4XFXA

Structure of the native full-length hiv-1 capsid protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
216
Chain Sequence
b'PIVQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 74
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfxA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfxA02
2PWOA 3G28A 4E92A 4E91A 2GONA 3G29A 1EM9A 2EIAA 2M8NA 2Y4ZA 4PH1A 1M9XC 2X2DD 1AFVA 1M9DC 4U0CA 4M0IA 4XFXA 4PH2A 2V4XA 3VRLC 5HGLA 2JPRA 1G03A 3DTJA 3LRYA 4B4NA 2KGFA 4PH0A 1EIAA 1D1DA 4U0FA 4U0DA 2WLVB 3H4EA 3DS4A 1E6JP 4DGEC 3DS0A 3G1GA 5JPAA 1U7KA 2WLVA 2XDEA 4XRQA 3DPHA 2X82A 2XT1A 2M8LA 3NTEA 1L6NA 1A43A 4DGAC 4COPA 2X83A 4J93A 3G0VA 2JYLA 2JO0A 3DS5A 5HGKA 1A8OA 5DCKA 1GWPA 1M9FC 4COCA 4HTWA 1M9YC 5HGOA 4IPYA 2PXRC 3G26A 4PH3A 2LF4A 2XGUA 1M9EC 4LQWC 3P05A 2ONTA 3G21A 3MGEA 5HGMA 2KODA 1BAJA 3DS3A 4U0BA 4U0EA 4U0AA 5HGNA 1M9CC 2XGVA 1QRJA 2XV6A 1P7NA 4XROA 2M8PA 1EOQA 3BP9A 1AK4C 2GOLB 2BUOA 3G1IA 4WYMA 4XFYA 1AUMA 4NX4C 2XXMA 2JYGA 3DS1A 3H47A 4QNBA 5I4TG 4XFZA 2L6EA 2XGYA 3DS2A 2PWMA 4INBA
chains in the Genus database with same CATH superfamily
3G28A 4E91A 2GONA 2N6YA 1EM9A 2N50A 2K93A 2EHTA 2CNRA 2GZEA 1VQ4P 2MR8A 2L4BA 2FQ1A 1DNYA 2N5HA 1YHQP 3G71P 1EMVA 5KP8B 4DG9A 3VRLC 2FVFA 2FVEA 3G4SP 1YIJP 1Q86Q 1L0HA 1D1DA 2KORA 3NY7B 3H4EA 2EHSA 1JJ2O 1VQMP 2JQ4A 2KW2A 2KWLA 1AF8A 3DS4A 2MVUA 1ZMBA 1U7KA 2XZ1C 3DPHA 2X82A 1YITP 2M8LA 1GPJA 4DGAC 4COPA 2K0DX 3HZQA 2KR5A 3GZLA 4J93A 1YI2P 2KGAA 2K94A 3RG6C 2JO0A 5EW5E 5HGKA 1YJNP 1M9FC 2PXRC 3CCEP 4U0EA 2JGPA 1Z6MA 2VLQA 3GZMA 2DGYA 1EOQA 2PNGA 4BPHA 2LIUA 2KGEA 2N98A 2NO8A 1HQBA 4XFYA 2PEJA 1VQ6P 2K5XA 1YJ9P 1N8RQ 2WPTA 2LMLA 3DS2A 2FADA 3CMAP 4CA3A 1VQ5P 1GXHA 2FVAA 2EIAA 1HY8A 3G6EP 2FAEA 3H0DA 5CZDB 1M9XC 2N6ZA 1VQ7P 2KG9A 1Q7YQ 1M9DC 2KG8A 3CCVP 2K0YA 2Z44A 2L22A 1QVFO 1F80D 1NJIQ 2EG5A 5HGLA 2JPRA 4BPFA 3EJDA 3DTJA 3LRYA 2KGFA 3CCUP 3EJBA 2LPKA 2WLVB 2EFJA 4BPGA 5BS1A 2K92A 2JU1A 5BS2A 1X3OA 1T8KA 1RO0A 3G1GA 2QNWA 2P9XA 2MF4A 3RG2A 2JB0A 1QVGO 1A43A 3G0VA 3EJEA 4GR6A 