4U0AA

Hexameric hiv-1 ca in complex with cpsf6 peptide, p6 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 70
structure length 208
sequence length 220
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0aA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0aA02
1M9CC 4LQWC 1M9YC 1AUMA 2X2DD 3H47A 2XDEA 1AK4C 3DS0A 1EM9A 4WYMA 3G1IA 5HGOA 3DS4A 4U0BA 4U0FA 2XGVA 4QNBA 1U7KA 4U0AA 2GOLB 4PH3A 3G26A 3H4EA 1D1DA 1P7NA 5HGMA 3G1GA 1E6JP 4U0EA 2M8LA 5DCKA 3LRYA 5I4TG 3G21A 2M8PA 3DS3A 1GWPA 3DPHA 2JPRA 3G29A 3DS5A 4DGAC 2X82A 4J93A 2XXMA 4XRQA 2BUOA 4IPYA 4B4NA 1A43A 3DS1A 4COPA 4COCA 2GONA 4XFXA 4PH2A 2ONTA 4XFYA 2JYGA 2JYLA 4E91A 4M0IA 2XT1A 3VRLC 2EIAA 2XGYA 4HTWA 4XROA 4INBA 4U0CA 4NX4C 3P05A 1EOQA 4U0DA 2WLVB 2XGUA 1L6NA 3DS2A 4XFZA 2PXRC 2WLVA 1QRJA 4PH1A 3BP9A 5JPAA 5HGKA 1M9EC 4DGEC 5HGNA 2X83A 1EIAA 1M9DC 1A8OA 1M9FC 2Y4ZA 1AFVA 2V4XA 2L6EA 3G0VA 2JO0A 3NTEA 1G03A 3MGEA 1M9XC 3G28A 4E92A 2XV6A 2KODA 2PWMA 5HGLA 4PH0A 1BAJA 2KGFA 2M8NA 2LF4A 2PWOA 3DTJA
chains in the Genus database with same CATH superfamily
2ROQA 1M6NA 5EJDA 3H47A 3I56P 1CEIA 3G4SP 3DS0A 3E2DA 5CZDB 2K2QA 1DV5A 1IMPA 3G1GA 2M8LA 3LRYA 5I4TG 3G21A 2AF8A 3DS3A 2JPRA 4GR6A 3DS5A 2L9FA 2EHSA 2MD9A 4XRQA 1ZNVA 1GXHA 1W2BO 4IPYA 3HYBA 3G6EP 3DS1A 4COPA 4PH2A 2PEKA 2JU1A 2LPKA 2N5HA 2JYLA 2K0XA 4E91A 2KWLA 4HTWA 5BS1A 4XROA 4INBA 5KP6B 1VQ6P 2KGDA 2LKIA 4PXHB 2XGUA 4XFZA 1QRJA 1M1KQ 1HQBA 2GDYA 2KG6A 2L0QA 1M90Q 2K92A 2CG5B 2JGPA 1YIJP 1AFVA 4PWVB 2L6EA 3LMOA 2JO0A 5F2KA 1HY8A 2FQ0A 1FR2A 2P9XA 3CCMP 1VKUA 2KG8A 3CC4P 1KLPA 2EG5A 1NJIQ 2LF4A 2PWOA 3DTJA 3GJNA 1Q81Q 1M9YC 1AUMA 2X2DD 3CXCO 1YJ9P 1Q86Q 3CC7P 3CCEP 4WYMA 1VQLP 3G1IA 3DS4A 2XGVA 3EJEA 5HGMA 1Q7YQ 3GKLC 1E6JP 4U0EA 1VQ7P 5DCKA 2M8PA 1GWPA 1VQ8P 1AYIA 2X82A 2FQ2A 2BUOA 4NEOA 1A43A 3CD6P 2VLNA 2VLPA 3CPWO 4COCA 2GONA 4XFXA 1VQNP 4XFYA 1K73Q 1VQ9P 2JYGA 2LIWA 2GZFA 1Z6MA 2N98A 1KC8Q 3CMEP 1IUQA 3CCSP 2EFJA 2WLVB 1L6NA 1BXIA 2PXRC 2WLVA 2GZGA 1EMVA 1MZ8A 5HVCA 3CCQP 4PH1A 5F2OA 3CCUP 5HGKA 