4XFXA

Structure of the native full-length hiv-1 capsid protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
216
Chain Sequence
PIVQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 74
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfxA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfxA02
1QRJA 1L6NA 1A8OA 4E92A 2XXMA 2X2DD 3DS3A 4LQWC 4U0CA 5DCKA 3P05A 2PWOA 3G28A 4M0IA 4PH0A 4XFYA 4COCA 4U0EA 3H4EA 1GWPA 2M8LA 2PXRC 4NX4C 2X83A 1E6JP 4B4NA 5I4TG 1U7KA 2XT1A 5JPAA 3G0VA 1M9DC 4XFXA 3G1IA 3VRLC 5HGKA 1AK4C 2Y4ZA 3MGEA 2WLVB 1D1DA 2JO0A 5HGLA 5HGNA 2GOLB 4U0DA 2LF4A 4DGAC 1M9YC 1A43A 2JPRA 2JYGA 2M8PA 1BAJA 4QNBA 3DPHA 3NTEA 3G1GA 2GONA 4WYMA 2EIAA 4U0FA 4XRQA 2BUOA 3DS0A 2XGVA 4XROA 2ONTA 1AFVA 3DS5A 1P7NA 2KODA 3BP9A 4IPYA 4PH2A 3G26A 2XV6A 2XGUA 2PWMA 4U0BA 2JYLA 3DS2A 1EOQA 2XDEA 5HGMA 5HGOA 3G29A 2V4XA 1M9XC 1M9EC 1M9CC 4E91A 2WLVA 2X82A 3DS4A 4PH1A 1AUMA 3DS1A 1M9FC 1EM9A 4DGEC 4XFZA 4COPA 4HTWA 1G03A 1EIAA 2L6EA 3LRYA 4INBA 3H47A 4J93A 3G21A 4U0AA 2M8NA 4PH3A 2KGFA 2XGYA 3DTJA
chains in the Genus database with same CATH superfamily
1QRJA 1VQNP 4E92A 2GZFA 2XXMA 2LKIA 3P05A 4M0IA 1VQ9P 2PENA 1KD1Q 4XFYA 4COCA 4U0EA 2K5XA 3B4QA 3CCVP 1VQPP 2PXRC 3I56P 1L0IA 5I4TG 1U7KA 1EMVA 2X2BA 2XT1A 4H2XC 1Q81Q 2FQ2A 1YITP 2WLVB 2JO0A 2GOLB 2GZEA 4NEOA 2LF4A 2N6YA 2QNWA 2VLOA 4DG9A 1A43A 1OR5A 1BAJA 1MZ8A 3CCUP 3DPHA 1VKUA 2GONA 2EIAA 4BPFA 2N6ZA 2BUOA 2K2QA 2OTJP 2JU2A 5CZDB 4XROA 1UJZA 1AFVA 1P7NA 2PEJA 1K9MQ 2P9XA 3H0DA 4BPGA 3CCSP 1S72P 2JU1A 2KGEA 4H2WC 3CD6P 4PH2A 3G26A 2MVVA 3CXCO 2JBGA 2PWMA 4U0BA 2JYLA 1EOQA 5HGMA 5HGOA 3G29A 1RO2A 2KOOA 4H2YC 3CCJP 1KLPA 2WLVA 1Q7YQ 2OARA 1IMPA 3Q20A 5EW5E 1AUMA 3U43A 1K73Q 4DGEC 7CEIA 2K94A 1EIAA 2L6EA 2WPTA 2KGAA 2FAEA 2M5RA 3LRYA 3H47A 3G21A 2Z45A 2XGYA 3DTJA 1BXIA 1IMQA 2FQ1A 4GR2A 2N5HA 5HV8A 2CQ8A 5DCKA 2GYKA 2PWOA 2PEMA 2MR8A 4PH0A 2K93A 2KG8A 3B5IA 1GWPA 3RG2A 2CNRA 2FQ0A 5JPAA 1M9DC 1N8RQ 2Z46A 3VRLC 5HGKA 1AK4C 3MGEA 3CE7A 5HGLA 5HGNA 3EJEA 4U0DA 2K0XA 2GZIA 2M8PA 