4U0AA

Hexameric hiv-1 ca in complex with cpsf6 peptide, p6 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 70
structure length 208
sequence length 220
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0aA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0aA02
3BP9A 2PWOA 3G26A 4IPYA 2LF4A 3MGEA 1GWPA 4HTWA 3G21A 4U0BA 3DPHA 4U0DA 1D1DA 1E6JP 3DS2A 2M8PA 1G03A 2V4XA 4QNBA 1A43A 4XFZA 2BUOA 4DGEC 3DS0A 4E92A 2JO0A 4INBA 5HGOA 3G29A 3DS3A 3H47A 5DCKA 2KGFA 4M0IA 4U0EA 4PH3A 2XT1A 3NTEA 2XGYA 4PH2A 4PH1A 2X2DD 1M9YC 1A8OA 2XGVA 2JPRA 1BAJA 5HGLA 1U7KA 4COCA 4NX4C 1M9DC 3DTJA 4B4NA 2M8LA 4COPA 2ONTA 4E91A 1L6NA 2JYLA 4XFXA 5HGMA 5I4TG 1AFVA 1AUMA 2X83A 1P7NA 4WYMA 4XROA 3DS4A 5HGKA 4XFYA 4U0FA 4PH0A 2GONA 1M9CC 1M9XC 1M9EC 2XDEA 4U0AA 1EM9A 1QRJA 1M9FC 1EOQA 2PXRC 2Y4ZA 4DGAC 3LRYA 2GOLB 2PWMA 3DS1A 2XV6A 4LQWC 5JPAA 2M8NA 2EIAA 3P05A 2JYGA 3G28A 2L6EA 4U0CA 2X82A 5HGNA 1EIAA 3DS5A 2XGUA 2XXMA 3G1GA 3VRLC 4XRQA 2WLVA 4J93A 3G1IA 1AK4C 3H4EA 2WLVB 2KODA 3G0VA
chains in the Genus database with same CATH superfamily
5F2KA 4HTWA 3G21A 2PEJA 1VQKP 2GZJA 3RG2A 3DPHA 2K0XA 4U0DA 1VKUA 2QEXP 3CCEP 2V4XA 2KGCA 2MF4A 4XFZA 2ERHA 1AYIA 4E92A 1VQNP 3G29A 1HQBA 2KR5A 2EG5A 4U0EA 4PH3A 5KP6B 2FADA 3NTEA 4PH2A 2CNRA 2XGVA 3HZQA 2PENA 1BAJA 3RG6C 1F80D 1U7KA 2AVAA 2X2BA 1VQ5P 1OR5A 2JGPA 3G6EP 2JYLA 3CCVP 5I4TG 1AFVA 2PEOA 4WYMA 1VQLP 1VHNA 1HY8A 1MZ8A 3HYBA 4BPGA 4PH0A 1M9XC 2LKIA 3CD6P 2XDEA 2KG9A 1M9FC 2PXRC 2Y4ZA 2XV6A 1M6NA 4H2YC 2N5IA 2GZFA 2FQ0A 2EIAA 2AFEA 3NY7B 2BHVA 4U0CA 5HGNA 2LTEA 1KQSO 2LOLA 1YJNP 3WBHA 2L22A 3VRLC 1M90Q 3B5IA 5F2OA 4J93A 4H2XC 3G0VA 1IMQA 2K2QA 2OTJP 1L0HA 2PWOA 2LL8A 2LF4A 1GWPA 2VSQA 2GZEA 1NJIQ 3E2DA 7CEIA 1IUQA 2K0YA 5KP7B 1E6JP 2M8PA 1G03A 4QNBA 2L4BA 4MRTC 3CMAP 1YJWP 2JAZA 2KOSA 2K94A 1K73Q 2JO0A 5HV8A 4F37A 1JJ2O 1X3OA 2PNGA 2L0QA 5HGOA 3DS3A 3H47A 4R0MA 4M0IA 3CPWO 5EW5E 2GZGA 4PH1A 4IZ6A 1VQ9P 1M9YC 1ACPA 2FHSC 5HGLA 1S72P 3GZMA 2CWOA 1VQOP 4B4NA 4COPA 2CQ8A 2FQ1A 5BS2A 4XFXA 1N8RQ 3CCJP 2EHSA 