1YITP 2M5RA 1AF8A 2Z46A 1M9DC 2K93A 2PEJA 4F37A 2V4XA 2KW2A 2GZJA 2FHSC 3EJBA 1VQ4P 1QVFO 2FACA 2XZ1C 2VLQA 1GPJA 1VQOP 2QA4P 4PH0A 2M8NA 3CMAP 2FVFA 3RG6C 1IMQA 2LL8A 1M9CC 2FAEA 4H2XC 2PNGA 1YI2P 2XDEA 3Q20A 2Z45A 3OW2O 4U0BA 4U0FA 4QNBA 4U0AA 2GOLB 3CCLP 1KQSO 3GZMA 7CEIA 3H4EA 2KG9A 2JB0A 5KP8B 2AFEA 2OARA 2PENA 1RO2A 2GDXA 1E0HA 1VQKP 3G29A 2KOOA 4DGAC 4UHPB 2FADA 1VQ5P 4J93A 2E1MA 2K0YA 2KOSA 1L0HA 2DGYA 2MY5A 2OTJP 4B4NA 3G71P 1K9MQ 5EW5E 1YJNP 2VLOA 2WPTA 2ONTA 3I55P 4MRTC 4M0IA 2MR7A 3VRLC 2XT1A 2XGYA 4U0CA 2N50A 4IZ6A 1M6EX 3EJDA 4NX4C 1T8KA 5F2NA 2JU2A 3B4QA 3DS2A 2MF4A 4DG9A 4CA3A 2N5IA 2FVAA 1M9EC 4DGEC 5HGNA 2K5XA 1QVGO 2GDWA 3B5IA 4QKOA 5BS2A 2MVUA 1EIAA 1A8OA 2X2BA 1M9FC 1DNYA 2N6ZA 2NO8A 3HZQA 3NTEA 1G03A 1M9XC 3G28A 4E92A 2XV6A 4BPFA 2PEOA 5KP7B 2KODA 1BAJA 1RO0A 2KGFA 2KOPA 2DNWA 2GZEA 1K8AQ 4LQWC 1YJWP 2JBGA 3H0DA 1YHQP 1VQMP 3CCRP 1AK4C 1EM9A 2MVVA 5HGOA 2PEIA 1U7KA 1F80D 2KGCA 4PH3A 2KOQA 3G26A 3U43A 2AFDA 1D1DA 3WBHA 2KGEA 1P7NA 2EHTA 2LOLA 2AVAA 2PY8A 3NY7B 2QNWA 1RNIA 2KR5A 1VQPP 3DPHA 4BPGA 1ZMBA 2ERHA 3CCVP 2L22A 1N8RQ 4H2WC 2XXMA 2FQ1A 2VSQA 1K30A 2BHVA 2FVEA 2N6YA 2KORA 2K94A 2MR8A 3CC2P 1L0IA 1GXGA 1UJZA 2K0DX 2OTLP 2JAZA 2L4BA 1NQ4A 2QEXP 1KD1Q 2EIAA 1VHNA 1M74A 4GR2A 3P05A 1EOQA 1X3OA 4U0DA 2Z44A 2XZ0D 1Q82Q 2GYKA 2CGQA 1OR5A 3BP9A 5JPAA 2PEMA 1ACPA 2X83A 1JJ2O 2CNRA 2GZIA 2Y4ZA 2LTEA 4R0MA 2LMLA 3M1MA 4H2YC 4BPHA 3G0VA 2LIUA 5HV8A 3MGEA 1S72P 3CE7A 4HKGA 2JQ4A 2CQ8A 1UNKA 3GZLA 3RG2A 2CWOA 2PWMA 5HGLA 2KGAA 2PEQA 3CCJP
chains in the Genus database with same CATH topology
1Q81Q 1M9CC 4LQWC 1M6NA 1YJWP 1M9YC 1AUMA 2X2DD 3CXCO 3H47A 1YJ9P 3I56P 3H0DA 1YHQP 1Q86Q 3CC7P 1VQMP 1YI2P 3CCEP 2XDEA 1AK4C 3DS0A 3Q20A 1EM9A 3G4SP 3CCJP 4WYMA 2Z45A 3CCRP 3OW2O 1VQLP 3G1IA 5HGOA 3DS4A 3E2DA 4U0BA 4U0FA 2XGVA 2PEIA 4QNBA 1U7KA 4U0AA 2GOLB 3CCLP 4PH3A 1KQSO 3G26A 3H4EA 1D1DA 3WBHA 1P7NA 5HGMA 3G1GA 1Q7YQ 2PY8A 1E6JP 4U0EA 1VQ7P 2M8LA 5DCKA 2OARA 3LRYA 2PENA 1RO2A 5I4TG 1RNIA 3G21A 2M8PA 1VQPP 3DS3A 1GWPA 1VQ8P 