2JYLA 3CCLP 3I55P 5HV8A 2AFDA 1GWPA 4COCA 1M9YC 5HGOA 4IPYA 1KLPA 1VQ9P 4PH3A 2XGUA 2CWOA 2ONTA 3CCSP 5HGMA 4PWVB 2GZIA 1M9CC 2XGVA 3B5IA 1KQSO 1S72P 2LOLA 1IUQA 1P7NA 2QA4P 2QEXP 3I56P 1AK4C 2GOLB 1VHNA 2PEIA 1UNKA 2GZJA 1VQKP 4WYMA 1VQPP 4H2XC 1E0HA 1RO2A 3CMEP 1UJZA 2Z45A 1VQLP 2GDXA 1YJWP 2L6EA 2GZGA 2XGYA 2CGQA 2PWMA 5EJDA 2PY8A 2CG5B 4E92A 2PEQA 3HYBA 2OTLP 2KOSA 4PH1A 2MVVA 4H2YC 1K73Q 2JBGA 4XFXA 4PH2A 7CEIA 2GDWA 2GDYA 2V4XA 2KOPA 1M6NA 3CD6P 2LL8A 2KG6A 1G03A 4B4NA 4PH0A 4HKGA 4GR2A 4U0DA 1K8AQ 2FHSC 1M90Q 1VKUA 1GXGA 2AVAA 2PENA 4DGEC 1M6EX 1W2BO 2K2QA 1L0IA 3GJNA 1L6NA 3NTEA 4PXHB 2FQ0A 2X83A 2PEMA 1M1KQ 2OARA 1Q81Q 2JAZA 3CPWO 2L9FA 5DCKA 4H2WC 2PEOA 1K30A 3G26A 3CE7A 2LF4A 4LQWC 3P05A 1MZ8A 1NQ4A 4MRTC 2AF8A 1BAJA 1VQNP 3GKLC 4U0BA 4U0AA 5HGNA 3CCJP 3CC2P 4XROA 5HVCA 2VSQA 2KOOA 5F2OA 1AUMA 3B4QA 2XXMA 2VLNA 3OW2O 4NEOA 3H47A 1KD1Q 2Z46A 4QNBA 4XFZA 3WBHA 3E2DA 2PEKA 2PWOA 2K0XA 3G29A 1OR5A 2M8NA 2Y4ZA 2VLOA 1DV5A 4IZ6A 2X2DD 1AFVA 2BHVA 4U0CA 4M0IA 2E1MA 1M74A 1Q82Q 2KOQA 5KP7B 2KGDA 3M1MA 3U43A 1AYIA 2VLPA 1FR2A 1EIAA 2FACA 4U0FA 3CCMP 1VQOP 4F37A 1BXIA 1KC8Q 2GZFA 1E6JP 1IMQA 1ZNVA 3DS0A 5JPAA 2WLVA 2AFEA 2XDEA 4XRQA 3CC4P 1ACPA 3CCRP 2XT1A 1IMPA 4R0MA 3CXCO 3CCQP 2DNWA 2LIWA 2OTJP 2N5IA 2ERHA 3DS5A 2JU2A 2LKIA 2CQ8A 2MD9A 1A8OA 5F2KA 4HTWA 2GYKA 2MR7A 1M9EC 2ROQA 3G21A 3MGEA 3Q20A 2KODA 2XZ0D 3DS3A 1RNIA 1K9MQ 2M5RA 1QRJA 2XV6A 4QKOA 5KP6B 2X2BA 3LMOA 1VQ8P 2KGCA 2M8PA 3BP9A 2L0QA 1CEIA 2LTEA 2BUOA 3G1IA 4NX4C 2JYGA 4UHPB 2MY5A 3DS1A 5I4TG 3CC7P 5F2NA 2FQ2A 4INBA
chains in the Genus database with same CATH topology
2PWOA 3G28A 3CMAP 1VQ5P 4E92A 4E91A 2GONA 3G29A 1EM9A 2EIAA 2M8NA 3G6EP 2PEQA 3HYBA 1VQ4P 2OTLP 3H0DA 2Y4ZA 4PH1A 1M9XC 1VQ7P 1Q7YQ 2X2DD 1AFVA 1K73Q 2BHVA 1M9DC 1YHQP 4U0CA 4M0IA 3CCVP 3G71P 2E1MA 4XFXA 2Z44A 4PH2A 1QVFO 1M74A 1Q82Q 2V4XA 1NJIQ 3VRLC 2EG5A 5HGLA 2JPRA 3M1MA 1M6NA 3CD6P 1G03A 3DTJA 3LRYA 4B4NA 3G4SP 1YIJP 2KGFA 3CCUP 1Q86Q 4PH0A 1EIAA 4GR2A 1D1DA 4U0FA 4U0DA 1K8AQ 2WLVB 3H4EA 2EFJA 1JJ2O 