4XFXA

Structure of the native full-length hiv-1 capsid protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
216
Chain Sequence
PIVQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
total genus 74
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfxA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfxA02
1BAJA 2WLVB 2XXMA 1M9EC 5JPAA 3G21A 4E92A 3LRYA 5HGMA 4XFXA 2JPRA 4PH0A 4E91A 3G29A 2M8NA 4XFZA 3G1GA 1EM9A 4U0CA 3DS0A 2GOLB 3DPHA 3G26A 1M9XC 1AFVA 2M8LA 2X83A 5HGLA 5DCKA 4M0IA 2PXRC 3H47A 2X82A 1EIAA 4COCA 4XROA 2PWOA 3DTJA 3G0VA 3G1IA 1G03A 5HGOA 4INBA 3DS5A 4XFYA 5HGKA 2PWMA 1QRJA 1A8OA 4NX4C 3G28A 5I4TG 1M9CC 1GWPA 2V4XA 2KODA 3VRLC 1D1DA 5HGNA 4PH2A 2BUOA 1L6NA 3DS4A 2ONTA 4COPA 1P7NA 4U0EA 4XRQA 4U0BA 2JYLA 2JYGA 4U0DA 4QNBA 3MGEA 4B4NA 2XT1A 4PH3A 2JO0A 2XGYA 2XDEA 3NTEA 3DS3A 3DS1A 4PH1A 4U0FA 2GONA 4DGAC 1EOQA 2XV6A 4U0AA 4IPYA 1M9YC 1M9DC 3H4EA 2WLVA 1U7KA 4LQWC 2LF4A 3P05A 2L6EA 4WYMA 2XGUA 4HTWA 1M9FC 2EIAA 3DS2A 2X2DD 2Y4ZA 1AUMA 3BP9A 1AK4C 4DGEC 1A43A 2M8PA 1E6JP 2KGFA 4J93A 2XGVA
chains in the Genus database with same CATH superfamily
4DG9A 2WLVB 2XXMA 1M9EC 2K0YA 1KD1Q 3EJDA 5JPAA 2KG6A 4E92A 2EHSA 2JBGA 2AF8A 2JGPA 2JB0A 1IMQA 2KW2A 2EHTA 3RG2A 1RO2A 4MRTC 1VQKP 5EW5E 2PEJA 1EIAA 1YHQP 2FACA 2PWOA 2KOPA 1BXIA 2JAZA 3B5IA 2AFEA 1G03A 1ZMBA 4XFYA 2PEQA 3G28A 3EJBA 3WBHA 3EJEA 3VRLC 3NY7B 3I55P 2QA4P 2GYKA 2PY8A 1HY8A 1P7NA 1VQOP 3M1MA 2JU2A 2GZGA 4PH3A 2JO0A 2CGQA 2XGYA 2Z45A 1NJIQ 2PEKA 2PEIA 1K9MQ 1M9DC 3I56P 2E1MA 5HVCA 4LQWC 2CWOA 3P05A 2K0XA 3CCMP 1MZ8A 3GJNA 2EIAA 2LOLA 2VLPA 4PXHB 2ROQA 1YIJP 1AK4C 3CMAP 1Z6MA 4J93A 2VLNA 2MR8A 2LIWA 2XZ0D 2N6YA 1Q7YQ 2JQ4A 4XFXA 2PNGA 4PH0A 1YJWP 1VQLP 3CC7P 3G29A 1IMPA 1Q82Q 1VQ4P 4XFZA 3G1GA 2L9FA 3DS0A 2M5RA 2GOLB 3GZMA 3OW2O 3G26A 2KOQA 2CG5B 1ZNVA 1AF8A 5HGLA 2PXRC 1UNKA 2KOOA 4COCA 2LPKA 1M6NA 5F2KA 2L0QA 2OTLP 5HGOA 1M90Q 2KGEA 3DS5A 2MVVA 3CPWO 4NX4C 2AFDA 5I4TG 4CA3A 1M9CC 2MF4A 2KODA 2L4BA 2GDWA 4PWVB 3CCEP 2X2BA 3GKLC 4COPA 2K5XA 1ACPA 5KP8B 1GXHA 