1VQKP 3DPHA 2JPRA 4GR6A 3G29A 3DS5A 1ZMBA 4DGAC 3CCVP 1N8RQ 2X82A 1VQ5P 4J93A 2XXMA 4XRQA 2E1MA 2BUOA 2DGYA 1K30A 4IPYA 2BHVA 1W2BO 2OTJP 4B4NA 1A43A 3HYBA 3G6EP 3DS1A 3CD6P 3CPWO 4COPA 3G71P 1K9MQ 4COCA 2GONA 1YJNP 3CC2P 4XFXA 4PH2A 1VQNP 2PEKA 2ONTA 4XFYA 1K73Q 1VQ9P 3I55P 2OTLP 2JYGA 2JYLA 4E91A 4M0IA 2XT1A 3VRLC 2QEXP 1KD1Q 2EIAA 2XGYA 4HTWA 5BS1A 4XROA 4INBA 1KC8Q 3CMEP 1VQ6P 1IUQA 4U0CA 3CCSP 1M6EX 1M74A 4GR2A 4NX4C 3P05A 1EOQA 4U0DA 2Z44A 5F2NA 2EFJA 2WLVB 1Q82Q 2XGUA 1L6NA 3DS2A 4XFZA 2PXRC 2WLVA 1QRJA 3CCQP 4PH1A 1M1KQ 5F2OA 3BP9A 5JPAA 2PEMA 3CCUP 5HGKA 1M9EC 1YITP 4DGEC 5HGNA 2X83A 1QVGO 1JJ2O 1M90Q 3B5IA 5BS2A 2Z46A 1EIAA 1M9DC 2PEJA 1A8OA 1M9FC 2Y4ZA 1YIJP 1AFVA 2V4XA 3M1MA 1VQ4P 3HZQA 2L6EA 3G0VA 2JO0A 5F2KA 3NTEA 1G03A 1QVFO 3MGEA 1M9XC 1S72P 3G28A 4E92A 2XV6A 2P9XA 3CCMP 2PEOA 1K8AQ 1VQOP 2QA4P 2CWOA 2KODA 2PWMA 5HGLA 4PH0A 1BAJA 2KGFA 2M8NA 1RO0A 2PEQA 3CMAP 3CC4P 3RG6C 2EG5A 1NJIQ 2LF4A 2PWOA 3DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9C C;  4LQW C;  1M9Y C;  1AUM A;  2X2D D;  3H47 A;  2XDE A;  1AK4 C;  3DS0 A;  1EM9 A;  4WYM A;  3G1I A;  5HGO A;  3DS4 A;  4U0B A;  4U0F A;  2XGV A;  4QNB A;  1U7K A;  4U0A A;  2GOL B;  4PH3 A;  3G26 A;  3H4E A;  1D1D A;  1P7N A;  5HGM A;  3G1G A;  1E6J P;  4U0E A;  2M8L A;  5DCK A;  3LRY A;  5I4T G;  3G21 A;  2M8P A;  3DS3 A;  1GWP A;  3DPH A;  2JPR A;  3G29 A;  3DS5 A;  4DGA C;  2X82 A;  4J93 A;  2XXM A;  4XRQ A;  2BUO A;  4IPY A;  4B4N A;  1A43 A;  3DS1 A;  4COP A;  4COC A;  2GON A;  4XFX A;  4PH2 A;  2ONT A;  4XFY A;  2JYG A;  2JYL A;  4E91 A;  4M0I A;  2XT1 A;  3VRL C;  2EIA A;  2XGY A;  4HTW A;  4XRO A;  4INB A;  4U0C A;  4NX4 C;  3P05 A;  1EOQ A;  4U0D A;  2WLV B;  2XGU A;  1L6N A;  3DS2 A;  4XFZ A;  2PXR C;  2WLV A;  1QRJ A;  4PH1 A;  3BP9 A;  5JPA A;  5HGK A;  1M9E C;  4DGE C;  5HGN A;  2X83 A;  1EIA A;  1M9D C;  1A8O A;  1M9F C;  2Y4Z A;  1AFV A;  2V4X A;  2L6E A;  3G0V A;  2JO0 A;  3NTE A;  1G03 A;  3MGE A;  1M9X C;  3G28 A;  4E92 A;  2XV6 A;  2KOD A;  2PWM A;  5HGL A;  4PH0 A;  1BAJ A;  2KGF A;  2M8N A;  2LF4 A;  2PWO A;  3DTJ A; 