3CCLP 2GZGA 2QA4P 4WYMA 1QVGO 1M6EX 2XGVA 2AFDA 2VSQA 2GDXA 1VQ5P 2ONTA 1AF8A 5F2KA 3DS5A 2VLNA 1YI2P 4BPHA 3G6EP 1ACPA 2GZJA 4GR6A 3WBHA 3CC4P 2KOQA 2OTLP 3HZQA 3GZMA 1M90Q 2PNGA 1NJIQ 5EJDA 1IUQA 1M9XC 4PWVB 1YJWP 3G4SP 1M9CC 2FHSC 1YHQP 4PH1A 2FVFA 1ZNVA 1L0HA 3DS1A 2KGCA 2Z44A 1W2BO 1ZMBA 4XFZA 2KG9A 2EHSA 2L0QA 4HKGA 5KP7B 1HQBA 2M8NA 1Q86Q 2KGFA 3CCMP 2GDWA 4QKOA 1Q82Q 3GZLA 3RG6C 4PXHB 2L22A 2MR7A 2KG6A 2X2DD 1X3OA 4LQWC 4U0CA 1NQ4A 3G28A 3E2DA 1JJ2O 3H4EA 2FVAA 2ERHA 1YJ9P 2X83A 1E6JP 2VLQA 2KOPA 2E1MA 3G0VA 2K0DX 1GXHA 4XFXA 5F2OA 3GJNA 4CA3A 1M1KQ 2FACA 1M9YC 2JPRA 1K8AQ 4QNBA 3G1GA 3CCQP 4U0FA 1E0HA 1YJNP 4MRTC 2N50A 2KODA 1VHNA 2CGQA 2AFEA 3G71P 3BP9A 1M6NA 2PEQA 3CCRP 4IPYA 1T8KA 1FR2A 2XGUA 3M1MA 3DS2A 2KOSA 2V4XA 1QVFO 2N98A 1VQKP 4F37A 2PEIA 2JGPA 2XZ0D 2AVAA 2NO8A 2MY5A 1CEIA 1RNIA 5HVCA 1M9FC 2JQ4A 2K92A 4COPA 1M74A 2ROQA 1G03A 2BHVA 2L9FA 3CPWO 2N5IA 1AYIA 4U0AA 5BS2A 1UNKA 1DNYA 2KWLA 1K30A 3CC7P 3EJDA 2KR5A 1L6NA 1A8OA 5F2NA 1VQ4P 3DS3A 2LIUA 2QEXP 2VLPA 2FVEA 4IZ6A 1VQ8P 2AF8A 1VQLP 2CG5B 2EHTA 1GXGA 2M8LA 2LTEA 4NX4C 4B4NA 3OW2O 5KP8B 3GKLC 2PEKA 3G1IA 2FADA 2GDYA 2JB0A 2MVUA 2Y4ZA 5KP6B 1Z6MA 1D1DA 4R0MA 4DGAC 3CCEP 2JYGA 1KQSO 3NTEA 1VQ7P 3CMAP 4XRQA 3DS0A 2XZ1C 3I55P 4UHPB 1HY8A 2CWOA 2KGDA 2PEOA 3NY7B 2PY8A 1F80D 3HYBA 2XV6A 2LIWA 1GPJA 1RO0A 2L4BA 2LL8A 2LMLA 1VQMP 2XDEA 3CMEP 2LPKA 2LOLA 2DGYA 2DNWA 5BS1A 1M9EC 2KW2A 4E91A 2EG5A 1YIJP 2X82A 3DS4A 2EFJA 2MF4A 2K0YA 3EJBA 1EM9A 1VQOP 2KORA 4HTWA 1VQ6P 2JAZA 3LMOA 4INBA 1KC8Q 4J93A 1DV5A 4PH3A 3CC2P 2MD9A
chains in the Genus database with same CATH topology
3CC7P 1QRJA 3RG6C 4GR2A 1L6NA 1A8OA 5F2NA 1VQNP 4E92A 1VQ4P 2XXMA 2X2DD 3DS3A 4LQWC 4U0CA 2QEXP 5DCKA 3P05A 2PWOA 3G28A 4M0IA 1VQ9P 1VQ8P 3E2DA 2PEMA 1JJ2O 2PENA 1KD1Q 4PH0A 4XFYA 4COCA 4U0EA 1VQLP 3B5IA 3H4EA 1GWPA 3CCVP 2M8LA 1YJ9P 1VQPP 2PXRC 4NX4C 2X83A 1E6JP 3I56P 4B4NA 2E1MA 5I4TG 1U7KA 3OW2O 2XT1A 5JPAA 3G0VA 1M9DC 2PEKA 4XFXA 3G1IA 2Z46A 5F2OA 3VRLC 1Q81Q 1N8RQ 5HGKA 1AK4C 2Y4ZA 3MGEA 1YITP 2WLVB 