1UJZA 4U0BA 3G4SP 2JYLA 2Z44A 3MGEA 2XT1A 3CD6P 1AYIA 2FQ0A 1L0IA 1VKUA 4QKOA 4BPGA 3DS3A 2QEXP 4IZ6A 4PH1A 5EJDA 1M9YC 1S72P 2PEOA 1U7KA 7CEIA 3CCVP 3E2DA 3DS2A 5HV8A 2X2DD 2Y4ZA 2LTEA 5F2NA 3BP9A 2OARA 2JU1A 2NO8A 1VQNP 3HYBA 1BAJA 4H2WC 2KOSA 3CCRP 4GR2A 2MY5A 1VQ6P 1VHNA 2FQ2A 3G21A 4UHPB 5KP7B 2JPRA 1KLPA 4E91A 3CC4P 2M8NA 3U43A 3HZQA 3Q20A 3CC2P 2KGDA 1FR2A 3GZLA 2DGYA 5CZDB 1GXGA 5KP6B 1K8AQ 2K92A 2KGCA 2N6ZA 1NQ4A 3G0VA 3G1IA 1VQ5P 2PWMA 2GDXA 1QRJA 1A8OA 3CE7A 2KG8A 1VQPP 1GWPA 2V4XA 2K0DX 1D1DA 2K94A 5BS1A 5HGNA 4PH2A 1L6NA 2AVAA 3DS4A 1CEIA 2ONTA 1X3OA 2KR5A 1YJNP 4U0EA 2KGAA 1VQ8P 2FVFA 1T8KA 2PEMA 2QNWA 2VLQA 1VQ9P 4U0DA 4QNBA 2GZIA 1GPJA 2KG9A 2XDEA 2LKIA 1K30A 1RO0A 4BPFA 2K93A 2MD9A 4U0FA 2GONA 4NEOA 4DGAC 3CCQP 2XV6A 1EMVA 1W2BO 2N50A 2L22A 2DNWA 4H2YC 2LIUA 1DNYA 2KWLA 4HTWA 3CMEP 2CQ8A 2N5IA 2FADA 1AUMA 2N5HA 4DGEC 1A43A 1VQ7P 2GZFA 3CCSP 1Q86Q 1M1KQ 2KGFA 2XGVA 4GR6A 1JJ2O 2MR7A 1HQBA 2FHSC 3B4QA 3LRYA 5HGMA 2GZEA 2OTJP 2FVAA 1EM9A 1IUQA 2VSQA 4U0CA 2P9XA 2FAEA 3DPHA 2EFJA 5F2OA 1M9XC 1N8RQ 1YJ9P 1AFVA 2M8LA 2X83A 5DCKA 4M0IA 3H47A 2X82A 1M74A 4XROA 3CXCO 1RNIA 3DTJA 4INBA 3CCJP 5HGKA 1F80D 2MVUA 4F37A 4BPHA 2LMLA 5BS2A 2KORA 4H2XC 2XZ1C 2BUOA 2LL8A 1KC8Q 1E0HA 2VLOA 3CCUP 1M6EX 4XRQA 2JYGA 3CCLP 4B4NA 1DV5A 2CNRA 1K73Q 2FVEA 3NTEA 1Q81Q 3DS1A 3RG6C 3LMOA 2GZJA 1EOQA 2EG5A 1KQSO 4U0AA 4IPYA 1VQMP 2PENA 4R0MA 3H4EA 2WLVA 3H0DA 2LF4A 2Z46A 3G6EP 2L6EA 3G71P 2N98A 4WYMA 2WPTA 2XGUA 1QVFO 1M9FC 1YI2P 1OR5A 2ERHA 2K2QA 2M8PA 2FQ1A 1E6JP 2BHVA 2GDYA 1L0HA 4HKGA 1YITP 1QVGO
chains in the Genus database with same CATH topology
1BAJA 4GR6A 1JJ2O 3CCRP 2WLVB 1Q7YQ 2XXMA 1M9EC 4GR2A 1KD1Q 5JPAA 1VQ6P 3G21A 4E92A 3LRYA 5HGMA 2OTJP 4XFXA 2JPRA 4PH0A 1YJWP 4E91A 3G29A 1VQLP 3CC7P 1Q82Q 2M8NA 3CC4P 1VQ4P 4XFZA 3G1GA 1EM9A 1IUQA 3HZQA 4U0CA 2P9XA 3DS0A 3Q20A 3CC2P 2GOLB 3DPHA 3OW2O 3G26A 2EFJA 2DGYA 5F2OA 1QVGO 1RO2A 1M9XC 1N8RQ 1YJ9P 1AFVA 2M8LA 1VQKP 2X83A 5HGLA 5DCKA 4M0IA 1K8AQ 2PXRC 3H47A 2X82A 2PEJA 1EIAA 1YHQP 1M74A 4COCA 