ZMBA 1VQ9P 4H2XC 3I55P 1EIAA 1VHNA 2LL8A 3RG6C 2L9FA 2L6EA 1Q81Q 2FVEA 3B4QA 2QA4P 2FVFA 1JJ2O 3H0DA 2L22A 2L0QA 3EJEA 2CWOA 1VQ8P 1VQPP 3DTJA 3CXCO 1RO0A 2MD9A 1A43A 4XROA 4U0AA 1KD1Q 2MY5A 2PEKA 2N5HA 1AUMA 2PENA 3H47A 3DS3A 4QKOA 2PEOA 1A8OA 2EFJA 3MGEA 4NEOA 2JYLA 4XFZA 5HGNA 1KC8Q 3CMEP 4H2WC 2JO0A 2M5RA 2FHSC 3G71P 2KORA 2KG8A 4HTWA 2MR7A 1M9YC 4IZ6A 2ONTA 2GZJA 3WBHA 3CCLP 2KGCA 4COCA 4H2YC 1QVFO 1YIJP 1VQMP 2KWLA 2NO8A 4U0BA 1DNYA 1VKUA 2LMLA 2GDXA 1Z6MA 2VLNA 1GXHA 2KOPA 3GZLA 1M90Q 2GDWA 2MR8A 2ERHA 1D1DA 2PEMA 3BP9A 2JU1A 2OTJP 2GZFA 5HGLA 1RO2A 2MF4A 4WYMA 2LIWA 2JAZA 5HVCA 2GZIA 2K2QA 2KOQA 5F2OA 2X82A 3I56P 2PY8A 4M0IA 1W2BO 2LTEA 2LOLA 4BPHA 3H4EA 5KP8B 3G21A 2KG6A 5F2NA 1L6NA 1BXIA 4LQWC 1M6NA 2XGUA 2PXRC 2XGVA 4NX4C 2JPRA 2KG9A 4E92A 1AFVA 2WPTA 1VQLP 3U43A 1L0IA 2JBGA 4CA3A 3B5IA 4COPA 2GOLB 2KGAA 3CC4P 2BHVA 1GXGA 1YJ9P 1NJIQ 1VQNP 2PWMA 3NTEA 2EIAA 4BPFA 1M9DC 1CEIA 1AK4C 2FAEA 2FVAA 5HGKA 3CCUP 2KR5A 2M8NA 2DGYA 2CNRA 3LRYA 2EHSA 4DGAC 1P7NA 1GWPA 2PEQA 5KP6B 2WLVA 2AFDA 4BPGA 2KODA 2JYGA 4XFXA 1BAJA 3CCVP 4U0CA 2K94A 3Q20A 3DS2A 1IMQA 1M74A 3G26A 1IMPA 5HGMA 1AF8A 2X83A 2AFEA 1VQ6P 5BS1A 1X3OA 2GONA 4J93A 2LIUA 1EOQA 2LPKA 2N6YA 3G28A 3CCSP 2E1MA 4QNBA 2WLVB 3RG2A 4U0EA 2EG5A 2AVAA 1Q7YQ 4PH2A 2CQ8A 1EM9A 1QVGO 4GR2A 2Z45A 2PEIA 2XZ0D 2FACA 3CCRP 4DG9A 3P05A 2Z44A 2K5XA 4B4NA 1YJNP 1AYIA 3G0VA 1Q82Q 1EMVA 2K93A 1YI2P 4INBA 4GR6A 4XFYA 2XXMA 3CC2P 2FQ2A 4F37A 1Q86Q 2LKIA 2X2DD 2CGQA 1QRJA 2JQ4A 3DS5A 1HQBA 2KGDA 2DNWA 2PEJA 4E91A 2N6ZA 2GYKA 2VLOA 3CD6P 1K9MQ 4PWVB 4DGEC 1N8RQ 2Y4ZA 2PWOA 3E2DA 2MVUA 5HV8A 1VQ7P 2XV6A 1K8AQ 3CPWO 5I4TG 5BS2A 2GDYA 2JB0A 1L0HA 2KOOA 3CC7P 1DV5A 4HKGA 3DS0A 3G1GA 3HZQA 1M1KQ 1KLPA 1U7KA 2K0XA 2LF4A 3CCEP 4PH0A 4U0DA 3DPHA 1VQ5P 4PXHB 2CG5B 2OARA 1YITP 2K0YA 1S72P 2KGEA 2V4XA 2FQ0A 3G29A 5EJDA 2XT1A 3EJDA 2MVVA 1MZ8A 5DCKA 1M9XC 5EW5E 1M9FC 2EHTA 2GZEA 2JU2A 4PH1A 2M8LA 7CEIA 3CCQP 2K0DX 3EJBA 2XDEA 2QNWA 3LMOA 5CZDB 3CCJP 3DS4A 3CE7A 5HGOA 3GZMA 1VQKP 1M9EC 1NQ4A 1M9CC 2JGPA 3CMAP 3G4SP 1G03A 1ZNVA 2N50A 2XZ1C 4U0FA 1UJZA 2N98A 2QEXP 5F2KA 1YJWP 1KQSO 2OTLP 1M6EX 4IPYA 2KW2A 2XGYA 2VLQA 3DS1A 1VQ4P
