4U0AA

Hexameric hiv-1 ca in complex with cpsf6 peptide, p6 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
208
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 70
structure length 208
sequence length 220
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0aA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0aA02
3G28A 4U0FA 3NTEA 1L6NA 4U0EA 4DGEC 3G1GA 4U0AA 3G29A 4PH3A 4XFZA 2KODA 4E92A 1M9EC 2XT1A 2ONTA 4XFYA 5HGNA 1QRJA 4M0IA 2PWOA 5DCKA 5HGLA 4COPA 4PH0A 1EM9A 4PH2A 1GWPA 2XGUA 4XFXA 3DPHA 3DS3A 2XGVA 2WLVB 5HGOA 3MGEA 1A8OA 4WYMA 2JYLA 1M9CC 4U0BA 4E91A 4B4NA 1M9FC 2JYGA 4U0DA 2XDEA 4LQWC 2BUOA 3DTJA 4HTWA 4PH1A 2KGFA 2Y4ZA 4NX4C 2XV6A 1D1DA 3DS4A 2V4XA 3BP9A 1M9XC 3LRYA 5HGKA 1BAJA 1EIAA 2M8NA 1P7NA 2EIAA 2M8PA 3G0VA 2WLVA 4U0CA 2XXMA 1M9YC 4XRQA 1AFVA 3VRLC 1AUMA 5I4TG 3P05A 5JPAA 4QNBA 3H47A 2PXRC 4COCA 2LF4A 1G03A 3DS1A 3H4EA 4DGAC 2X83A 2JPRA 4J93A 2GONA 3G1IA 3G21A 3DS5A 2JO0A 2L6EA 2XGYA 1A43A 2GOLB 1EOQA 4XROA 5HGMA 2PWMA 1M9DC 3DS2A 3G26A 1E6JP 2M8LA 4IPYA 2X82A 1U7KA 1AK4C 3DS0A 2X2DD 4INBA
chains in the Genus database with same CATH superfamily
1T8KA 1Q81Q 3RG6C 3CD6P 2JB0A 4U0EA 1L0HA 4U0AA 1KQSO 4PH3A 1GXGA 2XT1A 1VQNP 5HGNA 1QRJA 2FQ1A 1DV5A 5DCKA 2Z44A 4PXHB 2N6YA 5HGLA 1UJZA 4PH0A 2QNWA 2JU1A 2MR7A 2XGUA 2KGAA 2GDWA 5F2KA 3U43A 3I55P 1VQOP 2AFEA 3HZQA 2X2BA 2LOLA 7CEIA 3DS3A 2MVVA 5HGOA 4U0BA 2K5XA 2CG5B 1F80D 2XDEA 3DTJA 1CEIA 1YITP 2FQ0A 2L0QA 2KG6A 2KOOA 1VQ9P 2JAZA 1D1DA 4H2WC 2EHSA 5EW5E 3BP9A 2FVFA 3LRYA 1BAJA 1OR5A 3G0VA 2FACA 2KOQA 2XXMA 4H2XC 1VQKP 1AFVA 3VRLC 3OW2O 1M90Q 1YJWP 2WPTA 1FR2A 5F2NA 3H47A 1VHNA 1NQ4A 4COCA 4QKOA 2EFJA 2GDXA 2JPRA 4HKGA 3G1IA 3G21A 2JO0A 2L6EA 1VQLP 2VLOA 2XGYA 2OTLP 1K30A 4XROA 2VLNA 3DS2A 3G26A 2M8LA 4PWVB 1AK4C 4INBA 3G28A 1VQMP 2QA4P 1L6NA 3G6EP 1Q7YQ 2KOPA 1Q82Q 4DGEC 3G1GA 3G29A 4XFZA 4H2YC 4E92A 1M9EC 1YJ9P 1GPJA 2N6ZA 4COPA 4R0MA 2PEIA 2KG8A 2KGEA 2N50A 2AF8A 1ACPA 3DPHA 5HVCA 3B5IA 1QVFO 3MGEA 1E0HA 1QVGO 3H0DA 4E91A 4B4NA 1M9FC 4LQWC 1YIJP 4PH1A 1VQ6P 