1D1DA 2JO0A 5HGLA 5HGNA 2GOLB 4U0DA 2LF4A 1M1KQ 4DGAC 1M9YC 1A43A 3CCEP 2JPRA 2JYGA 2M8PA 1K8AQ 3CCLP 1BAJA 1KQSO 3CCUP 4QNBA 3DPHA 3NTEA 3G1GA 2GONA 4WYMA 3CMAP 2EIAA 4U0FA 3CCQP 2QA4P 1QVGO 4XRQA 2BUOA 1M6EX 2XGVA 3DS0A 2OTJP 3I55P 4XROA 1VQ5P 2ONTA 5F2KA 1AFVA 3DS5A 2CWOA 1P7NA 1YJNP 1YI2P 2PEJA 2PEOA 3G6EP 1K9MQ 2KODA 4GR6A 2P9XA 2PY8A 3WBHA 3H0DA 3CC4P 3G71P 3BP9A 1M6NA 2PEQA 3CCSP 3CCRP 1S72P 4IPYA 3HYBA 2OTLP 3CD6P 4PH2A 3G26A 2XV6A 3HZQA 3CXCO 2XGUA 3M1MA 1M90Q 2PWMA 4U0BA 1RO0A 2JYLA 3DS2A 1VQMP 1NJIQ 1EOQA 2XDEA 5HGMA 5HGOA 3G29A 3CMEP 1RO2A 2V4XA 1QVFO 2DGYA 1IUQA 3CCJP 1M9XC 1VQKP 2PEIA 1YJWP 5BS1A 3G4SP 1M9EC 1M9CC 4E91A 2EG5A 1YIJP 2WLVA 2X82A 1Q7YQ 1YHQP 2OARA 3DS4A 1RNIA 3Q20A 4PH1A 2EFJA 1AUMA 3DS1A 1M9FC 2Z44A 1W2BO 1EM9A 1K73Q 1ZMBA 4DGEC 4XFZA 4COPA 1M74A 1VQOP 4HTWA 1G03A 2BHVA 1EIAA 2L6EA 1VQ6P 3CPWO 3LRYA 4INBA 3H47A 1KC8Q 4J93A 3G21A 4U0AA 1VQ7P 2M8NA 1Q86Q 4PH3A 2KGFA 2XGYA 2Z45A 5BS2A 3CCMP 3CC2P 3DTJA 1K30A 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRJ A;  1L6N A;  1A8O A;  4E92 A;  2XXM A;  2X2D D;  3DS3 A;  4LQW C;  4U0C A;  5DCK A;  3P05 A;  2PWO A;  3G28 A;  4M0I A;  4PH0 A;  4XFY A;  4COC A;  4U0E A;  3H4E A;  1GWP A;  2M8L A;  2PXR C;  4NX4 C;  2X83 A;  1E6J P;  4B4N A;  5I4T G;  1U7K A;  2XT1 A;  5JPA A;  3G0V A;  1M9D C;  4XFX A;  3G1I A;  3VRL C;  5HGK A;  1AK4 C;  2Y4Z A;  3MGE A;  2WLV B;  1D1D A;  2JO0 A;  5HGL A;  5HGN A;  2GOL B;  4U0D A;  2LF4 A;  4DGA C;  1M9Y C;  1A43 A;  2JPR A;  2JYG A;  2M8P A;  1BAJ A;  4QNB A;  3DPH A;  3NTE A;  3G1G A;  2GON A;  4WYM A;  2EIA A;  4U0F A;  4XRQ A;  2BUO A;  3DS0 A;  2XGV A;  4XRO A;  2ONT A;  1AFV A;  3DS5 A;  1P7N A;  2KOD A;  3BP9 A;  4IPY A;  4PH2 A;  3G26 A;  2XV6 A;  2XGU A;  2PWM A;  4U0B A;  2JYL A;  3DS2 A;  1EOQ A;  2XDE A;  5HGM A;  5HGO A;  3G29 A;  2V4X A;  1M9X C;  1M9E C;  1M9C C;  4E91 A;  2WLV A;  2X82 A;  3DS4 A;  4PH1 A;  1AUM A;  3DS1 A;  1M9F C;  1EM9 A;  4DGE C;  4XFZ A;  4COP A;  4HTW A;  1G03 A;  1EIA A;  2L6E A;  3LRY A;  4INB A;  3H47 A;  4J93 A;  3G21 A;  4U0A A;  2M8N A;  4PH3 A;  2KGF A;  2XGY A;  3DTJ A; 