chains in the Genus database with same CATH topology
3CD6P 3M1MA 5JPAA 5HGKA 3CCUP 1K9MQ 3G71P 2P9XA 2M8NA 2DGYA 4DGEC 4PH3A 3CCMP 1N8RQ 3LRYA 1K73Q 4DGAC 2KGFA 1P7NA 1GWPA 2M8PA 2Y4ZA 4HTWA 1M9YC 2BUOA 2PEQA 2PWOA 2ONTA 3WBHA 1VQNP 1K30A 3E2DA 2WLVA 2Z46A 3HYBA 1VQ7P 3VRLC 2XV6A 1K8AQ 3CPWO 5I4TG 5BS2A 2KODA 1YHQP 3CCLP 4COCA 2JYGA 1QVFO 4XFXA 1YIJP 3G1IA 3OW2O 1VQMP 1VQOP 3CC7P 1BAJA 3CCVP 1E6JP 4U0CA 4U0BA 3Q20A 3DS2A 1M74A 1IUQA 3G26A 3DS0A 3G1GA 5HGMA 3HZQA 1M1KQ 4XRQA 2X83A 1U7KA 1M90Q 1VQ6P 1RNIA 5BS1A 2GONA 2LF4A 4J93A 3G6EP 1D1DA 2PEMA 3BP9A 3CCEP 2OTJP 4PH0A 4U0DA 5HGLA 3DPHA 1VQ5P 1ZMBA 1VQ9P 1EOQA 1RO2A 3G28A 3CCSP 2E1MA 4QNBA 2WLVB 3I55P 1EIAA 2OARA 1YITP 4WYMA 4U0EA 3RG6C 2EG5A 1S72P 2L6EA 2V4XA 3G29A 1Q81Q 1Q7YQ 2XT1A 4PH2A 5F2OA 1EM9A 2X82A 5DCKA 2PY8A 1M9XC 4GR2A 4M0IA 2Z45A 3I56P 1QVGO 1M9FC 2QA4P 2PEIA 1W2BO 4PH1A 2M8LA 3CCQP 3CCRP 3H4EA 1JJ2O 3G21A 3H0DA 5F2NA 1L6NA 4LQWC 2XDEA 1M6NA 3P05A 2XGUA 2Z44A 2CWOA 3CCJP 1VQ8P 2PXRC 3DS4A 2XGVA 4B4NA 4NX4C 1VQPP 2JPRA 1YJNP 5HGOA 3DTJA 3G0VA 1Q82Q 1M9EC 1VQKP 1YI2P 3CXCO 4INBA 1RO0A 4GR6A 4XFYA 1A43A 4E92A 1AFVA 4XROA 4U0AA 1M9CC 1VQLP 2XXMA 3CC2P 1KD1Q 3CMAP 3G4SP 1G03A 2PEKA 1Q86Q 3B5IA 1AUMA 2X2DD 2PENA 3H47A 1QRJA 3DS3A 4COPA 3DS5A 2GOLB 3CC4P 2PEOA 1A8OA 2BHVA 2EFJA 1YJ9P 4U0FA 1NJIQ 3MGEA 5F2KA 2QEXP 1YJWP 2JYLA 4E91A 4XFZA 2PWMA 5HGNA 2PEJA 1KC8Q 1KQSO 3CMEP 2OTLP 3NTEA 1M6EX 2EIAA 1M9DC 4IPYA 1AK4C 2XGYA 2JO0A 3DS1A 1VQ4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPA A;  5HGK A;  2M8N A;  4DGE C;  4PH3 A;  3LRY A;  4DGA C;  2KGF A;  1P7N A;  1GWP A;  2M8P A;  2Y4Z A;  4HTW A;  1M9Y C;  2BUO A;  2PWO A;  2ONT A;  2WLV A;  3VRL C;  2XV6 A;  5I4T G;  2KOD A;  4COC A;  2JYG A;  4XFX A;  3G1I A;  1BAJ A;  1E6J P;  4U0C A;  4U0B A;  3DS2 A;  3G26 A;  3DS0 A;  3G1G A;  5HGM A;  4XRQ A;  2X83 A;  1U7K A;  2GON A;  2LF4 A;  4J93 A;  1D1D A;  3BP9 A;  4PH0 A;  4U0D A;  5HGL A;  3DPH A;  1EOQ A;  3G28 A;  4QNB A;  2WLV B;  1EIA A;  4WYM A;  4U0E A;  2L6E A;  2V4X A;  3G29 A;  2XT1 A;  4PH2 A;  1EM9 A;  2X82 A;  5DCK A;  1M9X C;  4M0I A;  1M9F C;  4PH1 A;  2M8L A;  3H4E