4U0AA

Hexameric hiv-1 ca in complex with cpsf6 peptide, p6 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 70
structure length 208
sequence length 220
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0aA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0aA02
1EOQA 2XT1A 5DCKA 4DGAC 1A43A 4PH1A 2JO0A 1EM9A 3G0VA 3G28A 2EIAA 2XV6A 2WLVB 2WLVA 3H4EA 4PH3A 3G1IA 2Y4ZA 1EIAA 4LQWC 3DPHA 3G1GA 4XFXA 1E6JP 5HGLA 4E91A 3H47A 1A8OA 4QNBA 1AK4C 4INBA 2XDEA 4XRQA 1U7KA 2LF4A 5JPAA 4DGEC 2XXMA 3LRYA 5HGNA 2XGYA 1L6NA 4XROA 4U0AA 2JYGA 1M9DC 2GOLB 4IPYA 1M9XC 4E92A 1AUMA 1M9FC 3DS5A 1D1DA 2V4XA 4PH2A 4XFYA 2GONA 4COCA 4PH0A 1M9CC 1GWPA 1P7NA 4U0DA 3VRLC 4WYMA 3P05A 5HGMA 3DS0A 1M9YC 2X82A 2XGUA 3DS1A 1QRJA 2L6EA 3G21A 4B4NA 3G26A 2JPRA 3BP9A 3G29A 5I4TG 2JYLA 2PXRC 4M0IA 3DS3A 3DS2A 1AFVA 2BUOA 3DS4A 2KGFA 2X83A 2XGVA 2KODA 3MGEA 2M8LA 4HTWA 5HGOA 2M8NA 1BAJA 3NTEA 1G03A 2PWMA 3DTJA 2PWOA 4COPA 4U0EA 2M8PA 2ONTA 4NX4C 4J93A 1M9EC 2X2DD 4U0CA 4U0FA 4XFZA 4U0BA 5HGKA
chains in the Genus database with same CATH superfamily
2PY8A 1EOQA 1VQ9P 2XZ0D 1K8AQ 3CCMP 4PH3A 1VQNP 1RO2A 2JBGA 3G1IA 1IMQA 2Y4ZA 5F2OA 3G1GA 2KG6A 1E6JP 5HGLA 4E91A 3CC2P 5KP8B 1Q86Q 2FHSC 3CMAP 2K5XA 1AK4C 2XDEA 4XRQA 5HVCA 2FVAA 4R0MA 1VQ5P 3LRYA 2XGYA 2GYKA 1W2BO 3RG6C 3EJEA 2M5RA 1M9DC 4BPFA 1K30A 2JAZA 2JQ4A 1ZNVA 3CCEP 1EMVA 4CA3A 2MD9A 4XFYA 4PH0A 2L22A 1DV5A 1GWPA 4WYMA 3I56P 2KG8A 1KQSO 3B4QA 2FADA 3CE7A 2PEJA 1QRJA 2N98A 3CCLP 4H2XC 1VKUA 1AFVA 2JU2A 2BUOA 3G6EP 1RO0A 2N50A 1YI2P 2PEQA 2VSQA 1Q82Q 2PENA 2KOQA 2GZFA 5HGOA 1BXIA 2PEMA 2N5HA 3GZMA 2M8NA 2PWMA 2AF8A 2K93A 1ACPA 5F2KA 2BHVA 2KGAA 3Q20A 2KOSA 2ONTA 2L0QA 1M9EC 1VQKP 4XFZA 5KP7B 2XT1A 4PH1A 2GDWA 4GR6A 2EIAA 2GZEA 2CNRA 1VQOP 2WLVB 2WLVA 3CCQP 1VQPP 1L0IA 2K92A 2MR8A 3CCRP 2KGDA 2LF4A 5JPAA 4DGEC 2XXMA 1Q81Q 5HGNA 3E2DA 1YHQP 4U0AA 1M74A 1M9XC 2FQ1A 2FQ2A 4E92A 4F37A 1L0HA 2CG5B 3DS5A 1D1DA 1NJIQ 2QA4P 2P9XA 4PH2A 1VQ7P 4COCA 1M9CC 2LMLA 2VLPA 5HGMA 2L6EA 1M6EX 1HQBA 2JPRA 1VQ8P 1X3OA 1OR5A 