5BS1A 3CCMP 1VQMP 1VQOP 1M90Q 5BS2A 1KC8Q 1RO0A 3DS4A 1E6JP 4DGEC 2PENA 3DS0A 1M6EX 1ZMBA 3G1GA 5JPAA 1W2BO 1U7KA 2WLVA 2PEKA 2XDEA 4XRQA 2P9XA 3DPHA 2X82A 3CC4P 1YITP 3CCRP 2XT1A 1QVGO 2M8LA 3NTEA 1L6NA 3CXCO 1A43A 4DGAC 3CCQP 4COPA 3HZQA 2X83A 2PEMA 1M1KQ 4J93A 2OARA 3G0VA 1YI2P 1Q81Q 4GR6A 2OTJP 2JYLA 3CCLP 3RG6C 2JO0A 3DS5A 5HGKA 3I55P 3CPWO 1YJNP 1A8OA 5DCKA 5F2KA 1GWPA 1M9FC 4COCA 4HTWA 2PEOA 1M9YC 5HGOA 1K30A 4IPYA 2PXRC 3G26A 1VQ9P 4PH3A 2LF4A 2XGUA 1M9EC 4LQWC 3P05A 2CWOA 2ONTA 3CCEP 3G21A 3MGEA 3Q20A 5HGMA 2KODA 3CCSP 1BAJA 1VQNP 3DS3A 4U0BA 4U0EA 4U0AA 1RNIA 5HGNA 1K9MQ 1M9CC 2XGVA 3B5IA 1KQSO 1QRJA 1S72P 2DGYA 2XV6A 3CCJP 1IUQA 3CC2P 1P7NA 4XROA 1VQ8P 2M8PA 1EOQA 2QEXP 3BP9A 2QA4P 3I56P 1AK4C 2GOLB 2PEIA 2BUOA 3G1IA 1VQKP 4WYMA 1VQPP 5F2OA 4XFYA 1AUMA 4NX4C 1RO2A 2XXMA 3CMEP 3OW2O 2JYGA 2Z45A 1VQLP 2PEJA 3DS1A 3H47A 1KD1Q 1VQ6P 2Z46A 4QNBA 5I4TG 3CC7P 1YJ9P 1N8RQ 5F2NA 1YJWP 4XFZA 2L6EA 3E2DA 3WBHA 2XGYA 3DS2A 2PWMA 4INBA 2PY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PWO A;  3G28 A;  4E92 A;  4E91 A;  2GON A;  3G29 A;  1EM9 A;  2EIA A;  2M8N A;  2Y4Z A;  4PH1 A;  1M9X C;  2X2D D;  1AFV A;  1M9D C;  4U0C A;  4M0I A;  4XFX A;  4PH2 A;  2V4X A;  3VRL C;  5HGL A;  2JPR A;  1G03 A;  3DTJ A;  3LRY A;  4B4N A;  2KGF A;  4PH0 A;  1EIA A;  1D1D A;  4U0F A;  4U0D A;  2WLV B;  3H4E A;  3DS4 A;  1E6J P;  4DGE C;  3DS0 A;  3G1G A;  5JPA A;  1U7K A;  2WLV A;  2XDE A;  4XRQ A;  3DPH A;  2X82 A;  2XT1 A;  2M8L A;  3NTE A;  1L6N A;  1A43 A;  4DGA C;  4COP A;  2X83 A;  4J93 A;  3G0V A;  2JYL A;  2JO0 A;  3DS5 A;  5HGK A;  1A8O A;  5DCK A;  1GWP A;  1M9F C;  4COC A;  4HTW A;  1M9Y C;  5HGO A;  4IPY A;  2PXR C;  3G26 A;  4PH3 A;  2LF4 A;  2XGU A;  1M9E C;  4LQW C;  3P05 A;  2ONT A;  3G21 A;  3MGE A;  5HGM A;  2KOD A;  1BAJ A;  3DS3 A;  4U0B A;  4U0E A;  4U0A A;  5HGN A;  1M9C C;  2XGV A;  1QRJ A;  2XV6 A;  1P7N A;  4XRO A;  2M8P A;  1EOQ A;  3BP9 A;  1AK4 C;  2GOL B;  2BUO A;  3G1I A;  4WYM A;  4XFY A;  1AUM A;  4NX4 C;  2XXM A;  2JYG A;  3DS1 A;  3H47 A;  4QNB A;  5I4T G;  4XFZ A;  2L6E A;  2XGY A;  3DS2 A;  2PWM A;  4INB A; 