2KGFA 1EMVA 2AVAA 3WBHA 2V4XA 2VSQA 1UNKA 1M9XC 2L9FA 2P9XA 1EIAA 2M8NA 1P7NA 1VQ8P 2JU2A 1HY8A 2FADA 3Q20A 5CZDB 2WLVA 1M9YC 5KP8B 4XRQA 3CPWO 1ZNVA 2CQ8A 2FQ2A 3G71P 3CCUP 3CCEP 4QNBA 3CE7A 5KP7B 3GZLA 2LF4A 2KWLA 3H4EA 2AFDA 3HYBA 2CNRA 1K73Q 2OTJP 2KGDA 3CC2P 2CWOA 2FVAA 2DNWA 2K92A 1A43A 2ROQA 3GKLC 1JJ2O 1W2BO 1M9DC 3NY7B 3LMOA 2FHSC 2K0XA 3E2DA 1AF8A 1YHQP 2N98A 2N5IA 2PEJA 3NTEA 1MZ8A 1KC8Q 1VQ7P 2MVUA 3CCSP 2ONTA 3RG2A 3CCVP 1YI2P 1ZMBA 2OARA 2XZ0D 2LL8A 1KLPA 4PH2A 2Z45A 1RO0A 4DG9A 2NO8A 2GZJA 1VQ4P 4XFXA 1RO2A 1KD1Q 2QEXP 1DNYA 2XGVA 2FVEA 2WLVB 2K94A 2KG9A 2LMLA 4GR6A 4WYMA 2JYLA 3EJDA 4NEOA 2JGPA 2Z46A 2EHTA 2K0YA 2K93A 4HTWA 2Y4ZA 4NX4C 3I56P 1HQBA 5HGKA 3EJEA 2PEOA 1M1KQ 2PEKA 2LTEA 2EIAA 2E1MA 1RNIA 1X3OA 2PNGA 2PY8A 3G4SP 4U0CA 4IZ6A 2GZEA 5BS1A 5BS2A 1Q86Q 2GZFA 2LPKA 1L0IA 1G03A 2PEMA 4DGAC 1AYIA 2X83A 4J93A 3CCQP 2GONA 2DGYA 2MF4A 2GZGA 1BXIA 2MR8A 3DS5A 3CC7P 1EOQA 2M5RA 5HGMA 3CC4P 1VKUA 1E6JP 4IPYA 2GYKA 1U7KA 2L22A 5KP6B 4U0FA 4GR2A 4BPHA 2KR5A 2L4BA 3EJBA 2KODA 4XFYA 2K2QA 1IMPA 2FAEA 2LIUA 4M0IA 2PWOA 2KGCA 4BPFA 1M6NA 3M1MA 1EM9A 1GWPA 1K8AQ 4UHPB 2EG5A 2PEQA 4CA3A 3CCRP 3CCMP 1A8OA 2KOSA 1M9CC 2N5HA 2JYGA 4U0DA 2GDYA 2BUOA 2VLQA 2VLPA 3CMEP 3CMAP 2MD9A 5F2OA 2XV6A 2JQ4A 3DS4A 1GXHA 4F37A 1N8RQ 2KORA 1M74A 3GJNA 1S72P 2M8PA 1M6EX 4MRTC 1IUQA 1VQ5P 3B4QA 1AUMA 5I4TG 2CGQA 3P05A 5JPAA 2LKIA 3CCLP 1K9MQ 2PXRC 4BPGA 3DS1A 2LIWA 2KW2A 2BHVA 3CXCO 2ERHA 2XZ1C 1IMQA 1VQPP 5EJDA 2K0DX 5HV8A 2PENA 2GOLB 3CCJP 1YJNP 2JBGA 2GZIA 2PWMA 1NJIQ 3GZMA 2X82A 2MY5A 1Z6MA 3DS0A 2X2DD
chains in the Genus database with same CATH topology
1YHQP 3G28A 1VQMP 2QA4P 2PEJA 1Q81Q 4U0FA 3NTEA 1L6NA 4GR2A 3RG6C 3G6EP 1Q7YQ 1KC8Q 3CD6P 1VQ7P 4U0EA 4DGEC 3G1GA 4U0AA 3G29A 1Q82Q 1KQSO 4PH3A 3CCSP 4XFZA 2KODA 4E92A 1M9EC 2XT1A 2ONTA 4XFYA 1VQNP 5HGNA 1QRJA 3CCVP 1YI2P 4M0IA 1ZMBA 2PWOA 5DCKA 2Z44A 1YJ9P 2OARA 1M6NA 3M1MA 5HGLA 4COPA 4PH0A 1EM9A 4PH2A 2Z45A 2PEIA 1GWPA 1RO0A 1K8AQ 2XGUA 5F2KA 2EG5A 1VQ4P 3I55P 1VQOP 4XFXA 1RO2A 1KD1Q 3HZQA 