#chains in the Genus database with same CATH topology
 1QRJ A;  1VQN P;  4E92 A;  2GZF A;  2XXM A;  2LKI A;  3P05 A;  4M0I A;  1VQ9 P;  2PEN A;  1KD1 Q;  4XFY A;  4COC A;  4U0E A;  2K5X A;  3B4Q A;  3CCV P;  1VQP P;  2PXR C;  3I56 P;  1L0I A;  5I4T G;  1U7K A;  1EMV A;  2X2B A;  2XT1 A;  4H2X C;  1Q81 Q;  2FQ2 A;  1YIT P;  2WLV B;  2JO0 A;  2GOL B;  2GZE A;  4NEO A;  2LF4 A;  2N6Y A;  2QNW A;  2VLO A;  4DG9 A;  1A43 A;  1OR5 A;  1BAJ A;  1MZ8 A;  3CCU P;  3DPH A;  1VKU A;  2GON A;  2EIA A;  4BPF A;  2N6Z A;  2BUO A;  2K2Q A;  2OTJ P;  2JU2 A;  5CZD B;  4XRO A;  1UJZ A;  1AFV A;  1P7N A;  2PEJ A;  1K9M Q;  2P9X A;  3H0D A;  4BPG A;  3CCS P;  1S72 P;  2JU1 A;  2KGE A;  4H2W C;  3CD6 P;  4PH2 A;  3G26 A;  2MVV A;  3CXC O;  2JBG A;  2PWM A;  4U0B A;  2JYL A;  1EOQ A;  5HGM A;  5HGO A;  3G29 A;  1RO2 A;  2KOO A;  4H2Y C;  3CCJ P;  1KLP A;  2WLV A;  1Q7Y Q;  2OAR A;  1IMP A;  3Q20 A;  5EW5 E;  1AUM A;  3U43 A;  1K73 Q;  4DGE C;  7CEI A;  2K94 A;  1EIA A;  2L6E A;  2WPT A;  2KGA A;  2FAE A;  2M5R A;  3LRY A;  3H47 A;  3G21 A;  2Z45 A;  2XGY A;  3DTJ A;  1BXI A;  1IMQ A;  2FQ1 A;  4GR2 A;  2N5H A;  5HV8 A;  2CQ8 A;  5DCK A;  2GYK A;  2PWO A;  2PEM A;  2MR8 A;  4PH0 A;  2K93 A;  2KG8 A;  3B5I A;  1GWP A;  3RG2 A;  2CNR A;  2FQ0 A;  5JPA A;  1M9D C;  1N8R Q;  2Z46 A;  3VRL C;  5HGK A;  1AK4 C;  3MGE A;  3CE7 A;  5HGL A;  5HGN A;  3EJE A;  4U0D A;  2K0X A;  2GZI A;  2M8P A;  3CCL P;  2GZG A;  2QA4 P;  4WYM A;  1QVG O;  1M6E X;  2XGV A;  2AFD A;  2VSQ A;  2GDX A;  1VQ5 P;  2ONT A;  1AF8 A;  5F2K A;  3DS5 A;  2VLN A;  1YI2 P;  4BPH A;  3G6E P;  1ACP A;  2GZJ A;  4GR6 A;  3WBH A;  3CC4 P;  2KOQ A;  2OTL P;  3HZQ A;  3GZM A;  1M90 Q;  2PNG A;  1NJI Q;  5EJD A;  1IUQ A;  1M9X C;  4PWV B;  1YJW P;  3G4S P;  1M9C C;  2FHS C;  1YHQ P;  4PH1 A;  2FVF A;  1ZNV A;  1L0H A;  3DS1 A;  2KGC A;  2Z44 A;  1W2B O;  1ZMB A;  4XFZ A;  2KG9 A;  2EHS A;  2L0Q A;  