#chains in the Genus database with same CATH topology
 3G28 A;  4E91 A;  2GON A;  2N6Y A;  1EM9 A;  2N50 A;  2K93 A;  2EHT A;  2CNR A;  2GZE A;  1VQ4 P;  2MR8 A;  2L4B A;  2FQ1 A;  1DNY A;  2N5H A;  1YHQ P;  3G71 P;  1EMV A;  5KP8 B;  4DG9 A;  3VRL C;  2FVF A;  2FVE A;  3G4S P;  1YIJ P;  1Q86 Q;  1L0H A;  1D1D A;  2KOR A;  3NY7 B;  3H4E A;  2EHS A;  1JJ2 O;  1VQM P;  2JQ4 A;  2KW2 A;  2KWL A;  1AF8 A;  3DS4 A;  2MVU A;  1ZMB A;  1U7K A;  2XZ1 C;  3DPH A;  2X82 A;  1YIT P;  2M8L A;  1GPJ A;  4DGA C;  4COP A;  2K0D X;  3HZQ A;  2KR5 A;  3GZL A;  4J93 A;  1YI2 P;  2KGA A;  2K94 A;  3RG6 C;  2JO0 A;  5EW5 E;  5HGK A;  1YJN P;  1M9F C;  2PXR C;  3CCE P;  4U0E A;  2JGP A;  1Z6M A;  2VLQ A;  3GZM A;  2DGY A;  1EOQ A;  2PNG A;  4BPH A;  2LIU A;  2KGE A;  2N98 A;  2NO8 A;  1HQB A;  4XFY A;  2PEJ A;  1VQ6 P;  2K5X A;  1YJ9 P;  1N8R Q;  2WPT A;  2LML A;  3DS2 A;  2FAD A;  3CMA P;  4CA3 A;  1VQ5 P;  1GXH A;  2FVA A;  2EIA A;  1HY8 A;  3G6E P;  2FAE A;  3H0D A;  5CZD B;  1M9X C;  2N6Z A;  1VQ7 P;  2KG9 A;  1Q7Y Q;  1M9D C;  2KG8 A;  3CCV P;  2K0Y A;  2Z44 A;  2L22 A;  1QVF O;  1F80 D;  1NJI Q;  2EG5 A;  5HGL A;  2JPR A;  4BPF A;  3EJD A;  3DTJ A;  3LRY A;  2KGF A;  3CCU P;  3EJB A;  2LPK A;  2WLV B;  2EFJ A;  4BPG A;  5BS1 A;  2K92 A;  2JU1 A;  5BS2 A;  1X3O A;  1T8K A;  1RO0 A;  3G1G A;  2QNW A;  2P9X A;  2MF4 A;  3RG2 A;  2JB0 A;  1QVG O;  1A43 A;  3G0V A;  3EJE A;  4GR6 A;  2JYL A;  3CCL P;  3I55 P;  5HV8 A;  2AFD A;  1GWP A;  4COC A;  1M9Y C;  5HGO A;  4IPY A;  1KLP A;  1VQ9 P;  4PH3 A;  2XGU A;  2CWO A;  2ONT A;  3CCS P;  5HGM A;  4PWV B;  2GZI A;  1M9C C;  2XGV A;  3B5I A;  1KQS O;  1S72 P;  2LOL A;  1IUQ A;  1P7N A;  2QA4 P;  2QEX P;  3I56 P;  1AK4 C;  2GOL B;  1VHN A;  2PEI A;  1UNK A;  2GZJ A;  1VQK P;  4WYM A;  1VQP P;  4H2X C;  1E0H A;  1RO2 A;  3CME P;  1UJZ A;  2Z45 A;  1VQL P;  2GDX A;  1YJW P;  2L6E A;  2GZG A;  2XGY A;  2CGQ A;  