2PEQA 3DPHA 2QEXP 3CCRP 3DS3A 3B5IA 2XGVA 2WLVB 5HGOA 3CCMP 1QVFO 3MGEA 1A8OA 4GR6A 4WYMA 1QVGO 3H0DA 2JYLA 1M9CC 4U0BA 4E91A 4B4NA 2Z46A 1M9FC 2JYGA 4U0DA 2XDEA 4LQWC 2BUOA 3DTJA 1YIJP 4HTWA 3CMEP 4PH1A 1YITP 1VQ6P 2KGFA 3CMAP 3WBHA 2Y4ZA 4NX4C 5F2OA 1VQ9P 2XV6A 1D1DA 3I56P 3DS4A 2V4XA 1N8RQ 3BP9A 1M74A 1M9XC 3LRYA 5HGKA 1BAJA 2P9XA 1EIAA 2PEOA 1M1KQ 2M8NA 1P7NA 2PEKA 1S72P 1VQ8P 2EIAA 2E1MA 1RNIA 2M8PA 3G0VA 1M6EX 3Q20A 2WLVA 2PY8A 1IUQA 3G4SP 4U0CA 2XXMA 1VQ5P 1M9YC 1VQKP 4XRQA 1AFVA 3VRLC 3CPWO 3OW2O 1AUMA 5I4TG 1M90Q 3G71P 3P05A 3CCUP 3CCEP 1YJWP 5JPAA 5BS1A 5F2NA 5BS2A 4QNBA 3H47A 3CCLP 1K9MQ 2PXRC 1Q86Q 4COCA 2LF4A 1G03A 3DS1A 2EFJA 3H4EA 2BHVA 2PEMA 3CXCO 4DGAC 2OTJP 3HYBA 2X83A 1K73Q 2JPRA 4J93A 3CCQP 1VQPP 2GONA 2DGYA 3CC2P 2CWOA 3G1IA 3G21A 3DS5A 2JO0A 3CC7P 2L6EA 1VQLP 2PENA 2XGYA 1A43A 2OTLP 1K30A 2GOLB 1EOQA 3CCJP 1YJNP 1JJ2O 4XROA 5HGMA 1W2BO 2PWMA 1M9DC 3CC4P 1NJIQ 3DS2A 3G26A 1E6JP 2M8LA 4IPYA 3E2DA 2X82A 1U7KA 1AK4C 3DS0A 2X2DD 4INBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G28 A;  4U0F A;  3NTE A;  1L6N A;  4U0E A;  4DGE C;  3G1G A;  4U0A A;  3G29 A;  4PH3 A;  4XFZ A;  2KOD A;  4E92 A;  1M9E C;  2XT1 A;  2ONT A;  4XFY A;  5HGN A;  1QRJ A;  4M0I A;  2PWO A;  5DCK A;  5HGL A;  4COP A;  4PH0 A;  1EM9 A;  4PH2 A;  1GWP A;  2XGU A;  4XFX A;  3DPH A;  3DS3 A;  2XGV A;  2WLV B;  5HGO A;  3MGE A;  1A8O A;  4WYM A;  2JYL A;  1M9C C;  4U0B A;  4E91 A;  4B4N A;  1M9F C;  2JYG A;  4U0D A;  2XDE A;  4LQW C;  2BUO A;  3DTJ A;  4HTW A;  4PH1 A;  2KGF A;  2Y4Z A;  4NX4 C;  2XV6 A;  1D1D A;  3DS4 A;  2V4X A;  3BP9 A;  1M9X C;  3LRY A;  5HGK A;  1BAJ A;  1EIA A;  2M8N A;  1P7N A;  2EIA A;  2M8P A;  3G0V A;  2WLV A;  4U0C A;  2XXM A;  1M9Y C;  4XRQ A;  1AFV A;  3VRL C;  1AUM A;  5I4T G;  3P05 A;  5JPA A;  4QNB A;  3H47 A;  2PXR C;  4COC A;  2LF4 A;  1G03 A;  3DS1 A;  3H4E A;  4DGA C;  2X83 A;  2JPR A;  4J93 A;  2GON A;  3G1I A;  3G21 A;  3DS5 A;  2JO0 A;  2L6E A;  2XGY A;  1A43 A;  2GOL B;  1EOQ A;  4XRO A;  5HGM A;  2PWM A;  1M9D C;  3DS2 A;  3G26 A;  1E6J P;  2M8L A;  4IPY A;  2X82 A;  1U7K A;  1AK4 C;  3DS0 A;  2X2D D;  4INB A; 