3DS3A 1HY8A 3DS4A 3CPWO 1UNKA 2VLOA 5F2NA 3HZQA 2X83A 2XGVA 2FQ0A 2N5IA 2Z44A 3EJBA 1E0HA 4HTWA 2KR5A 1JJ2O 2KGCA 1QVGO 1M1KQ 4HKGA 1BAJA 1G03A 4NEOA 2PWOA 2GZIA 2PEOA 4COPA 1IUQA 2K0XA 1N8RQ 4U0BA 1GPJA 1M90Q 3CC7P 1KD1Q 4QKOA 5DCKA 4DGAC 1F80D 4MRTC 3CCJP 2MVVA 4PXHB 2XV6A 1AYIA 3H4EA 2LTEA 1K73Q 1EIAA 4LQWC 3WBHA 4XFXA 2LIWA 2KG9A 3M1MA 4IZ6A 2N6ZA 4QNBA 2WPTA 2VLNA 2XZ1C 2VLQA 1U7KA 2L9FA 2OTJP 2FACA 2K0DX 2JYGA 3CXCO 2GOLB 4IPYA 4PWVB 1AUMA 3I55P 1GXGA 2GONA 5BS1A 4U0DA 3VRLC 5BS2A 4DG9A 3P05A 1YIJP 3EJDA 1M9YC 3CCSP 2XGUA 1M6NA 2EG5A 3DS1A 2AVAA 2FVFA 2MY5A 1YJNP 2MVUA 1CEIA 2PEKA 3G29A 5KP6B 2L4BA 2PXRC 2QEXP 3U43A 2KGFA 1Z6MA 2ROQA 1FR2A 2MR7A 2JGPA 2N6YA 3MGEA 3HYBA 2E1MA 2QNWA 1VHNA 1VQ6P 2KOPA 1YITP 1ZMBA 2KGEA 2GDYA 1AF8A 2OARA 2ERHA 2M8PA 2FAEA 4NX4C 4J93A 1T8KA 3GZLA 2X2DD 2KW2A 4U0CA 2Z46A 2GZJA 3CCUP 3CCVP 1VQ4P 2OTLP 4GR2A 2LIUA 3CC4P 3G4SP 5CZDB 1A43A 2AFDA 1KLPA 2JO0A 1EM9A 3G0VA 3G28A 1S72P 2LKIA 1GXHA 2PEIA 2KORA 1KC8Q 3H0DA 2K2QA 2KOOA 3DPHA 2JU1A 1Q7YQ 2Z45A 3H47A 1A8OA 4INBA 2MF4A 2KWLA 2EHTA 2GDXA 2DNWA 3CD6P 2LL8A 1L6NA 4XROA 3OW2O 3LMOA 3RG2A 5HV8A 4UHPB 2FVEA 1VQMP 2CQ8A 1M9FC 2AFEA 2V4XA 1NQ4A 1IMPA 1P7NA 1DNYA 3DS0A 2X82A 1YJ9P 2K94A 3G71P 1K9MQ 3G21A 5EJDA 4B4NA 4BPGA 5EW5E 3BP9A 3G26A 2EHSA 3NY7B 5I4TG 2JYLA 4M0IA 3DS2A 2CWOA 2DGYA 2JB0A 2KODA 7CEIA 2M8LA 4H2WC 2K0YA 2LOLA 1VQLP 1RNIA 3NTEA 2NO8A 4BPHA 2X2BA 3DTJA 1MZ8A 1QVFO 2PNGA 2CGQA 2EFJA 2GZGA 4U0EA 1YJWP 4H2YC 1UJZA 3CMEP 4U0FA 3GKLC 2LPKA 3GJNA 3B5IA 5HGKA
chains in the Genus database with same CATH topology
3G4SP 2PY8A 1EOQA 2XT1A 5DCKA 1VQ9P 4DGAC 1A43A 4PH1A 1K8AQ 2JO0A 1EM9A 4GR6A 3G0VA 3G28A 3CCJP 1S72P 2EIAA 2XV6A 3CCMP 1VQOP 2PEIA 2WLVB 2WLVA 1KC8Q 3H4EA 4PH3A 3CCQP 1VQNP 1VQPP 1RO2A 3H0DA 1K73Q 3G1IA 2Y4ZA 1EIAA 4LQWC 3DPHA 5F2OA 3G1GA 3WBHA 4XFXA 1E6JP 5HGLA 4E91A 2Z45A 1Q7YQ 3CC2P 3M1MA 3H47A 1A8OA 3CCRP 1Q86Q 4QNBA 3CMAP 1AK4C 4INBA 2XDEA 4XRQA 1U7KA 2LF4A 5JPAA 1VQ5P 2OTJP 3CD6P 4DGEC 2XXMA 3LRYA 1Q81Q 5HGNA 2XGYA 1L6NA 