2PWM A;  5EJD A;  2PY8 A;  2CG5 B;  4E92 A;  2PEQ A;  3HYB A;  2OTL P;  2KOS A;  4PH1 A;  2MVV A;  4H2Y C;  1K73 Q;  2JBG A;  4XFX A;  4PH2 A;  7CEI A;  2GDW A;  2GDY A;  2V4X A;  2KOP A;  1M6N A;  3CD6 P;  2LL8 A;  2KG6 A;  1G03 A;  4B4N A;  4PH0 A;  4HKG A;  4GR2 A;  4U0D A;  1K8A Q;  2FHS C;  1M90 Q;  1VKU A;  1GXG A;  2AVA A;  2PEN A;  4DGE C;  1M6E X;  1W2B O;  2K2Q A;  1L0I A;  3GJN A;  1L6N A;  3NTE A;  4PXH B;  2FQ0 A;  2X83 A;  2PEM A;  1M1K Q;  2OAR A;  1Q81 Q;  2JAZ A;  3CPW O;  2L9F A;  5DCK A;  4H2W C;  2PEO A;  1K30 A;  3G26 A;  3CE7 A;  2LF4 A;  4LQW C;  3P05 A;  1MZ8 A;  1NQ4 A;  4MRT C;  2AF8 A;  1BAJ A;  1VQN P;  3GKL C;  4U0B A;  4U0A A;  5HGN A;  3CCJ P;  3CC2 P;  4XRO A;  5HVC A;  2VSQ A;  2KOO A;  5F2O A;  1AUM A;  3B4Q A;  2XXM A;  2VLN A;  3OW2 O;  4NEO A;  3H47 A;  1KD1 Q;  2Z46 A;  4QNB A;  4XFZ A;  3WBH A;  3E2D A;  2PEK A;  2PWO A;  2K0X A;  3G29 A;  1OR5 A;  2M8N A;  2Y4Z A;  2VLO A;  1DV5 A;  4IZ6 A;  2X2D D;  1AFV A;  2BHV A;  4U0C A;  4M0I A;  2E1M A;  1M74 A;  1Q82 Q;  2KOQ A;  5KP7 B;  2KGD A;  3M1M A;  3U43 A;  1AYI A;  2VLP A;  1FR2 A;  1EIA A;  2FAC A;  4U0F A;  3CCM P;  1VQO P;  4F37 A;  1BXI A;  1KC8 Q;  2GZF A;  1E6J P;  1IMQ A;  1ZNV A;  3DS0 A;  5JPA A;  2WLV A;  2AFE A;  2XDE A;  4XRQ A;  3CC4 P;  1ACP A;  3CCR P;  2XT1 A;  1IMP A;  4R0M A;  3CXC O;  3CCQ P;  2DNW A;  2LIW A;  2OTJ P;  2N5I A;  2ERH A;  3DS5 A;  2JU2 A;  2LKI A;  2CQ8 A;  2MD9 A;  1A8O A;  5F2K A;  4HTW A;  2GYK A;  2MR7 A;  1M9E C;  2ROQ A;  3G21 A;  3MGE A;  3Q20 A;  2KOD A;  2XZ0 D;  3DS3 A;  1RNI A;  1K9M Q;  2M5R A;  1QRJ A;  2XV6 A;  4QKO A;  5KP6 B;  2X2B A;  3LMO A;  1VQ8 P;  2KGC A;  2M8P A;  3BP9 A;  2L0Q A;  1CEI A;  2LTE A;  2BUO A;  3G1I A;  4NX4 C;  2JYG A;  4UHP B;  2MY5 A;  3DS1 A;  5I4T G;  3CC7 P;  5F2N A;  2FQ2 A;  4INB A; 
#chains in the Genus database with same CATH homology