2X83A 1DV5A 4XROA 5HGKA 1RNIA 2FVEA 2GYKA 2K92A 5CZDB 1QVGO 2GDXA 1M9EC 4U0AA 2KWLA 1Q82Q 1EOQA 4DGAC 2MD9A 3LRYA 2KGEA 1DNYA 2KGAA 1Q86Q 4LQWC 1W2BO 2MR8A 2K93A 1Z6MA 3CCQP 2KOPA 2JYGA 2Z45A 3GJNA 1L0IA 1EIAA 3DS5A 4GR2A 3B4QA 1ZMBA 2XXMA 2EHTA 2WLVA 2NO8A 1M74A 3H4EA 2GDYA 1IMPA 2WLVB 3CC2P 1GXGA 2MVVA 4BPHA 2FAEA 3G26A 2MR7A 2MVUA 3CE7A 3CXCO 1BXIA 2LPKA 5F2NA 1UNKA 3CCUP 1KC8Q 1AF8A 4GR6A 3I56P 2VLPA 1A43A 1K9MQ 2GDWA 1YI2P 3DS0A 4INBA 2CGQA 2JU2A 2PY8A 2KOOA 2VLNA 4BPFA 1M6EX 2X2DD 3CMEP 1A8OA 3GKLC 4HKGA 1E0HA 2JBGA 1EMVA 1UJZA 2AF8A 2KG6A 1L6NA 2ONTA 1ZNVA 5HGMA 1FR2A 3G71P 2JB0A 1Q81Q 2M5RA 3H0DA 4H2WC 2N50A 3M1MA 2FQ2A 2FVAA 2PEQA 3DS4A 4XFYA 2JU1A 2N6YA 4U0FA 2PEMA 1QVFO 4CA3A 2GONA 2N98A 2FVFA 1EM9A 4DG9A 2FACA 4PXHB 3OW2O 3DS1A 5JPAA 2LMLA 4QKOA 2M8NA 3G28A 2XZ0D 1K8AQ 2XGUA 3G1GA 1CEIA 3EJBA 3CCLP 1GXHA 2LIWA 3G1IA 2OARA 2VLOA 1AK4C 2KODA 5KP8B 1KLPA 2P9XA 2KOQA 1VQMP 3BP9A 4IPYA 1T8KA 3MGEA 2PEKA 3EJDA 4NEOA 3GZLA 2EFJA 3G4SP 4U0BA 1VQ8P 1NQ4A 2AFDA 1D1DA 2DNWA 3DS2A 2JQ4A 2ROQA 2CG5B 2QNWA 2WPTA 2BUOA 4DGEC 1GPJA 1RO2A 3CC7P 5DCKA 2KGFA 4UHPB 1K30A 1VQ7P 2XT1A 3CCMP 1YITP 2XGYA 2K0DX 2XZ1C 2JPRA 4COCA 4NX4C 1YHQP 1M9DC 3DTJA 2GZIA 3LMOA 2M8LA 4E91A 1VQ4P 2KG8A 3Q20A 1VQPP 1VQ6P 2Z44A 1AUMA 1P7NA 3CCSP 1YIJP 2N5HA 2N6ZA 1M9CC 5EJDA 3I55P 1RO0A 2K5XA 1QRJA 1KD1Q 2OTLP 4PWVB 2VLQA 1YJ9P 2PEIA 2L9FA 2GOLB 2PWMA 2KORA 3CC4P 5HVCA 5BS1A 3EJEA 1M1KQ 3P05A 2L6EA 2KGDA 2X82A 3CCRP 2Z46A 2QA4P 2LIUA 4XRQA 2DGYA 1Q7YQ 2KW2A 3U43A 2MY5A 2E1MA
chains in the Genus database with same CATH topology
3BP9A 2PWOA 3G26A 4IPYA 2LF4A 3MGEA 1GWPA 2PEKA 5F2KA 4HTWA 3G21A 3CXCO 5F2NA 2EFJA 2PEJA 3G4SP 4U0BA 3CCUP 1NJIQ 1KC8Q 1VQKP 3E2DA 1VQ8P 3DPHA 4U0DA 1IUQA 1D1DA 1E6JP 4GR6A 2QEXP 3I56P 3CCEP 3DS2A 2M8PA 1G03A 2V4XA 4QNBA 3CMAP 1YJWP 1A43A 1K9MQ 4XFZA 2BUOA 1K73Q 1YI2P 4DGEC 3DS0A 4E92A 2JO0A 4INBA 1VQNP 1RO2A 1JJ2O 3CC7P 5HGOA 3G29A 3DS3A 3H47A 2PY8A 5DCKA 2KGFA 2EG5A 4M0IA 4U0EA 4PH3A 1K30A 3CPWO 1VQ7P 2XT1A 3CCMP 1M6EX 3NTEA 