4HKG A;  5KP7 B;  1HQB A;  2M8N A;  1Q86 Q;  2KGF A;  3CCM P;  2GDW A;  4QKO A;  1Q82 Q;  3GZL A;  3RG6 C;  4PXH B;  2L22 A;  2MR7 A;  2KG6 A;  2X2D D;  1X3O A;  4LQW C;  4U0C A;  1NQ4 A;  3G28 A;  3E2D A;  1JJ2 O;  3H4E A;  2FVA A;  2ERH A;  1YJ9 P;  2X83 A;  1E6J P;  2VLQ A;  2KOP A;  2E1M A;  3G0V A;  2K0D X;  1GXH A;  4XFX A;  5F2O A;  3GJN A;  4CA3 A;  1M1K Q;  2FAC A;  1M9Y C;  2JPR A;  1K8A Q;  4QNB A;  3G1G A;  3CCQ P;  4U0F A;  1E0H A;  1YJN P;  4MRT C;  2N50 A;  2KOD A;  1VHN A;  2CGQ A;  2AFE A;  3G71 P;  3BP9 A;  1M6N A;  2PEQ A;  3CCR P;  4IPY A;  1T8K A;  1FR2 A;  2XGU A;  3M1M A;  3DS2 A;  2KOS A;  2V4X A;  1QVF O;  2N98 A;  1VQK P;  4F37 A;  2PEI A;  2JGP A;  2XZ0 D;  2AVA A;  2NO8 A;  2MY5 A;  1CEI A;  1RNI A;  5HVC A;  1M9F C;  2JQ4 A;  2K92 A;  4COP A;  1M74 A;  2ROQ A;  1G03 A;  2BHV A;  2L9F A;  3CPW O;  2N5I A;  1AYI A;  4U0A A;  5BS2 A;  1UNK A;  1DNY A;  2KWL A;  1K30 A;  3CC7 P;  3EJD A;  2KR5 A;  1L6N A;  1A8O A;  5F2N A;  1VQ4 P;  3DS3 A;  2LIU A;  2QEX P;  2VLP A;  2FVE A;  4IZ6 A;  1VQ8 P;  2AF8 A;  1VQL P;  2CG5 B;  2EHT A;  1GXG A;  2M8L A;  2LTE A;  4NX4 C;  4B4N A;  3OW2 O;  5KP8 B;  3GKL C;  2PEK A;  3G1I A;  2FAD A;  2GDY A;  2JB0 A;  2MVU A;  2Y4Z A;  5KP6 B;  1Z6M A;  1D1D A;  4R0M A;  4DGA C;  3CCE P;  2JYG A;  1KQS O;  3NTE A;  1VQ7 P;  3CMA P;  4XRQ A;  3DS0 A;  2XZ1 C;  3I55 P;  4UHP B;  1HY8 A;  2CWO A;  2KGD A;  2PEO A;  3NY7 B;  2PY8 A;  1F80 D;  3HYB A;  2XV6 A;  2LIW A;  1GPJ A;  1RO0 A;  2L4B A;  2LL8 A;  2LML A;  1VQM P;  2XDE A;  3CME P;  2LPK A;  2LOL A;  2DGY A;  2DNW A;  5BS1 A;  1M9E C;  2KW2 A;  4E91 A;  2EG5 A;  1YIJ P;  2X82 A;  3DS4 A;  2EFJ A;  2MF4 A;  2K0Y A;  3EJB A;  1EM9 A;  1VQO P;  2KOR A;  4HTW A;  1VQ6 P;  2JAZ A;  3LMO A;  4INB A;  1KC8 Q;  4J93 A;  1DV5 A;  4PH3 A;  3CC2 P;  2MD9 A; 
#chains in the Genus database with same CATH homology