A;  3G21 A;  1L6N A;  4LQW C;  2XDE A;  3P05 A;  2XGU A;  2PXR C;  3DS4 A;  2XGV A;  4B4N A;  4NX4 C;  2JPR A;  5HGO A;  3DTJ A;  3G0V A;  1M9E C;  4INB A;  4XFY A;  1A43 A;  4E92 A;  1AFV A;  4XRO A;  4U0A A;  1M9C C;  2XXM A;  1G03 A;  1AUM A;  2X2D D;  3H47 A;  1QRJ A;  3DS3 A;  4COP A;  3DS5 A;  2GOL B;  1A8O A;  4U0F A;  3MGE A;  2JYL A;  4E91 A;  4XFZ A;  2PWM A;  5HGN A;  3NTE A;  2EIA A;  1M9D C;  4IPY A;  1AK4 C;  2XGY A;  2JO0 A;  3DS1 A; 
#chains in the Genus database with same CATH topology
 3M1M A;  5JPA A;  1E0H A;  2VLP A;  2P9X A;  2VSQ A;  4PH3 A;  3CCM P;  1K73 Q;  2KGF A;  1VQO P;  2M8P A;  2BUO A;  1OR5 A;  2FQ1 A;  4R0M A;  1K30 A;  2Z46 A;  3HYB A;  2ROQ A;  3VRL C;  2GZG A;  1FR2 A;  1YHQ P;  1UNK A;  3G1I A;  3OW2 O;  2N5I A;  2KOS A;  2K92 A;  1E6J P;  1ACP A;  1IUQ A;  1GPJ A;  1HY8 A;  2X2B A;  1F80 D;  1T8K A;  4XRQ A;  4UHP B;  1RNI A;  3GJN A;  3NY7 B;  2FAD A;  2L4B A;  3G6E P;  5KP7 B;  2PNG A;  2AF8 A;  3GKL C;  4MRT C;  1ZMB A;  1VQ9 P;  4H2X C;  3I55 P;  1EIA A;  1VHN A;  2LL8 A;  3RG6 C;  2L9F A;  2L6E A;  1Q81 Q;  2FVE A;  3B4Q A;  2QA4 P;  2FVF A;  1JJ2 O;  3H0D A;  2L22 A;  2L0Q A;  3EJE A;  2CWO A;  1VQ8 P;  1VQP P;  3DTJ A;  3CXC O;  1RO0 A;  2MD9 A;  1A43 A;  4XRO A;  4U0A A;  1KD1 Q;  2MY5 A;  2PEK A;  2N5H A;  1AUM A;  2PEN A;  3H47 A;  3DS3 A;  4QKO A;  2PEO A;  1A8O A;  2EFJ A;  3MGE A;  4NEO A;  2JYL A;  4XFZ A;  5HGN A;  1KC8 Q;  3CME P;  4H2W C;  2JO0 A;  2M5R A;  2FHS C;  3G71 P;  2KOR A;  2KG8 A;  4HTW A;  2MR7 A;  1M9Y C;  4IZ6 A;  2ONT A;  2GZJ A;  3WBH A;  3CCL P;  2KGC A;  4COC A;  4H2Y C;  1QVF O;  1YIJ P;  1VQM P;  2KWL A;  2NO8 A;  4U0B A;  1DNY A;  1VKU A;  2LML A;  2GDX A;  1Z6M A;  2VLN A;  1GXH A;  2KOP A;  3GZL A;  1M90 Q;  2GDW A;  2MR8 A;  2ERH A;  1D1D A;  2PEM A;  3BP9 A;  2JU1 A;  2OTJ P;  2GZF A;  5HGL A;  1RO2 A;  2MF4 A;  4WYM A;  2LIW A;  2JAZ A;  5HVC A;  2GZI A;  2K2Q A;  2KOQ A;  5F2O A;  2X82 A;  3I56 P;  2PY8 A;  4M0I A;  1W2B O;  2LTE A;  2LOL A;  4BPH A;  3H4E A;  5KP8 B;  3G21 A;  2KG6 A;  5F2N A;  1L6N A;  1BXI A;  4LQW C;  1M6N A;  2XGU A;  2PXR C;  2XGV A;  4NX4 