4XROA 3E2DA 1YHQP 1W2BO 4U0AA 1M74A 2JYGA 3RG6C 3CXCO 3OW2O 1M9DC 2GOLB 4IPYA 1K30A 1M9XC 4E92A 1AUMA 1VQMP 3CCEP 3I55P 1M9FC 3DS5A 1D1DA 1NJIQ 2V4XA 2QA4P 2P9XA 4PH2A 4XFYA 2GONA 4COCA 4PH0A 5BS1A 1VQ7P 1M9CC 1GWPA 1P7NA 4U0DA 3VRLC 5BS2A 4WYMA 3I56P 3P05A 5HGMA 3DS0A 1YIJP 1KQSO 1M9YC 2X82A 3CCSP 2XGUA 1YJ9P 1M6NA 2EG5A 2PEJA 1QRJA 3DS1A 3G71P 2L6EA 1M6EX 1K9MQ 1YJNP 3CCLP 3G21A 4B4NA 3G26A 2JPRA 3BP9A 2PEKA 3G29A 1VQ8P 5I4TG 2JYLA 2PXRC 4M0IA 2QEXP 3DS3A 2CWOA 3DS2A 1AFVA 2DGYA 2BUOA 3DS4A 3G6EP 3CPWO 1RO0A 5F2NA 1YI2P 3HZQA 2KGFA 2PEQA 2X83A 2XGVA 2KODA 1Q82Q 2PENA 3MGEA 2Z44A 2M8LA 4HTWA 1JJ2O 5HGOA 2PEMA 3HYBA 1VQLP 1QVGO 2E1MA 1RNIA 1M1KQ 2M8NA 1BAJA 1VQ6P 3NTEA 1G03A 1YITP 1ZMBA 2PWMA 3DTJA 2PWOA 5F2KA 1QVFO 2BHVA 2EFJA 3Q20A 2OARA 2PEOA 4U0EA 4COPA 2M8PA 2ONTA 1IUQA 4NX4C 1YJWP 4J93A 1M9EC 2X2DD 1VQKP 4U0CA 2Z46A 3CMEP 3CCUP 4U0FA 3CCVP 4XFZA 1N8RQ 4U0BA 3CC7P 1M90Q 1KD1Q 1VQ4P 2OTLP 4GR2A 3CC4P 3B5IA 5HGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOQ A;  2XT1 A;  5DCK A;  4DGA C;  1A43 A;  4PH1 A;  2JO0 A;  1EM9 A;  3G0V A;  3G28 A;  2EIA A;  2XV6 A;  2WLV B;  2WLV A;  3H4E A;  4PH3 A;  3G1I A;  2Y4Z A;  1EIA A;  4LQW C;  3DPH A;  3G1G A;  4XFX A;  1E6J P;  5HGL A;  4E91 A;  3H47 A;  1A8O A;  4QNB A;  1AK4 C;  4INB A;  2XDE A;  4XRQ A;  1U7K A;  2LF4 A;  5JPA A;  4DGE C;  2XXM A;  3LRY A;  5HGN A;  2XGY A;  1L6N A;  4XRO A;  4U0A A;  2JYG A;  1M9D C;  2GOL B;  4IPY A;  1M9X C;  4E92 A;  1AUM A;  1M9F C;  3DS5 A;  1D1D A;  2V4X A;  4PH2 A;  4XFY A;  2GON A;  4COC A;  4PH0 A;  1M9C C;  1GWP A;  1P7N A;  4U0D A;  3VRL C;  4WYM A;  3P05 A;  5HGM A;  3DS0 A;  1M9Y C;  2X82 A;  2XGU A;  3DS1 A;  1QRJ A;  2L6E A;  3G21 A;  4B4N A;  3G26 A;  2JPR A;  3BP9 A;  3G29 A;  5I4T G;  2JYL A;  2PXR C;  4M0I A;  3DS3 A;  3DS2 A;  1AFV A;  2BUO A;  3DS4 A;  2KGF A;  2X83 A;  2XGV A;  2KOD A;  3MGE A;  2M8L A;  4HTW A;  5HGO A;  2M8N A;  1BAJ A;  3NTE A;  1G03 A;  2PWM A;  3DTJ A;  2PWO A;  4COP A;  4U0E A;  2M8P A;  2ONT A;  4NX4 C;  4J93 A;  1M9E C;  2X2D D;  4U0C A;  4U0F A;  4XFZ A;  4U0B A;  5HGK A; 