#chains in the Genus database with same CATH topology
 2ROQ A;  1M6N A;  5EJD A;  3H47 A;  3I56 P;  1CEI A;  3G4S P;  3DS0 A;  3E2D A;  5CZD B;  2K2Q A;  1DV5 A;  1IMP A;  3G1G A;  2M8L A;  3LRY A;  5I4T G;  3G21 A;  2AF8 A;  3DS3 A;  2JPR A;  4GR6 A;  3DS5 A;  2L9F A;  2EHS A;  2MD9 A;  4XRQ A;  1ZNV A;  1GXH A;  1W2B O;  4IPY A;  3HYB A;  3G6E P;  3DS1 A;  4COP A;  4PH2 A;  2PEK A;  2JU1 A;  2LPK A;  2N5H A;  2JYL A;  2K0X A;  4E91 A;  2KWL A;  4HTW A;  5BS1 A;  4XRO A;  4INB A;  5KP6 B;  1VQ6 P;  2KGD A;  2LKI A;  4PXH B;  2XGU A;  4XFZ A;  1QRJ A;  1M1K Q;  1HQB A;  2GDY A;  2KG6 A;  2L0Q A;  1M90 Q;  2K92 A;  2CG5 B;  2JGP A;  1YIJ P;  1AFV A;  4PWV B;  2L6E A;  3LMO A;  2JO0 A;  5F2K A;  1HY8 A;  2FQ0 A;  1FR2 A;  2P9X A;  3CCM P;  1VKU A;  2KG8 A;  3CC4 P;  1KLP A;  2EG5 A;  1NJI Q;  2LF4 A;  2PWO A;  3DTJ A;  3GJN A;  1Q81 Q;  1M9Y C;  1AUM A;  2X2D D;  3CXC O;  1YJ9 P;  1Q86 Q;  3CC7 P;  3CCE P;  4WYM A;  1VQL P;  3G1I A;  3DS4 A;  2XGV A;  3EJE A;  5HGM A;  1Q7Y Q;  3GKL C;  1E6J P;  4U0E A;  1VQ7 P;  5DCK A;  2M8P A;  1GWP A;  1VQ8 P;  1AYI A;  2X82 A;  2FQ2 A;  2BUO A;  4NEO A;  1A43 A;  3CD6 P;  2VLN A;  2VLP A;  3CPW O;  4COC A;  2GON A;  4XFX A;  1VQN P;  4XFY A;  1K73 Q;  1VQ9 P;  2JYG A;  2LIW A;  2GZF A;  1Z6M A;  2N98 A;  1KC8 Q;  3CME P;  1IUQ A;  3CCS P;  2EFJ A;  2WLV B;  1L6N A;  1BXI A;  2PXR C;  2WLV A;  2GZG A;  1EMV A;  1MZ8 A;  5HVC A;  3CCQ P;  4PH1 A;  5F2O A;  3CCU P;  5HGK A;  1YIT P;  2M5R A;  1AF8 A;  2Z46 A;  1M9D C;  2K93 A;  2PEJ A;  4F37 A;  2V4X A;  2KW2 A;  2GZJ A;  2FHS C;  3EJB A;  1VQ4 P;  1QVF O;  2FAC A;  2XZ1 C;  2VLQ A;  1GPJ A;  1VQO P;  2QA4 P;  4PH0 A;  2M8N A;  3CMA P;  2FVF A;  3RG6 C;  1IMQ A;  2LL8 A;  1M9C C;  2FAE A;  4H2X C;  2PNG A;  1YI2 P;  2XDE A;  3Q20 A;  2Z45 A;  3OW2 O;  4U0B A;  4U0F A;  4QNB A;  4U0A A;  2GOL B;  3CCL P;  1KQS O;  3GZM A;  7CEI A;  3H4E A;  2KG9 A;  2JB0 A;  5KP8 