1YITP 2XGYA 4PH2A 4PH1A 2X2DD 1VQ9P 3CMEP 1M9YC 1A8OA 2XGVA 2JPRA 3HZQA 2PENA 1BAJA 5HGLA 3RG6C 1U7KA 1S72P 4COCA 4NX4C 1YHQP 1VQOP 2CWOA 1VQ5P 1M9DC 3DTJA 4B4NA 3G6EP 2M8LA 4COPA 2ONTA 4E91A 1L6NA 2JYLA 5BS2A 1N8RQ 1VQ4P 4XFXA 3Q20A 5HGMA 3CCJP 3G71P 3CCVP 1VQPP 1Q81Q 3H0DA 3M1MA 5I4TG 1AFVA 2Z44A 1VQ6P 1AUMA 2PEOA 2X83A 2PEQA 1P7NA 4WYMA 4XROA 3DS4A 5HGKA 4XFYA 1RNIA 1VQLP 3CCSP 4U0FA 3HYBA 2PEMA 1YIJP 1QVFO 4PH0A 2GONA 1M9CC 1M9XC 1QVGO 3I55P 1M9EC 2XDEA 3CD6P 1RO0A 4U0AA 1EM9A 1QRJA 1KD1Q 2OTLP 1M9FC 1Q82Q 1YJ9P 1EOQA 2PXRC 2Y4ZA 4DGAC 2PEIA 3LRYA 2GOLB 3OW2O 2PWMA 3DS1A 1Q86Q 2XV6A 4LQWC 1W2BO 1M6NA 5JPAA 3CC4P 1M1KQ 5BS1A 2M8NA 2EIAA 3CCQP 3P05A 2JYGA 3G28A 2L6EA 2Z45A 2BHVA 4U0CA 2X82A 3CCRP 5HGNA 2Z46A 1EIAA 3DS5A 1K8AQ 2QA4P 2XGUA 4GR2A 1KQSO 1YJNP 1ZMBA 3WBHA 2XXMA 3G1GA 3VRLC 1M90Q 4XRQA 2WLVA 3B5IA 5F2OA 3CCLP 4J93A 3G1IA 2DGYA 2OARA 1M74A 1Q7YQ 1AK4C 3H4EA 2WLVB 2KODA 3G0VA 3CC2P 2OTJP 2P9XA 1VQMP 2E1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP9 A;  2PWO A;  3G26 A;  4IPY A;  2LF4 A;  3MGE A;  1GWP A;  4HTW A;  3G21 A;  4U0B A;  3DPH A;  4U0D A;  1D1D A;  1E6J P;  3DS2 A;  2M8P A;  1G03 A;  2V4X A;  4QNB A;  1A43 A;  4XFZ A;  2BUO A;  4DGE C;  3DS0 A;  4E92 A;  2JO0 A;  4INB A;  5HGO A;  3G29 A;  3DS3 A;  3H47 A;  5DCK A;  2KGF A;  4M0I A;  4U0E A;  4PH3 A;  2XT1 A;  3NTE A;  2XGY A;  4PH2 A;  4PH1 A;  2X2D D;  1M9Y C;  1A8O A;  2XGV A;  2JPR A;  1BAJ A;  5HGL A;  1U7K A;  4COC A;  4NX4 C;  1M9D C;  3DTJ A;  4B4N A;  2M8L A;  4COP A;  2ONT A;  4E91 A;  1L6N A;  2JYL A;  4XFX A;  5HGM A;  5I4T G;  1AFV A;  1AUM A;  2X83 A;  1P7N A;  4WYM A;  4XRO A;  3DS4 A;  5HGK A;  4XFY A;  4U0F A;  4PH0 A;  2GON A;  1M9C C;  1M9X C;  1M9E C;  2XDE A;  4U0A A;  1EM9 A;  1QRJ A;  1M9F C;  1EOQ A;  2PXR C;  2Y4Z A;  4DGA C;  3LRY A;  2GOL B;  2PWM A;  3DS1 A;  2XV6 A;  4LQW C;  5JPA A;  2M8N A;  2EIA A;  3P05 A;  2JYG A;  3G28 A;  2L6E A;  4U0C A;  2X82 A;  5HGN A;  1EIA A;  3DS5 A;  2XGU A;  2XXM A;  3G1G A;  3VRL C;  4XRQ A;  2WLV A;  4J93 A;  3G1I A;  1AK4 C;  3H4E A;  2WLV B;  2KOD A;  3G0V A; 
