4U0AA

Hexameric hiv-1 ca in complex with cpsf6 peptide, p6 crystal form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
208
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 70
structure length 208
sequence length 220
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0aA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0aA02
4U0DA 4B4NA 1G03A 3DS3A 2M8NA 3VRLC 5I4TG 1U7KA 5HGOA 4E91A 4XFZA 5HGMA 4U0CA 2M8PA 1L6NA 2JYLA 1AFVA 1M9FC 2V4XA 4DGAC 3G1GA 3G1IA 3G0VA 3H47A 4PH1A 4LQWC 2ONTA 3G28A 1QRJA 4HTWA 4PH2A 4WYMA 4XFXA 1P7NA 2X82A 1BAJA 1EIAA 3DTJA 4U0AA 5HGNA 3DPHA 4COCA 1D1DA 4NX4C 4PH3A 2XGYA 3G26A 2WLVB 2XXMA 3BP9A 2M8LA 1AUMA 4XRQA 1E6JP 3G29A 4M0IA 1M9XC 2XV6A 1EM9A 3G21A 4COPA 2PWOA 1A43A 4U0FA 2XT1A 3DS0A 2JYGA 4XFYA 5JPAA 5HGLA 3LRYA 4U0EA 2GOLB 5DCKA 3H4EA 2L6EA 4E92A 2XGUA 2JO0A 4INBA 4PH0A 2LF4A 4DGEC 2WLVA 5HGKA 4QNBA 3DS2A 1M9DC 2KGFA 2X83A 2Y4ZA 4U0BA 3NTEA 1GWPA 1M9CC 2GONA 4IPYA 4XROA 2KODA 1AK4C 2EIAA 2XDEA 2BUOA 1EOQA 4J93A 2XGVA 1M9YC 3P05A 1A8OA 2JPRA 3DS1A 2X2DD 2PXRC 3DS4A 1M9EC 3MGEA 2PWMA 3DS5A
chains in the Genus database with same CATH superfamily
1RO2A 1F80D 2K0YA 2KG9A 1K8AQ 5I4TG 1N8RQ 1K73Q 3EJDA 3CCLP 4E91A 4MRTC 2QEXP 4XFZA 1IMQA 1L6NA 2JYLA 3CMAP 1QVFO 2V4XA 3CCQP 3G1GA 3G0VA 3E2DA 3EJEA 2ERHA 1IMPA 2PY8A 3G28A 2MD9A 4DG9A 2FVFA 2N5HA 2KOPA 1VQMP 2OARA 1BAJA 4U0AA 4R0MA 1Z6MA 1OR5A 2KORA 4NX4C 1X3OA 2KGAA 3CCMP 2XGYA 2GZFA 2XXMA 3BP9A 4XRQA 2ROQA 1M9XC 3G6EP 1EM9A 3G21A 1L0HA 2M5RA 2EHTA 2AFDA 1IUQA 4QKOA 1Q82Q 2GOLB 2Z45A 1DNYA 2Z46A 3RG2A 2JO0A 2KG8A 4NEOA 2WLVA 3DS2A 3I56P 2FAEA 2KWLA 4IZ6A 2Y4ZA 5EJDA 2JBGA 2GONA 1ZMBA 2L22A 1VQ6P 1M6NA 2KODA 1ACPA 1AK4C 2PEJA 1EOQA 1VQ8P 4F37A 2FACA 2XGVA 2GDXA 2L9FA 3G4SP 2MR8A 1A8OA 2JPRA 1MZ8A 1YITP 2PXRC 1UNKA 2E1MA 2KOSA 3MGEA 3HYBA 5KP6B 4U0DA 2K2QA 1G03A 3DS3A 2JGPA 2P9XA 1U7KA 2MVUA 1NQ4A 1AFVA 4H2YC 3H0DA 3G1IA 2L4BA 3H47A 2EFJA 4LQWC 3CCVP 3GKLC 2N98A 1GPJA 4PH2A 4PXHB 1KLPA 