#chains in the Genus database with same CATH topology
 2PY8 A;  1EOQ A;  1VQ9 P;  2XZ0 D;  1K8A Q;  3CCM P;  4PH3 A;  1VQN P;  1RO2 A;  2JBG A;  3G1I A;  1IMQ A;  2Y4Z A;  5F2O A;  3G1G A;  2KG6 A;  1E6J P;  5HGL A;  4E91 A;  3CC2 P;  5KP8 B;  1Q86 Q;  2FHS C;  3CMA P;  2K5X A;  1AK4 C;  2XDE A;  4XRQ A;  5HVC A;  2FVA A;  4R0M A;  1VQ5 P;  3LRY A;  2XGY A;  2GYK A;  1W2B O;  3RG6 C;  3EJE A;  2M5R A;  1M9D C;  4BPF A;  1K30 A;  2JAZ A;  2JQ4 A;  1ZNV A;  3CCE P;  1EMV A;  4CA3 A;  2MD9 A;  4XFY A;  4PH0 A;  2L22 A;  1DV5 A;  1GWP A;  4WYM A;  3I56 P;  2KG8 A;  1KQS O;  3B4Q A;  2FAD A;  3CE7 A;  2PEJ A;  1QRJ A;  2N98 A;  3CCL P;  4H2X C;  1VKU A;  1AFV A;  2JU2 A;  2BUO A;  3G6E P;  1RO0 A;  2N50 A;  1YI2 P;  2PEQ A;  2VSQ A;  1Q82 Q;  2PEN A;  2KOQ A;  2GZF A;  5HGO A;  1BXI A;  2PEM A;  2N5H A;  3GZM A;  2M8N A;  2PWM A;  2AF8 A;  2K93 A;  1ACP A;  5F2K A;  2BHV A;  2KGA A;  3Q20 A;  2KOS A;  2ONT A;  2L0Q A;  1M9E C;  1VQK P;  4XFZ A;  5KP7 B;  2XT1 A;  4PH1 A;  2GDW A;  4GR6 A;  2EIA A;  2GZE A;  2CNR A;  1VQO P;  2WLV B;  2WLV A;  3CCQ P;  1VQP P;  1L0I A;  2K92 A;  2MR8 A;  3CCR P;  2KGD A;  2LF4 A;  5JPA A;  4DGE C;  2XXM A;  1Q81 Q;  5HGN A;  3E2D A;  1YHQ P;  4U0A A;  1M74 A;  1M9X C;  2FQ1 A;  2FQ2 A;  4E92 A;  4F37 A;  1L0H A;  2CG5 B;  3DS5 A;  1D1D A;  1NJI Q;  2QA4 P;  2P9X A;  4PH2 A;  1VQ7 P;  4COC A;  1M9C C;  2LML A;  2VLP A;  5HGM A;  2L6E A;  1M6E X;  1HQB A;  2JPR A;  1VQ8 P;  1X3O A;  1OR5 A;  3DS3 A;  1HY8 A;  3DS4 A;  3CPW O;  1UNK A;  2VLO A;  5F2N A;  3HZQ A;  2X83 A;  2XGV A;  2FQ0 A;  2N5I A;  2Z44 A;  3EJB A;  1E0H A;  4HTW A;  2KR5 A;  1JJ2 O;  2KGC A;  1QVG O;  1M1K Q;  4HKG A;  1BAJ A;  1G03 A;  4NEO A;  2PWO A;  2GZI A;  2PEO A;  4COP A;  1IUQ A;  2K0X A;  1N8R Q;  4U0B A;  1GPJ A;  1M90 Q;  3CC7 P;  1KD1 Q;  4QKO A;  5DCK A;  4DGA C;  1F80 D;  4MRT C;  3CCJ P;  2MVV A;  4PXH B;  2XV6 A;  1AYI A;  3H4E A;  2LTE