#chains in the Genus database with same CATH topology
 5F2K A;  4HTW A;  3G21 A;  2PEJ A;  1VQK P;  2GZJ A;  3RG2 A;  3DPH A;  2K0X A;  4U0D A;  1VKU A;  2QEX P;  3CCE P;  2V4X A;  2KGC A;  2MF4 A;  4XFZ A;  2ERH A;  1AYI A;  4E92 A;  1VQN P;  3G29 A;  1HQB A;  2KR5 A;  2EG5 A;  4U0E A;  4PH3 A;  5KP6 B;  2FAD A;  3NTE A;  4PH2 A;  2CNR A;  2XGV A;  3HZQ A;  2PEN A;  1BAJ A;  3RG6 C;  1F80 D;  1U7K A;  2AVA A;  2X2B A;  1VQ5 P;  1OR5 A;  2JGP A;  3G6E P;  2JYL A;  3CCV P;  5I4T G;  1AFV A;  2PEO A;  4WYM A;  1VQL P;  1VHN A;  1HY8 A;  1MZ8 A;  3HYB A;  4BPG A;  4PH0 A;  1M9X C;  2LKI A;  3CD6 P;  2XDE A;  2KG9 A;  1M9F C;  2PXR C;  2Y4Z A;  2XV6 A;  1M6N A;  4H2Y C;  2N5I A;  2GZF A;  2FQ0 A;  2EIA A;  2AFE A;  3NY7 B;  2BHV A;  4U0C A;  5HGN A;  2LTE A;  1KQS O;  2LOL A;  1YJN P;  3WBH A;  2L22 A;  3VRL C;  1M90 Q;  3B5I A;  5F2O A;  4J93 A;  4H2X C;  3G0V A;  1IMQ A;  2K2Q A;  2OTJ P;  1L0H A;  2PWO A;  2LL8 A;  2LF4 A;  1GWP A;  2VSQ A;  2GZE A;  1NJI Q;  3E2D A;  7CEI A;  1IUQ A;  2K0Y A;  5KP7 B;  1E6J P;  2M8P A;  1G03 A;  4QNB A;  2L4B A;  4MRT C;  3CMA P;  1YJW P;  2JAZ A;  2KOS A;  2K94 A;  1K73 Q;  2JO0 A;  5HV8 A;  4F37 A;  1JJ2 O;  1X3O A;  2PNG A;  2L0Q A;  5HGO A;  3DS3 A;  3H47 A;  4R0M A;  4M0I A;  3CPW O;  5EW5 E;  2GZG A;  4PH1 A;  4IZ6 A;  1VQ9 P;  1M9Y C;  1ACP A;  2FHS C;  5HGL A;  1S72 P;  3GZM A;  2CWO A;  1VQO P;  4B4N A;  4COP A;  2CQ8 A;  2FQ1 A;  5BS2 A;  4XFX A;  1N8R Q;  3CCJ P;  2EHS A;  2X83 A;  1DV5 A;  4XRO A;  5HGK A;  1RNI A;  2FVE A;  2GYK A;  2K92 A;  5CZD B;  1QVG O;  2GDX A;  1M9E C;  4U0A A;  2KWL A;  1Q82 Q;  1EOQ A;  4DGA C;  2MD9 A;  3LRY A;  2KGE A;  1DNY A;  2KGA A;  1Q86 Q;  4LQW C;  1W2B O;  2MR8 A;  2K93 A;  1Z6M A;  3CCQ P;  2KOP A;  2JYG A;  2Z45 A;  3GJN A;  1L0I A;  1EIA A;  3DS5 A;  4GR2 A;  3B4Q A;  1ZMB A;  2XXM A;  2EHT A;  2WLV A;  2NO8 A;  1M74 A;  3H4E A;  2GDY A;  1IMP A;  2WLV B;  3CC2 