 3CC7 P;  1QRJ A;  3RG6 C;  4GR2 A;  1L6N A;  1A8O A;  5F2N A;  1VQN P;  4E92 A;  1VQ4 P;  2XXM A;  2X2D D;  3DS3 A;  4LQW C;  4U0C A;  2QEX P;  5DCK A;  3P05 A;  2PWO A;  3G28 A;  4M0I A;  1VQ9 P;  1VQ8 P;  3E2D A;  2PEM A;  1JJ2 O;  2PEN A;  1KD1 Q;  4PH0 A;  4XFY A;  4COC A;  4U0E A;  1VQL P;  3B5I A;  3H4E A;  1GWP A;  3CCV P;  2M8L A;  1YJ9 P;  1VQP P;  2PXR C;  4NX4 C;  2X83 A;  1E6J P;  3I56 P;  4B4N A;  2E1M A;  5I4T G;  1U7K A;  3OW2 O;  2XT1 A;  5JPA A;  3G0V A;  1M9D C;  2PEK A;  4XFX A;  3G1I A;  2Z46 A;  5F2O A;  3VRL C;  1Q81 Q;  1N8R Q;  5HGK A;  1AK4 C;  2Y4Z A;  3MGE A;  1YIT P;  2WLV B;  1D1D A;  2JO0 A;  5HGL A;  5HGN A;  2GOL B;  4U0D A;  2LF4 A;  1M1K Q;  4DGA C;  1M9Y C;  1A43 A;  3CCE P;  2JPR A;  2JYG A;  2M8P A;  1K8A Q;  3CCL P;  1BAJ A;  1KQS O;  3CCU P;  4QNB A;  3DPH A;  3NTE A;  3G1G A;  2GON A;  4WYM A;  3CMA P;  2EIA A;  4U0F A;  3CCQ P;  2QA4 P;  1QVG O;  4XRQ A;  2BUO A;  1M6E X;  2XGV A;  3DS0 A;  2OTJ P;  3I55 P;  4XRO A;  1VQ5 P;  2ONT A;  5F2K A;  1AFV A;  3DS5 A;  2CWO A;  1P7N A;  1YJN P;  1YI2 P;  2PEJ A;  2PEO A;  3G6E P;  1K9M Q;  2KOD A;  4GR6 A;  2P9X A;  2PY8 A;  3WBH A;  3H0D A;  3CC4 P;  3G71 P;  3BP9 A;  1M6N A;  2PEQ A;  3CCS P;  3CCR P;  1S72 P;  4IPY A;  3HYB A;  2OTL P;  3CD6 P;  4PH2 A;  3G26 A;  2XV6 A;  3HZQ A;  3CXC O;  2XGU A;  3M1M A;  1M90 Q;  2PWM A;  4U0B A;  1RO0 A;  2JYL A;  3DS2 A;  1VQM P;  1NJI Q;  1EOQ A;  2XDE A;  5HGM A;  5HGO A;  3G29 A;  3CME P;  1RO2 A;  2V4X A;  1QVF O;  2DGY A;  1IUQ A;  3CCJ P;  1M9X C;  1VQK P;  2PEI A;  1YJW P;  5BS1 A;  3G4S P;  1M9E C;  1M9C C;  4E91 A;  2EG5 A;  1YIJ P;  2WLV A;  2X82 A;  1Q7Y Q;  1YHQ P;  2OAR A;  3DS4 A;  1RNI A;  3Q20 A;  4PH1 A;  2EFJ A;  1AUM A;  3DS1 A;  1M9F C;  2Z44 A;  1W2B O;  1EM9 A;  1K73 Q;  1ZMB A;  4DGE C;  4XFZ A;  4COP A;  1M74 A;  1VQO P;  4HTW A;  1G03 A;  2BHV A;  1EIA A;  2L6E A;  1VQ6 P;  3CPW O;  3LRY A;  4INB A;  3H47 A;  1KC8 Q;  4J93 A;  3G21 A;  4U0A A;  1VQ7 P;  2M8N A;  1Q86 Q;  4PH3 A;  2KGF A;  2XGY A;  2Z45 A;  5BS2 A;  3CCM P;  3CC2 P;  3DTJ A;  1K30 A;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...