A;  1K73 Q;  1EIA A;  4LQW C;  3WBH A;  4XFX A;  2LIW A;  2KG9 A;  3M1M A;  4IZ6 A;  2N6Z A;  4QNB A;  2WPT A;  2VLN A;  2XZ1 C;  2VLQ A;  1U7K A;  2L9F A;  2OTJ P;  2FAC A;  2K0D X;  2JYG A;  3CXC O;  2GOL B;  4IPY A;  4PWV B;  1AUM A;  3I55 P;  1GXG A;  2GON A;  5BS1 A;  4U0D A;  3VRL C;  5BS2 A;  4DG9 A;  3P05 A;  1YIJ P;  3EJD A;  1M9Y C;  3CCS P;  2XGU A;  1M6N A;  2EG5 A;  3DS1 A;  2AVA A;  2FVF A;  2MY5 A;  1YJN P;  2MVU A;  1CEI A;  2PEK A;  3G29 A;  5KP6 B;  2L4B A;  2PXR C;  2QEX P;  3U43 A;  2KGF A;  1Z6M A;  2ROQ A;  1FR2 A;  2MR7 A;  2JGP A;  2N6Y A;  3MGE A;  3HYB A;  2E1M A;  2QNW A;  1VHN A;  1VQ6 P;  2KOP A;  1YIT P;  1ZMB A;  2KGE A;  2GDY A;  1AF8 A;  2OAR A;  2ERH A;  2M8P A;  2FAE A;  4NX4 C;  4J93 A;  1T8K A;  3GZL A;  2X2D D;  2KW2 A;  4U0C A;  2Z46 A;  2GZJ A;  3CCU P;  3CCV P;  1VQ4 P;  2OTL P;  4GR2 A;  2LIU A;  3CC4 P;  3G4S P;  5CZD B;  1A43 A;  2AFD A;  1KLP A;  2JO0 A;  1EM9 A;  3G0V A;  3G28 A;  1S72 P;  2LKI A;  1GXH A;  2PEI A;  2KOR A;  1KC8 Q;  3H0D A;  2K2Q A;  2KOO A;  3DPH A;  2JU1 A;  1Q7Y Q;  2Z45 A;  3H47 A;  1A8O A;  4INB A;  2MF4 A;  2KWL A;  2EHT A;  2GDX A;  2DNW A;  3CD6 P;  2LL8 A;  1L6N A;  4XRO A;  3OW2 O;  3LMO A;  3RG2 A;  5HV8 A;  4UHP B;  2FVE A;  1VQM P;  2CQ8 A;  1M9F C;  2AFE A;  2V4X A;  1NQ4 A;  1IMP A;  1P7N A;  1DNY A;  3DS0 A;  2X82 A;  1YJ9 P;  2K94 A;  3G71 P;  1K9M Q;  3G21 A;  5EJD A;  4B4N A;  4BPG A;  5EW5 E;  3BP9 A;  3G26 A;  2EHS A;  3NY7 B;  5I4T G;  2JYL A;  4M0I A;  3DS2 A;  2CWO A;  2DGY A;  2JB0 A;  2KOD A;  7CEI A;  2M8L A;  4H2W C;  2K0Y A;  2LOL A;  1VQL P;  1RNI A;  3NTE A;  2NO8 A;  4BPH A;  2X2B A;  3DTJ A;  1MZ8 A;  1QVF O;  2PNG A;  2CGQ A;  2EFJ A;  2GZG A;  4U0E A;  1YJW P;  4H2Y C;  1UJZ A;  3CME P;  4U0F A;  3GKL C;  2LPK A;  3GJN A;  3B5I A;  5HGK A; 
#chains in the Genus database with same CATH homology