4XROA 3CXCO 2PWOA 1RNIA 1M6NA 5F2KA 3B5IA 3DTJA 3G0VA 3G1IA 1G03A 5HGOA 1ZMBA 4INBA 2OTLP 1M90Q 1VQ5P 3DS5A 4XFYA 5HGKA 2PEQA 2PWMA 3CCJP 1QRJA 1A8OA 3CPWO 4NX4C 3G28A 5I4TG 3WBHA 1M9CC 1GWPA 2V4XA 2KODA 3VRLC 1VQPP 5BS2A 1D1DA 3I55P 5BS1A 5HGNA 4PH2A 2BUOA 3CCEP 2QA4P 2PY8A 1L6NA 3DS4A 2ONTA 4COPA 1KC8Q 1P7NA 1YJNP 4U0EA 1VQOP 3CCUP 1M6EX 1VQ8P 2PEMA 4XRQA 3M1MA 4U0BA 3G4SP 1VQ9P 2JYLA 2JYGA 3CCLP 4U0DA 4QNBA 3MGEA 4B4NA 2XT1A 2Z44A 3CD6P 4PH3A 2JO0A 1K73Q 2XGYA 2XDEA 2Z45A 1NJIQ 3NTEA 3DS3A 1Q81Q 1K30A 1RO0A 3DS1A 3RG6C 2QEXP 4PH1A 4U0FA 2GONA 2PEKA 4DGAC 3CCQP 1EOQA 2EG5A 2XV6A 1KQSO 4U0AA 4IPYA 2PEIA 1M9YC 2PENA 1M9DC 3I56P 1VQMP 1S72P 1W2BO 1K9MQ 2E1MA 2PEOA 3H4EA 2WLVA 3H0DA 1U7KA 4LQWC 2LF4A 2CWOA 3P05A 2Z46A 3G6EP 2L6EA 3G71P 4WYMA 2XGUA 3CCMP 4HTWA 3CMEP 1QVFO 1M9FC 3CCVP 3E2DA 2EIAA 1YI2P 3DS2A 2X2DD 2Y4ZA 1AUMA 5F2NA 3BP9A 2OARA 1YIJP 1AK4C 4DGEC 1A43A 1VQ7P 2M8PA 1E6JP 2BHVA 3CMAP 3CCSP 1Q86Q 1M1KQ 2KGFA 1VQNP 4J93A 1YITP 3HYBA 2XGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAJ A;  2WLV B;  2XXM A;  1M9E C;  5JPA A;  3G21 A;  4E92 A;  3LRY A;  5HGM A;  4XFX A;  2JPR A;  4PH0 A;  4E91 A;  3G29 A;  2M8N A;  4XFZ A;  3G1G A;  1EM9 A;  4U0C A;  3DS0 A;  2GOL B;  3DPH A;  3G26 A;  1M9X C;  1AFV A;  2M8L A;  2X83 A;  5HGL A;  5DCK A;  4M0I A;  2PXR C;  3H47 A;  2X82 A;  1EIA A;  4COC A;  4XRO A;  2PWO A;  3DTJ A;  3G0V A;  3G1I A;  1G03 A;  5HGO A;  4INB A;  3DS5 A;  4XFY A;  5HGK A;  2PWM A;  1QRJ A;  1A8O A;  4NX4 C;  3G28 A;  5I4T G;  1M9C C;  1GWP A;  2V4X A;  2KOD A;  3VRL C;  1D1D A;  5HGN A;  4PH2 A;  2BUO A;  1L6N A;  3DS4 A;  2ONT A;  4COP A;  1P7N A;  4U0E A;  4XRQ A;  4U0B A;  2JYL A;  2JYG A;  4U0D A;  4QNB A;  3MGE A;  4B4N A;  2XT1 A;  4PH3 A;  2JO0 A;  2XGY A;  2XDE A;  3NTE A;  3DS3 A;  3DS1 A;  4PH1 A;  4U0F A;  2GON A;  4DGA C;  1EOQ A;  2XV6 A;  4U0A A;  4IPY A;  1M9Y C;  1M9D C;  3H4E A;  2WLV A;  1U7K A;  4LQW C;  2LF4 A;  3P05 A;  2L6E A;  4WYM A;  2XGU A;  4HTW A;  1M9F C;  2EIA A;  3DS2 A;  2X2D D;  2Y4Z A;  1AUM A;  3BP9 A;  1AK4 C;  4DGE C;  1A43 A;  2M8P A;  1E6J P;  2KGF A;  4J93 A;  2XGV A; 