2AF8A 3CCUP 1NJIQ 1YJWP 2GZJA 2KG6A 3DPHA 1D1DA 1YJNP 2BHVA 2PNGA 2WLVB 1BXIA 3CE7A 2FQ1A 1AF8A 2K0DX 1AUMA 2AVAA 2GYKA 3CCJP 2JU1A 4COPA 2PWOA 1A43A 2QNWA 2LMLA 4GR6A 5EW5E 3DS0A 2KOOA 2EHSA 4BPGA 4XFYA 2GZGA 4U0EA 2FQ0A 2CNRA 2NO8A 4GR2A 3WBHA 1KC8Q 2GZEA 5HGKA 4QNBA 3CXCO 1E0HA 2K5XA 2LOLA 4U0BA 3NTEA 1GWPA 3OW2O 2LIWA 2JQ4A 3CC4P 2MR7A 1KQSO 1T8KA 2LKIA 4J93A 1VQ9P 5KP7B 2JU2A 2VLPA 1M9YC 3G71P 3DS1A 3RG6C 2X2DD 3U43A 1AYIA 3GJNA 2OTJP 2M8NA 5F2OA 1K9MQ 5HGOA 1HQBA 5HGMA 1GXHA 4U0CA 2KR5A 1M9FC 4BPHA 4H2WC 5F2NA 3CCRP 2K92A 4PH1A 2LTEA 1EMVA 1QRJA 2VLQA 2DNWA 2MVVA 2GDWA 3Q20A 4BPFA 3B5IA 1KD1Q 3DTJA 2MF4A 4PH3A 2JAZA 2CWOA 2DGYA 1CEIA 4UHPB 3CCSP 1E6JP 3G29A 1DV5A 2XZ1C 4M0IA 3CC2P 2XV6A 2X2BA 2XT1A 2N50A 1JJ2O 2JYGA 1VHNA 5HGLA 5DCKA 3H4EA 3HZQA 2L6EA 2N6YA 4E92A 5HV8A 7CEIA 2CQ8A 1RO0A 3NY7B 4INBA 4PH0A 2LF4A 4HKGA 1VQOP 2GZIA 4CA3A 5CZDB 1M9CC 2KGEA 2KGDA 4XROA 2FADA 1M6EX 4PWVB 1M90Q 2MY5A 2AFEA 2EIAA 2XDEA 5F2KA 2BUOA 2VLNA 2FVAA 1RNIA 2L0QA 1L0IA 2PEQA 4H2XC 2LPKA 1YIJP 2OTLP 3I55P 2PEKA 4B4NA 1YHQP 3VRLC 2K0XA 1HY8A 2PEMA 1VQ4P 2M8PA 2LL8A 2Z44A 2QA4P 1W2BO 4DGAC 1Q81Q 5KP8B 2FHSC 1K30A 3CC7P 2ONTA 4HTWA 2VSQA 1VKUA 4WYMA 1UJZA 4XFXA 1P7NA 2JB0A 2X82A 1EIAA 2N6ZA 2PEIA 5HGNA 2FVEA 4COCA 3GZLA 3G26A 3CD6P 3CPWO 1VQKP 2M8LA 3CMEP 1VQPP 3B4QA 1VQLP 2CG5B 1S72P 1M74A 2N5IA 1ZNVA 1VQ5P 4U0FA 2VLOA 2K93A 5BS1A 3M1MA 5JPAA 3LRYA 1YJ9P 2KOQA 2GDYA 1VQNP 1FR2A 2FQ2A 2LIUA 2XGUA 2K94A 1Q86Q 3LMOA 2WPTA 4DGEC 2XZ0D 1M9DC 2KGFA 1YI2P 2X83A 3EJBA 3GZMA 4IPYA 2EG5A 2KW2A 5HVCA 2KGCA 5BS2A 3CCEP 1Q7YQ 1M1KQ 1QVGO 2PENA 1GXGA 1VQ7P 3P05A 2CGQA 3DS4A 1M9EC 2PWMA 2PEOA 3DS5A
chains in the Genus database with same CATH topology