 3G4S P;  2PY8 A;  1EOQ A;  2XT1 A;  5DCK A;  1VQ9 P;  4DGA C;  1A43 A;  4PH1 A;  1K8A Q;  2JO0 A;  1EM9 A;  4GR6 A;  3G0V A;  3G28 A;  3CCJ P;  1S72 P;  2EIA A;  2XV6 A;  3CCM P;  1VQO P;  2PEI A;  2WLV B;  2WLV A;  1KC8 Q;  3H4E A;  4PH3 A;  3CCQ P;  1VQN P;  1VQP P;  1RO2 A;  3H0D A;  1K73 Q;  3G1I A;  2Y4Z A;  1EIA A;  4LQW C;  3DPH A;  5F2O A;  3G1G A;  3WBH A;  4XFX A;  1E6J P;  5HGL A;  4E91 A;  2Z45 A;  1Q7Y Q;  3CC2 P;  3M1M A;  3H47 A;  1A8O A;  3CCR P;  1Q86 Q;  4QNB A;  3CMA P;  1AK4 C;  4INB A;  2XDE A;  4XRQ A;  1U7K A;  2LF4 A;  5JPA A;  1VQ5 P;  2OTJ P;  3CD6 P;  4DGE C;  2XXM A;  3LRY A;  1Q81 Q;  5HGN A;  2XGY A;  1L6N A;  4XRO A;  3E2D A;  1YHQ P;  1W2B O;  4U0A A;  1M74 A;  2JYG A;  3RG6 C;  3CXC O;  3OW2 O;  1M9D C;  2GOL B;  4IPY A;  1K30 A;  1M9X C;  4E92 A;  1AUM A;  1VQM P;  3CCE P;  3I55 P;  1M9F C;  3DS5 A;  1D1D A;  1NJI Q;  2V4X A;  2QA4 P;  2P9X A;  4PH2 A;  4XFY A;  2GON A;  4COC A;  4PH0 A;  5BS1 A;  1VQ7 P;  1M9C C;  1GWP A;  1P7N A;  4U0D A;  3VRL C;  5BS2 A;  4WYM A;  3I56 P;  3P05 A;  5HGM A;  3DS0 A;  1YIJ P;  1KQS O;  1M9Y C;  2X82 A;  3CCS P;  2XGU A;  1YJ9 P;  1M6N A;  2EG5 A;  2PEJ A;  1QRJ A;  3DS1 A;  3G71 P;  2L6E A;  1M6E X;  1K9M Q;  1YJN P;  3CCL P;  3G21 A;  4B4N A;  3G26 A;  2JPR A;  3BP9 A;  2PEK A;  3G29 A;  1VQ8 P;  5I4T G;  2JYL A;  2PXR C;  4M0I A;  2QEX P;  3DS3 A;  2CWO A;  3DS2 A;  1AFV A;  2DGY A;  2BUO A;  3DS4 A;  3G6E P;  3CPW O;  1RO0 A;  5F2N A;  1YI2 P;  3HZQ A;  2KGF A;  2PEQ A;  2X83 A;  2XGV A;  2KOD A;  1Q82 Q;  2PEN A;  3MGE A;  2Z44 A;  2M8L A;  4HTW A;  1JJ2 O;  5HGO A;  2PEM A;  3HYB A;  1VQL P;  1QVG O;  2E1M A;  1RNI A;  1M1K Q;  2M8N A;  1BAJ A;  1VQ6 P;  3NTE A;  1G03 A;  1YIT P;  1ZMB A;  2PWM A;  3DTJ A;  2PWO A;  5F2K A;  1QVF O;  2BHV A;  2EFJ A;  3Q20 A;  2OAR A;  2PEO A;  4U0E A;  4COP A;  2M8P A;  2ONT A;  1IUQ A;  4NX4 C;  1YJW P;  4J93 A;  1M9E C;  2X2D D;  1VQK P;  4U0C A;  2Z46 A;  3CME P;  3CCU P;  4U0F A;  3CCV P;  4XFZ A;  1N8R Q;  4U0B A;  3CC7 P;  1M90 Q;  1KD1 Q;  1VQ4 P;  2OTL P;  4GR2 A;  3CC4 P;  3B5I A;  5HGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...