P;  1GXG A;  2MVV A;  4BPH A;  2FAE A;  3G26 A;  2MR7 A;  2MVU A;  3CE7 A;  3CXC O;  1BXI A;  2LPK A;  5F2N A;  1UNK A;  3CCU P;  1KC8 Q;  1AF8 A;  4GR6 A;  3I56 P;  2VLP A;  1A43 A;  1K9M Q;  2GDW A;  1YI2 P;  3DS0 A;  4INB A;  2CGQ A;  2JU2 A;  2PY8 A;  2KOO A;  2VLN A;  4BPF A;  1M6E X;  2X2D D;  3CME P;  1A8O A;  3GKL C;  4HKG A;  1E0H A;  2JBG A;  1EMV A;  1UJZ A;  2AF8 A;  2KG6 A;  1L6N A;  2ONT A;  1ZNV A;  5HGM A;  1FR2 A;  3G71 P;  2JB0 A;  1Q81 Q;  2M5R A;  3H0D A;  4H2W C;  2N50 A;  3M1M A;  2FQ2 A;  2FVA A;  2PEQ A;  3DS4 A;  4XFY A;  2JU1 A;  2N6Y A;  4U0F A;  2PEM A;  1QVF O;  4CA3 A;  2GON A;  2N98 A;  2FVF A;  1EM9 A;  4DG9 A;  2FAC A;  4PXH B;  3OW2 O;  3DS1 A;  5JPA A;  2LML A;  4QKO A;  2M8N A;  3G28 A;  2XZ0 D;  1K8A Q;  2XGU A;  3G1G A;  1CEI A;  3EJB A;  3CCL P;  1GXH A;  2LIW A;  3G1I A;  2OAR A;  2VLO A;  1AK4 C;  2KOD A;  5KP8 B;  1KLP A;  2P9X A;  2KOQ A;  1VQM P;  3BP9 A;  4IPY A;  1T8K A;  3MGE A;  2PEK A;  3EJD A;  4NEO A;  3GZL A;  2EFJ A;  3G4S P;  4U0B A;  1VQ8 P;  1NQ4 A;  2AFD A;  1D1D A;  2DNW A;  3DS2 A;  2JQ4 A;  2ROQ A;  2CG5 B;  2QNW A;  2WPT A;  2BUO A;  4DGE C;  1GPJ A;  1RO2 A;  3CC7 P;  5DCK A;  2KGF A;  4UHP B;  1K30 A;  1VQ7 P;  2XT1 A;  3CCM P;  1YIT P;  2XGY A;  2K0D X;  2XZ1 C;  2JPR A;  4COC A;  4NX4 C;  1YHQ P;  1M9D C;  3DTJ A;  2GZI A;  3LMO A;  2M8L A;  4E91 A;  1VQ4 P;  2KG8 A;  3Q20 A;  1VQP P;  1VQ6 P;  2Z44 A;  1AUM A;  1P7N A;  3CCS P;  1YIJ P;  2N5H A;  2N6Z A;  1M9C C;  5EJD A;  3I55 P;  1RO0 A;  2K5X A;  1QRJ A;  1KD1 Q;  2OTL P;  4PWV B;  2VLQ A;  1YJ9 P;  2PEI A;  2L9F A;  2GOL B;  2PWM A;  2KOR A;  3CC4 P;  5HVC A;  5BS1 A;  3EJE A;  1M1K Q;  3P05 A;  2L6E A;  2KGD A;  2X82 A;  3CCR P;  2Z46 A;  2QA4 P;  2LIU A;  4XRQ A;  2DGY A;  1Q7Y Q;  2KW2 A;  3U43 A;  2MY5 A;  2E1M A; 
#chains in the Genus database with same CATH homology