B;  2AFE A;  2OAR A;  2PEN A;  1RO2 A;  2GDX A;  1E0H A;  1VQK P;  3G29 A;  2KOO A;  4DGA C;  4UHP B;  2FAD A;  1VQ5 P;  4J93 A;  2E1M A;  2K0Y A;  2KOS A;  1L0H A;  2DGY A;  2MY5 A;  2OTJ P;  4B4N A;  3G71 P;  1K9M Q;  5EW5 E;  1YJN P;  2VLO A;  2WPT A;  2ONT A;  3I55 P;  4MRT C;  4M0I A;  2MR7 A;  3VRL C;  2XT1 A;  2XGY A;  4U0C A;  2N50 A;  4IZ6 A;  1M6E X;  3EJD A;  4NX4 C;  1T8K A;  5F2N A;  2JU2 A;  3B4Q A;  3DS2 A;  2MF4 A;  4DG9 A;  4CA3 A;  2N5I A;  2FVA A;  1M9E C;  4DGE C;  5HGN A;  2K5X A;  1QVG O;  2GDW A;  3B5I A;  4QKO A;  5BS2 A;  2MVU A;  1EIA A;  1A8O A;  2X2B A;  1M9F C;  1DNY A;  2N6Z A;  2NO8 A;  3HZQ A;  3NTE A;  1G03 A;  1M9X C;  3G28 A;  4E92 A;  2XV6 A;  4BPF A;  2PEO A;  5KP7 B;  2KOD A;  1BAJ A;  1RO0 A;  2KGF A;  2KOP A;  2DNW A;  2GZE A;  1K8A Q;  4LQW C;  1YJW P;  2JBG A;  3H0D A;  1YHQ P;  1VQM P;  3CCR P;  1AK4 C;  1EM9 A;  2MVV A;  5HGO A;  2PEI A;  1U7K A;  1F80 D;  2KGC A;  4PH3 A;  2KOQ A;  3G26 A;  3U43 A;  2AFD A;  1D1D A;  3WBH A;  2KGE A;  1P7N A;  2EHT A;  2LOL A;  2AVA A;  2PY8 A;  3NY7 B;  2QNW A;  1RNI A;  2KR5 A;  1VQP P;  3DPH A;  4BPG A;  1ZMB A;  2ERH A;  3CCV P;  2L22 A;  1N8R Q;  4H2W C;  2XXM A;  2FQ1 A;  2VSQ A;  1K30 A;  2BHV A;  2FVE A;  2N6Y A;  2KOR A;  2K94 A;  2MR8 A;  3CC2 P;  1L0I A;  1GXG A;  1UJZ A;  2K0D X;  2OTL P;  2JAZ A;  2L4B A;  1NQ4 A;  2QEX P;  1KD1 Q;  2EIA A;  1VHN A;  1M74 A;  4GR2 A;  3P05 A;  1EOQ A;  1X3O A;  4U0D A;  2Z44 A;  2XZ0 D;  1Q82 Q;  2GYK A;  2CGQ A;  1OR5 A;  3BP9 A;  5JPA A;  2PEM A;  1ACP A;  2X83 A;  1JJ2 O;  2CNR A;  2GZI A;  2Y4Z A;  2LTE A;  4R0M A;  2LML A;  3M1M A;  4H2Y C;  4BPH A;  3G0V A;  2LIU A;  5HV8 A;  3MGE A;  1S72 P;  3CE7 A;  4HKG A;  2JQ4 A;  2CQ8 A;  1UNK A;  3GZL A;  3RG2 A;  2CWO A;  2PWM A;  5HGL A;  2KGA A;  2PEQ A;  3CCJ P; 
#chains in the Genus database with same CATH homology