#chains in the Genus database with same CATH topology
 4DG9 A;  2WLV B;  2XXM A;  1M9E C;  2K0Y A;  1KD1 Q;  3EJD A;  5JPA A;  2KG6 A;  4E92 A;  2EHS A;  2JBG A;  2AF8 A;  2JGP A;  2JB0 A;  1IMQ A;  2KW2 A;  2EHT A;  3RG2 A;  1RO2 A;  4MRT C;  1VQK P;  5EW5 E;  2PEJ A;  1EIA A;  1YHQ P;  2FAC A;  2PWO A;  2KOP A;  1BXI A;  2JAZ A;  3B5I A;  2AFE A;  1G03 A;  1ZMB A;  4XFY A;  2PEQ A;  3G28 A;  3EJB A;  3WBH A;  3EJE A;  3VRL C;  3NY7 B;  3I55 P;  2QA4 P;  2GYK A;  2PY8 A;  1HY8 A;  1P7N A;  1VQO P;  3M1M A;  2JU2 A;  2GZG A;  4PH3 A;  2JO0 A;  2CGQ A;  2XGY A;  2Z45 A;  1NJI Q;  2PEK A;  2PEI A;  1K9M Q;  1M9D C;  3I56 P;  2E1M A;  5HVC A;  4LQW C;  2CWO A;  3P05 A;  2K0X A;  3CCM P;  1MZ8 A;  3GJN A;  2EIA A;  2LOL A;  2VLP A;  4PXH B;  2ROQ A;  1YIJ P;  1AK4 C;  3CMA P;  1Z6M A;  4J93 A;  2VLN A;  2MR8 A;  2LIW A;  2XZ0 D;  2N6Y A;  1Q7Y Q;  2JQ4 A;  4XFX A;  2PNG A;  4PH0 A;  1YJW P;  1VQL P;  3CC7 P;  3G29 A;  1IMP A;  1Q82 Q;  1VQ4 P;  4XFZ A;  3G1G A;  2L9F A;  3DS0 A;  2M5R A;  2GOL B;  3GZM A;  3OW2 O;  3G26 A;  2KOQ A;  2CG5 B;  1ZNV A;  1AF8 A;  5HGL A;  2PXR C;  1UNK A;  2KOO A;  4COC A;  2LPK A;  1M6N A;  5F2K A;  2L0Q A;  2OTL P;  5HGO A;  1M90 Q;  2KGE A;  3DS5 A;  2MVV A;  3CPW O;  4NX4 C;  2AFD A;  5I4T G;  4CA3 A;  1M9C C;  2MF4 A;  2KOD A;  2L4B A;  2GDW A;  4PWV B;  3CCE P;  2X2B A;  3GKL C;  4COP A;  2K5X A;  1ACP A;  5KP8 B;  1GXH A;  1UJZ A;  4U0B A;  3G4S P;  2JYL A;  2Z44 A;  3MGE A;  2XT1 A;  3CD6 P;  1AYI A;  2FQ0 A;  1L0I A;  1VKU A;  4QKO A;  4BPG A;  3DS3 A;  2QEX P;  4IZ6 A;  4PH1 A;  5EJD A;  1M9Y C;  1S72 P;  2PEO A;  1U7K A;  7CEI A;  3CCV P;  3E2D A;  3DS2 A;  5HV8 A;  2X2D D;  2Y4Z A;  2LTE A;  5F2N A;  3BP9 A;  2OAR A;  2JU1 A;  2NO8 A;  1VQN P;  3HYB A;  1BAJ A;  4H2W C;  2KOS A;  3CCR P;  4GR2 A;  2MY5 A;  1VQ6 P;  1VHN A;  2FQ2 A;  3G21 A;  4UHP B;  5KP7 B;  2JPR A;  1KLP A;  4E91 A;  3CC4 