 3BP9 A;  2PWO A;  3G26 A;  4IPY A;  2LF4 A;  3MGE A;  1GWP A;  2PEK A;  5F2K A;  4HTW A;  3G21 A;  3CXC O;  5F2N A;  2EFJ A;  2PEJ A;  3G4S P;  4U0B A;  3CCU P;  1NJI Q;  1KC8 Q;  1VQK P;  3E2D A;  1VQ8 P;  3DPH A;  4U0D A;  1IUQ A;  1D1D A;  1E6J P;  4GR6 A;  2QEX P;  3I56 P;  3CCE P;  3DS2 A;  2M8P A;  1G03 A;  2V4X A;  4QNB A;  3CMA P;  1YJW P;  1A43 A;  1K9M Q;  4XFZ A;  2BUO A;  1K73 Q;  1YI2 P;  4DGE C;  3DS0 A;  4E92 A;  2JO0 A;  4INB A;  1VQN P;  1RO2 A;  1JJ2 O;  3CC7 P;  5HGO A;  3G29 A;  3DS3 A;  3H47 A;  2PY8 A;  5DCK A;  2KGF A;  2EG5 A;  4M0I A;  4U0E A;  4PH3 A;  1K30 A;  3CPW O;  1VQ7 P;  2XT1 A;  3CCM P;  1M6E X;  3NTE A;  1YIT P;  2XGY A;  4PH2 A;  4PH1 A;  2X2D D;  1VQ9 P;  3CME P;  1M9Y C;  1A8O A;  2XGV A;  2JPR A;  3HZQ A;  2PEN A;  1BAJ A;  5HGL A;  3RG6 C;  1U7K A;  1S72 P;  4COC A;  4NX4 C;  1YHQ P;  1VQO P;  2CWO A;  1VQ5 P;  1M9D C;  3DTJ A;  4B4N A;  3G6E P;  2M8L A;  4COP A;  2ONT A;  4E91 A;  1L6N A;  2JYL A;  5BS2 A;  1N8R Q;  1VQ4 P;  4XFX A;  3Q20 A;  5HGM A;  3CCJ P;  3G71 P;  3CCV P;  1VQP P;  1Q81 Q;  3H0D A;  3M1M A;  5I4T G;  1AFV A;  2Z44 A;  1VQ6 P;  1AUM A;  2PEO A;  2X83 A;  2PEQ A;  1P7N A;  4WYM A;  4XRO A;  3DS4 A;  5HGK A;  4XFY A;  1RNI A;  1VQL P;  3CCS P;  4U0F A;  3HYB A;  2PEM A;  1YIJ P;  1QVF O;  4PH0 A;  2GON A;  1M9C C;  1M9X C;  1QVG O;  3I55 P;  1M9E C;  2XDE A;  3CD6 P;  1RO0 A;  4U0A A;  1EM9 A;  1QRJ A;  1KD1 Q;  2OTL P;  1M9F C;  1Q82 Q;  1YJ9 P;  1EOQ A;  2PXR C;  2Y4Z A;  4DGA C;  2PEI A;  3LRY A;  2GOL B;  3OW2 O;  2PWM A;  3DS1 A;  1Q86 Q;  2XV6 A;  4LQW C;  1W2B O;  1M6N A;  5JPA A;  3CC4 P;  1M1K Q;  5BS1 A;  2M8N A;  2EIA A;  3CCQ P;  3P05 A;  2JYG A;  3G28 A;  2L6E A;  2Z45 A;  2BHV A;  4U0C A;  2X82 A;  3CCR P;  5HGN A;  2Z46 A;  1EIA A;  3DS5 A;  1K8A Q;  2QA4 P;  2XGU A;  4GR2 A;  1KQS O;  1YJN P;  1ZMB A;  3WBH A;  2XXM A;  3G1G A;  3VRL C;  1M90 Q;  4XRQ A;  2WLV A;  3B5I A;  5F2O A;  3CCL P;  4J93 A;  3G1I A;  2DGY A;  2OAR A;  1M74 A;  1Q7Y Q;  1AK4 C;  3H4E A;  2WLV B;  2KOD A;  3G0V A;  3CC2 P;  2OTJ P;  2P9X A;  1VQM P;  2E1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...