#chains in the Genus database with same CATH topology
 1T8K A;  1Q81 Q;  3RG6 C;  3CD6 P;  2JB0 A;  4U0E A;  1L0H A;  4U0A A;  1KQS O;  4PH3 A;  1GXG A;  2XT1 A;  1VQN P;  5HGN A;  1QRJ A;  2FQ1 A;  1DV5 A;  5DCK A;  2Z44 A;  4PXH B;  2N6Y A;  5HGL A;  1UJZ A;  4PH0 A;  2QNW A;  2JU1 A;  2MR7 A;  2XGU A;  2KGA A;  2GDW A;  5F2K A;  3U43 A;  3I55 P;  1VQO P;  2AFE A;  3HZQ A;  2X2B A;  2LOL A;  7CEI A;  3DS3 A;  2MVV A;  5HGO A;  4U0B A;  2K5X A;  2CG5 B;  1F80 D;  2XDE A;  3DTJ A;  1CEI A;  1YIT P;  2FQ0 A;  2L0Q A;  2KG6 A;  2KOO A;  1VQ9 P;  2JAZ A;  1D1D A;  4H2W C;  2EHS A;  5EW5 E;  3BP9 A;  2FVF A;  3LRY A;  1BAJ A;  1OR5 A;  3G0V A;  2FAC A;  2KOQ A;  2XXM A;  4H2X C;  1VQK P;  1AFV A;  3VRL C;  3OW2 O;  1M90 Q;  1YJW P;  2WPT A;  1FR2 A;  5F2N A;  3H47 A;  1VHN A;  1NQ4 A;  4COC A;  4QKO A;  2EFJ A;  2GDX A;  2JPR A;  4HKG A;  3G1I A;  3G21 A;  2JO0 A;  2L6E A;  1VQL P;  2VLO A;  2XGY A;  2OTL P;  1K30 A;  4XRO A;  2VLN A;  3DS2 A;  3G26 A;  2M8L A;  4PWV B;  1AK4 C;  4INB A;  3G28 A;  1VQM P;  2QA4 P;  1L6N A;  3G6E P;  1Q7Y Q;  2KOP A;  1Q82 Q;  4DGE C;  3G1G A;  3G29 A;  4XFZ A;  4H2Y C;  4E92 A;  1M9E C;  1YJ9 P;  1GPJ A;  2N6Z A;  4COP A;  4R0M A;  2PEI A;  2KG8 A;  2KGE A;  2N50 A;  2AF8 A;  1ACP A;  3DPH A;  5HVC A;  3B5I A;  1QVF O;  3MGE A;  1E0H A;  1QVG O;  3H0D A;  4E91 A;  4B4N A;  1M9F C;  4LQW C;  1YIJ P;  4PH1 A;  1VQ6 P;  2KGF A;  1EMV A;  2AVA A;  3WBH A;  2V4X A;  2VSQ A;  1UNK A;  1M9X C;  2L9F A;  2P9X A;  1EIA A;  2M8N A;  1P7N A;  1VQ8 P;  2JU2 A;  1HY8 A;  2FAD A;  3Q20 A;  5CZD B;  2WLV A;  1M9Y C;  5KP8 B;  4XRQ A;  3CPW O;  1ZNV A;  2CQ8 A;  2FQ2 A;  3G71 P;  3CCU P;  3CCE P;  4QNB A;  3CE7 A;  5KP7 B;  3GZL A;  2LF4 A;  2KWL A;  3H4E A;  2AFD A;  3HYB A;  2CNR A;  1K73 Q;  2OTJ P;  2KGD A;  3CC2 P;  2CWO A;  2FVA A;  2DNW A;  2K92 A;  1A43 A;  2ROQ A;  3GKL C;  1JJ2 O;  1W2B O;  1M9D C;  3NY7 