P;  2M8N A;  3U43 A;  3HZQ A;  3Q20 A;  3CC2 P;  2KGD A;  1FR2 A;  3GZL A;  2DGY A;  5CZD B;  1GXG A;  5KP6 B;  1K8A Q;  2K92 A;  2KGC A;  2N6Z A;  1NQ4 A;  3G0V A;  3G1I A;  1VQ5 P;  2PWM A;  2GDX A;  1QRJ A;  1A8O A;  3CE7 A;  2KG8 A;  1VQP P;  1GWP A;  2V4X A;  2K0D X;  1D1D A;  2K94 A;  5BS1 A;  5HGN A;  4PH2 A;  1L6N A;  2AVA A;  3DS4 A;  1CEI A;  2ONT A;  1X3O A;  2KR5 A;  1YJN P;  4U0E A;  2KGA A;  1VQ8 P;  2FVF A;  1T8K A;  2PEM A;  2QNW A;  2VLQ A;  1VQ9 P;  4U0D A;  4QNB A;  2GZI A;  1GPJ A;  2KG9 A;  2XDE A;  2LKI A;  1K30 A;  1RO0 A;  4BPF A;  2K93 A;  2MD9 A;  4U0F A;  2GON A;  4NEO A;  4DGA C;  3CCQ P;  2XV6 A;  1EMV A;  1W2B O;  2N50 A;  2L22 A;  2DNW A;  4H2Y C;  2LIU A;  1DNY A;  2KWL A;  4HTW A;  3CME P;  2CQ8 A;  2N5I A;  2FAD A;  1AUM A;  2N5H A;  4DGE C;  1A43 A;  1VQ7 P;  2GZF A;  3CCS P;  1Q86 Q;  1M1K Q;  2KGF A;  2XGV A;  4GR6 A;  1JJ2 O;  2MR7 A;  1HQB A;  2FHS C;  3B4Q A;  3LRY A;  5HGM A;  2GZE A;  2OTJ P;  2FVA A;  1EM9 A;  1IUQ A;  2VSQ A;  4U0C A;  2P9X A;  2FAE A;  3DPH A;  2EFJ A;  5F2O A;  1M9X C;  1N8R Q;  1YJ9 P;  1AFV A;  2M8L A;  2X83 A;  5DCK A;  4M0I A;  3H47 A;  2X82 A;  1M74 A;  4XRO A;  3CXC O;  1RNI A;  3DTJ A;  4INB A;  3CCJ P;  5HGK A;  1F80 D;  2MVU A;  4F37 A;  4BPH A;  2LML A;  5BS2 A;  2KOR A;  4H2X C;  2XZ1 C;  2BUO A;  2LL8 A;  1KC8 Q;  1E0H A;  2VLO A;  3CCU P;  1M6E X;  4XRQ A;  2JYG A;  3CCL P;  4B4N A;  1DV5 A;  2CNR A;  1K73 Q;  2FVE A;  3NTE A;  1Q81 Q;  3DS1 A;  3RG6 C;  3LMO A;  2GZJ A;  1EOQ A;  2EG5 A;  1KQS O;  4U0A A;  4IPY A;  1VQM P;  2PEN A;  4R0M A;  3H4E A;  2WLV A;  3H0D A;  2LF4 A;  2Z46 A;  3G6E P;  2L6E A;  3G71 P;  2N98 A;  4WYM A;  2WPT A;  2XGU A;  1QVF O;  1M9F C;  1YI2 P;  1OR5 A;  2ERH A;  2K2Q A;  2M8P A;  2FQ1 A;  1E6J P;  2BHV A;  2GDY A;  1L0H A;  4HKG A;  1YIT P;  1QVG O; 
#chains in the Genus database with same CATH homology