 1Q81 Q;  1M9C C;  4LQW C;  1M6N A;  1YJW P;  1M9Y C;  1AUM A;  2X2D D;  3CXC O;  3H47 A;  1YJ9 P;  3I56 P;  3H0D A;  1YHQ P;  1Q86 Q;  3CC7 P;  1VQM P;  1YI2 P;  3CCE P;  2XDE A;  1AK4 C;  3DS0 A;  3Q20 A;  1EM9 A;  3G4S P;  3CCJ P;  4WYM A;  2Z45 A;  3CCR P;  3OW2 O;  1VQL P;  3G1I A;  5HGO A;  3DS4 A;  3E2D A;  4U0B A;  4U0F A;  2XGV A;  2PEI A;  4QNB A;  1U7K A;  4U0A A;  2GOL B;  3CCL P;  4PH3 A;  1KQS O;  3G26 A;  3H4E A;  1D1D A;  3WBH A;  1P7N A;  5HGM A;  3G1G A;  1Q7Y Q;  2PY8 A;  1E6J P;  4U0E A;  1VQ7 P;  2M8L A;  5DCK A;  2OAR A;  3LRY A;  2PEN A;  1RO2 A;  5I4T G;  1RNI A;  3G21 A;  2M8P A;  1VQP P;  3DS3 A;  1GWP A;  1VQ8 P;  1VQK P;  3DPH A;  2JPR A;  4GR6 A;  3G29 A;  3DS5 A;  1ZMB A;  4DGA C;  3CCV P;  1N8R Q;  2X82 A;  1VQ5 P;  4J93 A;  2XXM A;  4XRQ A;  2E1M A;  2BUO A;  2DGY A;  1K30 A;  4IPY A;  2BHV A;  1W2B O;  2OTJ P;  4B4N A;  1A43 A;  3HYB A;  3G6E P;  3DS1 A;  3CD6 P;  3CPW O;  4COP A;  3G71 P;  1K9M Q;  4COC A;  2GON A;  1YJN P;  3CC2 P;  4XFX A;  4PH2 A;  1VQN P;  2PEK A;  2ONT A;  4XFY A;  1K73 Q;  1VQ9 P;  3I55 P;  2OTL P;  2JYG A;  2JYL A;  4E91 A;  4M0I A;  2XT1 A;  3VRL C;  2QEX P;  1KD1 Q;  2EIA A;  2XGY A;  4HTW A;  5BS1 A;  4XRO A;  4INB A;  1KC8 Q;  3CME P;  1VQ6 P;  1IUQ A;  4U0C A;  3CCS P;  1M6E X;  1M74 A;  4GR2 A;  4NX4 C;  3P05 A;  1EOQ A;  4U0D A;  2Z44 A;  5F2N A;  2EFJ A;  2WLV B;  1Q82 Q;  2XGU A;  1L6N A;  3DS2 A;  4XFZ A;  2PXR C;  2WLV A;  1QRJ A;  3CCQ P;  4PH1 A;  1M1K Q;  5F2O A;  3BP9 A;  5JPA A;  2PEM A;  3CCU P;  5HGK A;  1M9E C;  1YIT P;  4DGE C;  5HGN A;  2X83 A;  1QVG O;  1JJ2 O;  1M90 Q;  3B5I A;  5BS2 A;  2Z46 A;  1EIA A;  1M9D C;  2PEJ A;  1A8O A;  1M9F C;  2Y4Z A;  1YIJ P;  1AFV A;  2V4X A;  3M1M A;  1VQ4 P;  3HZQ A;  2L6E A;  3G0V A;  2JO0 A;  5F2K A;  3NTE A;  1G03 A;  1QVF O;  3MGE A;  1M9X C;  1S72 P;  3G28 A;  4E92 A;  2XV6 A;  2P9X A;  3CCM P;  2PEO A;  1K8A Q;  1VQO P;  2QA4 P;  2CWO A;  2KOD A;  2PWM A;  5HGL A;  4PH0 A;  1BAJ A;  2KGF A;  2M8N A;  1RO0 A;  2PEQ A;  3CMA P;  3CC4 P;  3RG6 C;  2EG5 A;  1NJI Q;  2LF4 A;  2PWO A;  3DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...