B;  3LMO A;  2FHS C;  2K0X A;  3E2D A;  1AF8 A;  1YHQ P;  2N98 A;  2N5I A;  2PEJ A;  3NTE A;  1MZ8 A;  1KC8 Q;  1VQ7 P;  2MVU A;  3CCS P;  2ONT A;  3RG2 A;  3CCV P;  1YI2 P;  1ZMB A;  2OAR A;  2XZ0 D;  2LL8 A;  1KLP A;  4PH2 A;  2Z45 A;  1RO0 A;  4DG9 A;  2NO8 A;  2GZJ A;  1VQ4 P;  4XFX A;  1RO2 A;  1KD1 Q;  2QEX P;  1DNY A;  2XGV A;  2FVE A;  2WLV B;  2K94 A;  2KG9 A;  2LML A;  4GR6 A;  4WYM A;  2JYL A;  3EJD A;  4NEO A;  2JGP A;  2Z46 A;  2EHT A;  2K0Y A;  2K93 A;  4HTW A;  2Y4Z A;  4NX4 C;  3I56 P;  1HQB A;  5HGK A;  3EJE A;  2PEO A;  1M1K Q;  2PEK A;  2LTE A;  2EIA A;  2E1M A;  1RNI A;  1X3O A;  2PNG A;  2PY8 A;  3G4S P;  4U0C A;  4IZ6 A;  2GZE A;  5BS1 A;  5BS2 A;  1Q86 Q;  2GZF A;  2LPK A;  1L0I A;  1G03 A;  2PEM A;  4DGA C;  1AYI A;  2X83 A;  4J93 A;  3CCQ P;  2GON A;  2DGY A;  2MF4 A;  2GZG A;  1BXI A;  2MR8 A;  3DS5 A;  3CC7 P;  1EOQ A;  2M5R A;  5HGM A;  3CC4 P;  1VKU A;  1E6J P;  4IPY A;  2GYK A;  1U7K A;  2L22 A;  5KP6 B;  4U0F A;  4GR2 A;  4BPH A;  2KR5 A;  2L4B A;  3EJB A;  2KOD A;  4XFY A;  2K2Q A;  1IMP A;  2FAE A;  2LIU A;  4M0I A;  2PWO A;  2KGC A;  4BPF A;  1M6N A;  3M1M A;  1EM9 A;  1GWP A;  1K8A Q;  4UHP B;  2EG5 A;  2PEQ A;  4CA3 A;  3CCR P;  3CCM P;  1A8O A;  2KOS A;  1M9C C;  2N5H A;  2JYG A;  4U0D A;  2GDY A;  2BUO A;  2VLQ A;  2VLP A;  3CME P;  3CMA P;  2MD9 A;  5F2O A;  2XV6 A;  2JQ4 A;  3DS4 A;  1GXH A;  4F37 A;  1N8R Q;  2KOR A;  1M74 A;  3GJN A;  1S72 P;  2M8P A;  1M6E X;  4MRT C;  1IUQ A;  1VQ5 P;  3B4Q A;  1AUM A;  5I4T G;  2CGQ A;  3P05 A;  5JPA A;  2LKI A;  3CCL P;  1K9M Q;  2PXR C;  4BPG A;  3DS1 A;  2LIW A;  2KW2 A;  2BHV A;  3CXC O;  2ERH A;  2XZ1 C;  1IMQ A;  1VQP P;  5EJD A;  2K0D X;  5HV8 A;  2PEN A;  2GOL B;  3CCJ P;  1YJN P;  2JBG A;  2GZI A;  2PWM A;  1NJI Q;  3GZM A;  2X82 A;  2MY5 A;  1Z6M A;  3DS0 A;  2X2D D; 
#chains in the Genus database with same CATH homology