C;  2JPR A;  2KG9 A;  4E92 A;  1AFV A;  2WPT A;  1VQL P;  3U43 A;  1L0I A;  2JBG A;  4CA3 A;  3B5I A;  4COP A;  2GOL B;  2KGA A;  3CC4 P;  2BHV A;  1GXG A;  1YJ9 P;  1NJI Q;  1VQN P;  2PWM A;  3NTE A;  2EIA A;  4BPF A;  1M9D C;  1CEI A;  1AK4 C;  2FAE A;  2FVA A;  5HGK A;  3CCU P;  2KR5 A;  2M8N A;  2DGY A;  2CNR A;  3LRY A;  2EHS A;  4DGA C;  1P7N A;  1GWP A;  2PEQ A;  5KP6 B;  2WLV A;  2AFD A;  4BPG A;  2KOD A;  2JYG A;  4XFX A;  1BAJ A;  3CCV P;  4U0C A;  2K94 A;  3Q20 A;  3DS2 A;  1IMQ A;  1M74 A;  3G26 A;  1IMP A;  5HGM A;  1AF8 A;  2X83 A;  2AFE A;  1VQ6 P;  5BS1 A;  1X3O A;  2GON A;  4J93 A;  2LIU A;  1EOQ A;  2LPK A;  2N6Y A;  3G28 A;  3CCS P;  2E1M A;  4QNB A;  2WLV B;  3RG2 A;  4U0E A;  2EG5 A;  2AVA A;  1Q7Y Q;  4PH2 A;  2CQ8 A;  1EM9 A;  1QVG O;  4GR2 A;  2Z45 A;  2PEI A;  2XZ0 D;  2FAC A;  3CCR P;  4DG9 A;  3P05 A;  2Z44 A;  2K5X A;  4B4N A;  1YJN P;  1AYI A;  3G0V A;  1Q82 Q;  1EMV A;  2K93 A;  1YI2 P;  4INB A;  4GR6 A;  4XFY A;  2XXM A;  3CC2 P;  2FQ2 A;  4F37 A;  1Q86 Q;  2LKI A;  2X2D D;  2CGQ A;  1QRJ A;  2JQ4 A;  3DS5 A;  1HQB A;  2KGD A;  2DNW A;  2PEJ A;  4E91 A;  2N6Z A;  2GYK A;  2VLO A;  3CD6 P;  1K9M Q;  4PWV B;  4DGE C;  1N8R Q;  2Y4Z A;  2PWO A;  3E2D A;  2MVU A;  5HV8 A;  1VQ7 P;  2XV6 A;  1K8A Q;  3CPW O;  5I4T G;  5BS2 A;  2GDY A;  2JB0 A;  1L0H A;  2KOO A;  3CC7 P;  1DV5 A;  4HKG A;  3DS0 A;  3G1G A;  3HZQ A;  1M1K Q;  1KLP A;  1U7K A;  2K0X A;  2LF4 A;  3CCE P;  4PH0 A;  4U0D A;  3DPH A;  1VQ5 P;  4PXH B;  2CG5 B;  2OAR A;  1YIT P;  2K0Y A;  1S72 P;  2KGE A;  2V4X A;  2FQ0 A;  3G29 A;  5EJD A;  2XT1 A;  3EJD A;  2MVV A;  1MZ8 A;  5DCK A;  1M9X C;  5EW5 E;  1M9F C;  2EHT A;  2GZE A;  2JU2 A;  4PH1 A;  2M8L A;  7CEI A;  3CCQ P;  2K0D X;  3EJB A;  2XDE A;  2QNW A;  3LMO A;  5CZD B;  3CCJ P;  3DS4 A;  3CE7 A;  5HGO A;  3GZM A;  1VQK P;  1M9E C;  1NQ4 A;  1M9C C;  2JGP A;  3CMA P;  3G4S P;  1G03 A;  1ZNV A;  2N50 A;  2XZ1 C;  4U0F A;  1UJZ A;  2N98 A;  2QEX P;  5F2K A;  1YJW P;  1KQS O;  2OTL P;  1M6E X;  4IPY A;  2KW2 A;  2XGY A;  2VLQ A;  3DS1 A;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 3CD6 P;  3M1M