 1BAJ A;  4GR6 A;  1JJ2 O;  3CCR P;  2WLV B;  1Q7Y Q;  2XXM A;  1M9E C;  4GR2 A;  1KD1 Q;  5JPA A;  1VQ6 P;  3G21 A;  4E92 A;  3LRY A;  5HGM A;  2OTJ P;  4XFX A;  2JPR A;  4PH0 A;  1YJW P;  4E91 A;  3G29 A;  1VQL P;  3CC7 P;  1Q82 Q;  2M8N A;  3CC4 P;  1VQ4 P;  4XFZ A;  3G1G A;  1EM9 A;  1IUQ A;  3HZQ A;  4U0C A;  2P9X A;  3DS0 A;  3Q20 A;  3CC2 P;  2GOL B;  3DPH A;  3OW2 O;  3G26 A;  2EFJ A;  2DGY A;  5F2O A;  1QVG O;  1RO2 A;  1M9X C;  1N8R Q;  1YJ9 P;  1AFV A;  2M8L A;  1VQK P;  2X83 A;  5HGL A;  5DCK A;  4M0I A;  1K8A Q;  2PXR C;  3H47 A;  2X82 A;  2PEJ A;  1EIA A;  1YHQ P;  1M74 A;  4COC A;  4XRO A;  3CXC O;  2PWO A;  1RNI A;  1M6N A;  5F2K A;  3B5I A;  3DTJ A;  3G0V A;  3G1I A;  1G03 A;  5HGO A;  1ZMB A;  4INB A;  2OTL P;  1M90 Q;  1VQ5 P;  3DS5 A;  4XFY A;  5HGK A;  2PEQ A;  2PWM A;  3CCJ P;  1QRJ A;  1A8O A;  3CPW O;  4NX4 C;  3G28 A;  5I4T G;  3WBH A;  1M9C C;  1GWP A;  2V4X A;  2KOD A;  3VRL C;  1VQP P;  5BS2 A;  1D1D A;  3I55 P;  5BS1 A;  5HGN A;  4PH2 A;  2BUO A;  3CCE P;  2QA4 P;  2PY8 A;  1L6N A;  3DS4 A;  2ONT A;  4COP A;  1KC8 Q;  1P7N A;  1YJN P;  4U0E A;  1VQO P;  3CCU P;  1M6E X;  1VQ8 P;  2PEM A;  4XRQ A;  3M1M A;  4U0B A;  3G4S P;  1VQ9 P;  2JYL A;  2JYG A;  3CCL P;  4U0D A;  4QNB A;  3MGE A;  4B4N A;  2XT1 A;  2Z44 A;  3CD6 P;  4PH3 A;  2JO0 A;  1K73 Q;  2XGY A;  2XDE A;  2Z45 A;  1NJI Q;  3NTE A;  3DS3 A;  1Q81 Q;  1K30 A;  1RO0 A;  3DS1 A;  3RG6 C;  2QEX P;  4PH1 A;  4U0F A;  2GON A;  2PEK A;  4DGA C;  3CCQ P;  1EOQ A;  2EG5 A;  2XV6 A;  1KQS O;  4U0A A;  4IPY A;  2PEI A;  1M9Y C;  2PEN A;  1M9D C;  3I56 P;  1VQM P;  1S72 P;  1W2B O;  1K9M Q;  2E1M A;  2PEO A;  3H4E A;  2WLV A;  3H0D A;  1U7K A;  4LQW C;  2LF4 A;  2CWO A;  3P05 A;  2Z46 A;  3G6E P;  2L6E A;  3G71 P;  4WYM A;  2XGU A;  3CCM P;  4HTW A;  3CME P;  1QVF O;  1M9F C;  3CCV P;  3E2D A;  2EIA A;  1YI2 P;  3DS2 A;  2X2D D;  2Y4Z A;  1AUM A;  5F2N A;  3BP9 A;  2OAR A;  1YIJ P;  1AK4 C;  4DGE C;  1A43 A;  1VQ7 P;  2M8P A;  1E6J P;  2BHV A;  3CMA P;  3CCS P;  1Q86 Q;  1M1K Q;  2KGF A;  1VQN P;  4J93 A;  1YIT P;  3HYB A;  2XGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...