 1YHQ P;  3G28 A;  1VQM P;  2QA4 P;  2PEJ A;  1Q81 Q;  4U0F A;  3NTE A;  1L6N A;  4GR2 A;  3RG6 C;  3G6E P;  1Q7Y Q;  1KC8 Q;  3CD6 P;  1VQ7 P;  4U0E A;  4DGE C;  3G1G A;  4U0A A;  3G29 A;  1Q82 Q;  1KQS O;  4PH3 A;  3CCS P;  4XFZ A;  2KOD A;  4E92 A;  1M9E C;  2XT1 A;  2ONT A;  4XFY A;  1VQN P;  5HGN A;  1QRJ A;  3CCV P;  1YI2 P;  4M0I A;  1ZMB A;  2PWO A;  5DCK A;  2Z44 A;  1YJ9 P;  2OAR A;  1M6N A;  3M1M A;  5HGL A;  4COP A;  4PH0 A;  1EM9 A;  4PH2 A;  2Z45 A;  2PEI A;  1GWP A;  1RO0 A;  1K8A Q;  2XGU A;  5F2K A;  2EG5 A;  1VQ4 P;  3I55 P;  1VQO P;  4XFX A;  1RO2 A;  1KD1 Q;  3HZQ A;  2PEQ A;  3DPH A;  2QEX P;  3CCR P;  3DS3 A;  3B5I A;  2XGV A;  2WLV B;  5HGO A;  3CCM P;  1QVF O;  3MGE A;  1A8O A;  4GR6 A;  4WYM A;  1QVG O;  3H0D A;  2JYL A;  1M9C C;  4U0B A;  4E91 A;  4B4N A;  2Z46 A;  1M9F C;  2JYG A;  4U0D A;  2XDE A;  4LQW C;  2BUO A;  3DTJ A;  1YIJ P;  4HTW A;  3CME P;  4PH1 A;  1YIT P;  1VQ6 P;  2KGF A;  3CMA P;  3WBH A;  2Y4Z A;  4NX4 C;  5F2O A;  1VQ9 P;  2XV6 A;  1D1D A;  3I56 P;  3DS4 A;  2V4X A;  1N8R Q;  3BP9 A;  1M74 A;  1M9X C;  3LRY A;  5HGK A;  1BAJ A;  2P9X A;  1EIA A;  2PEO A;  1M1K Q;  2M8N A;  1P7N A;  2PEK A;  1S72 P;  1VQ8 P;  2EIA A;  2E1M A;  1RNI A;  2M8P A;  3G0V A;  1M6E X;  3Q20 A;  2WLV A;  2PY8 A;  1IUQ A;  3G4S P;  4U0C A;  2XXM A;  1VQ5 P;  1M9Y C;  1VQK P;  4XRQ A;  1AFV A;  3VRL C;  3CPW O;  3OW2 O;  1AUM A;  5I4T G;  1M90 Q;  3G71 P;  3P05 A;  3CCU P;  3CCE P;  1YJW P;  5JPA A;  5BS1 A;  5F2N A;  5BS2 A;  4QNB A;  3H47 A;  3CCL P;  1K9M Q;  2PXR C;  1Q86 Q;  4COC A;  2LF4 A;  1G03 A;  3DS1 A;  2EFJ A;  3H4E A;  2BHV A;  2PEM A;  3CXC O;  4DGA C;  2OTJ P;  3HYB A;  2X83 A;  1K73 Q;  2JPR A;  4J93 A;  3CCQ P;  1VQP P;  2GON A;  2DGY A;  3CC2 P;  2CWO A;  3G1I A;  3G21 A;  3DS5 A;  2JO0 A;  3CC7 P;  2L6E A;  1VQL P;  2PEN A;  2XGY A;  1A43 A;  2OTL P;  1K30 A;  2GOL B;  1EOQ A;  3CCJ P;  1YJN P;  1JJ2 O;  4XRO A;  5HGM A;  1W2B O;  2PWM A;  1M9D C;  3CC4 P;  1NJI Q;  3DS2 A;  3G26 A;  1E6J P;  2M8L A;  4IPY A;  3E2D A;  2X82 A;  1U7K A;  1AK4 C;  3DS0 A;  2X2D D;  4INB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...