A;  5JPA A;  5HGK A;  3CCU P;  1K9M Q;  3G71 P;  2P9X A;  2M8N A;  2DGY A;  4DGE C;  4PH3 A;  3CCM P;  1N8R Q;  3LRY A;  1K73 Q;  4DGA C;  2KGF A;  1P7N A;  1GWP A;  2M8P A;  2Y4Z A;  4HTW A;  1M9Y C;  2BUO A;  2PEQ A;  2PWO A;  2ONT A;  3WBH A;  1VQN P;  1K30 A;  3E2D A;  2WLV A;  2Z46 A;  3HYB A;  1VQ7 P;  3VRL C;  2XV6 A;  1K8A Q;  3CPW O;  5I4T G;  5BS2 A;  2KOD A;  1YHQ P;  3CCL P;  4COC A;  2JYG A;  1QVF O;  4XFX A;  1YIJ P;  3G1I A;  3OW2 O;  1VQM P;  1VQO P;  3CC7 P;  1BAJ A;  3CCV P;  1E6J P;  4U0C A;  4U0B A;  3Q20 A;  3DS2 A;  1M74 A;  1IUQ A;  3G26 A;  3DS0 A;  3G1G A;  5HGM A;  3HZQ A;  1M1K Q;  4XRQ A;  2X83 A;  1U7K A;  1M90 Q;  1VQ6 P;  1RNI A;  5BS1 A;  2GON A;  2LF4 A;  4J93 A;  3G6E P;  1D1D A;  2PEM A;  3BP9 A;  3CCE P;  2OTJ P;  4PH0 A;  4U0D A;  5HGL A;  3DPH A;  1VQ5 P;  1ZMB A;  1VQ9 P;  1EOQ A;  1RO2 A;  3G28 A;  3CCS P;  2E1M A;  4QNB A;  2WLV B;  3I55 P;  1EIA A;  2OAR A;  1YIT P;  4WYM A;  4U0E A;  3RG6 C;  2EG5 A;  1S72 P;  2L6E A;  2V4X A;  3G29 A;  1Q81 Q;  1Q7Y Q;  2XT1 A;  4PH2 A;  5F2O A;  1EM9 A;  2X82 A;  5DCK A;  2PY8 A;  1M9X C;  4GR2 A;  4M0I A;  2Z45 A;  3I56 P;  1QVG O;  1M9F C;  2QA4 P;  2PEI A;  1W2B O;  4PH1 A;  2M8L A;  3CCQ P;  3CCR P;  3H4E A;  1JJ2 O;  3G21 A;  3H0D A;  5F2N A;  1L6N A;  4LQW C;  2XDE A;  1M6N A;  3P05 A;  2XGU A;  2Z44 A;  2CWO A;  3CCJ P;  1VQ8 P;  2PXR C;  3DS4 A;  2XGV A;  4B4N A;  4NX4 C;  1VQP P;  2JPR A;  1YJN P;  5HGO A;  3DTJ A;  3G0V A;  1Q82 Q;  1M9E C;  1VQK P;  1YI2 P;  3CXC O;  4INB A;  1RO0 A;  4GR6 A;  4XFY A;  1A43 A;  4E92 A;  1AFV A;  4XRO A;  4U0A A;  1M9C C;  1VQL P;  2XXM A;  3CC2 P;  1KD1 Q;  3CMA P;  3G4S P;  1G03 A;  2PEK A;  1Q86 Q;  3B5I A;  1AUM A;  2X2D D;  2PEN A;  3H47 A;  1QRJ A;  3DS3 A;  4COP A;  3DS5 A;  2GOL B;  3CC4 P;  2PEO A;  1A8O A;  2BHV A;  2EFJ A;  1YJ9 P;  4U0F A;  1NJI Q;  3MGE A;  5F2K A;  2QEX P;  1YJW P;  2JYL A;  4E91 A;  4XFZ A;  2PWM A;  5HGN A;  2PEJ A;  1KC8 Q;  1KQS O;  3CME P;  2OTL P;  3NTE A;  1M6E X;  2EIA A;  1M9D C;  4IPY A;  1AK4 C;  2XGY A;  2JO0 A;  3DS1 A;  1VQ4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...