 2PWO A;  3G28 A;  3CMA P;  1VQ5 P;  4E92 A;  4E91 A;  2GON A;  3G29 A;  1EM9 A;  2EIA A;  2M8N A;  3G6E P;  2PEQ A;  3HYB A;  1VQ4 P;  2OTL P;  3H0D A;  2Y4Z A;  4PH1 A;  1M9X C;  1VQ7 P;  1Q7Y Q;  2X2D D;  1AFV A;  1K73 Q;  2BHV A;  1M9D C;  1YHQ P;  4U0C A;  4M0I A;  3CCV P;  3G71 P;  2E1M A;  4XFX A;  2Z44 A;  4PH2 A;  1QVF O;  1M74 A;  1Q82 Q;  2V4X A;  1NJI Q;  3VRL C;  2EG5 A;  5HGL A;  2JPR A;  3M1M A;  1M6N A;  3CD6 P;  1G03 A;  3DTJ A;  3LRY A;  4B4N A;  3G4S P;  1YIJ P;  2KGF A;  3CCU P;  1Q86 Q;  4PH0 A;  1EIA A;  4GR2 A;  1D1D A;  4U0F A;  4U0D A;  1K8A Q;  2WLV B;  3H4E A;  2EFJ A;  1JJ2 O;  5BS1 A;  3CCM P;  1VQM P;  1VQO P;  1M90 Q;  5BS2 A;  1KC8 Q;  1RO0 A;  3DS4 A;  1E6J P;  4DGE C;  2PEN A;  3DS0 A;  1M6E X;  1ZMB A;  3G1G A;  5JPA A;  1W2B O;  1U7K A;  2WLV A;  2PEK A;  2XDE A;  4XRQ A;  2P9X A;  3DPH A;  2X82 A;  3CC4 P;  1YIT P;  3CCR P;  2XT1 A;  1QVG O;  2M8L A;  3NTE A;  1L6N A;  3CXC O;  1A43 A;  4DGA C;  3CCQ P;  4COP A;  3HZQ A;  2X83 A;  2PEM A;  1M1K Q;  4J93 A;  2OAR A;  3G0V A;  1YI2 P;  1Q81 Q;  4GR6 A;  2OTJ P;  2JYL A;  3CCL P;  3RG6 C;  2JO0 A;  3DS5 A;  5HGK A;  3I55 P;  3CPW O;  1YJN P;  1A8O A;  5DCK A;  5F2K A;  1GWP A;  1M9F C;  4COC A;  4HTW A;  2PEO A;  1M9Y C;  5HGO A;  1K30 A;  4IPY A;  2PXR C;  3G26 A;  1VQ9 P;  4PH3 A;  2LF4 A;  2XGU A;  1M9E C;  4LQW C;  3P05 A;  2CWO A;  2ONT A;  3CCE P;  3G21 A;  3MGE A;  3Q20 A;  5HGM A;  2KOD A;  3CCS P;  1BAJ A;  1VQN P;  3DS3 A;  4U0B A;  4U0E A;  4U0A A;  1RNI A;  5HGN A;  1K9M Q;  1M9C C;  2XGV A;  3B5I A;  1KQS O;  1QRJ A;  1S72 P;  2DGY A;  2XV6 A;  3CCJ P;  1IUQ A;  3CC2 P;  1P7N A;  4XRO A;  1VQ8 P;  2M8P A;  1EOQ A;  2QEX P;  3BP9 A;  2QA4 P;  3I56 P;  1AK4 C;  2GOL B;  2PEI A;  2BUO A;  3G1I A;  1VQK P;  4WYM A;  1VQP P;  5F2O A;  4XFY A;  1AUM A;  4NX4 C;  1RO2 A;  2XXM A;  3CME P;  3OW2 O;  2JYG A;  2Z45 A;  1VQL P;  2PEJ A;  3DS1 A;  3H47 A;  1KD1 Q;  1VQ6 P;  2Z46 A;  4QNB A;  5I4T G;  3CC7 P;  1YJ9 P;  1N8R Q;  5F2N A;  1YJW P;  4XFZ A;  2L6E A;  3E2D A;  3WBH A;  2XGY A;  3DS2 A;  2PWM A;  4INB A;  2PY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...