4U0DA 4B4NA 1G03A 3DS3A 2OTJP 2M8NA 1RO2A 5F2OA 1YHQP 1K8AQ 2P9XA 3VRLC 5I4TG 1N8RQ 1K73Q 1U7KA 2PEMA 1K9MQ 5HGOA 3CCLP 4E91A 2QEXP 4XFZA 5HGMA 1VQ4P 4U0CA 2M8PA 1L6NA 2JYLA 3CMAP 1AFVA 2Z44A 1QVFO 2QA4P 1M9FC 2V4XA 3CCQP 1W2BO 4DGAC 3H0DA 3G1GA 1Q81Q 3G1IA 3G0VA 3E2DA 5F2NA 3H47A 2EFJA 4PH1A 3CCRP 4LQWC 3CCVP 1K30A 3CC7P 2ONTA 2PY8A 3G28A 1QRJA 4HTWA 4PH2A 3CCUP 4WYMA 4XFXA 1P7NA 2OARA 3Q20A 1VQMP 1NJIQ 2X82A 1BAJA 1EIAA 3B5IA 3DTJA 1KD1Q 1YJWP 4U0AA 2PEIA 5HGNA 3DPHA 4COCA 1D1DA 4NX4C 1YJNP 4PH3A 2BHVA 3CCMP 2XGYA 3G26A 2WLVB 3CD6P 2XXMA 2CWOA 2DGYA 3CPWO 3BP9A 2M8LA 1AUMA 1VQKP 1VQPP 3CMEP 3CCSP 1VQLP 4XRQA 1E6JP 3G29A 1S72P 4M0IA 3CCJP 1M9XC 3G6EP 2XV6A 1EM9A 3CC2P 2PEOA 1M74A 3G21A 4COPA 2PWOA 1A43A 1VQ5P 4GR6A 4U0FA 2XT1A 3DS0A 5BS1A 1JJ2O 3M1MA 2JYGA 4XFYA 5JPAA 1IUQA 5HGLA 3LRYA 4U0EA 1YJ9P 1Q82Q 2GOLB 5DCKA 3H4EA 1VQNP 3HZQA 2L6EA 4E92A 2Z45A 4GR2A 3WBHA 2Z46A 1KC8Q 2XGUA 1RO0A 2JO0A 4INBA 4PH0A 2LF4A 1Q86Q 4DGEC 2WLVA 5HGKA 4QNBA 3DS2A 3I56P 3CXCO 1M9DC 2KGFA 1YI2P 1VQOP 2X83A 2Y4ZA 4U0BA 3NTEA 1GWPA 1M9CC 2GONA 3OW2O 1ZMBA 1VQ6P 4IPYA 4XROA 3CC4P 1M6NA 1M6EX 2KODA 1AK4C 2EG5A 1M90Q 2EIAA 2XDEA 5F2KA 2BUOA 2PEJA 1KQSO 5BS2A 3CCEP 1EOQA 1VQ8P 1Q7YQ 1M1KQ 1QVGO 4J93A 1RNIA 1VQ9P 2PENA 2XGVA 1VQ7P 3G4SP 2PEQA 1M9YC 3P05A 1A8OA 3G71P 2JPRA 3DS1A 3RG6C 2X2DD 2PXRC 3DS4A 1YITP 2E1MA 1M9EC 1YIJP 3MGEA 2PWMA 3HYBA 3I55P 2OTLP 2PEKA 3DS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0D A;  4B4N A;  1G03 A;  3DS3 A;  2M8N A;  3VRL C;  5I4T G;  1U7K A;  5HGO A;  4E91 A;  4XFZ A;  5HGM A;  4U0C A;  2M8P A;  1L6N A;  2JYL A;  1AFV A;  1M9F C;  2V4X A;  4DGA C;  3G1G A;  3G1I A;  3G0V A;  3H47 A;  4PH1 A;  4LQW C;  2ONT A;  3G28 A;  1QRJ A;  4HTW A;  4PH2 A;  4WYM A;  4XFX A;  1P7N A;  2X82 A;  1BAJ A;  1EIA A;  3DTJ A;  4U0A A;  5HGN A;  3DPH A;  4COC A;  1D1D A;  4NX4 C;  4PH3 A;  2XGY A;  3G26 A;  2WLV B;  2XXM A;  3BP9 A;  2M8L A;  1AUM A;  4XRQ A;  1E6J P;  3G29 A;  4M0I A;  1M9X C;  2XV6 A;  1EM9 A;  3G21 A;  4COP A;  2PWO A;  1A43 A;  4U0F A;  2XT1 A;  3DS0 A;  2JYG A;  4XFY A;  5JPA A;  5HGL A;  3LRY A;  4U0E A;  2GOL B;  5DCK A;  3H4E A;  2L6E A;  4E92 A;  2XGU A;  2JO0 A;  4INB A;  4PH0 A;  2LF4 A;  4DGE C;  2WLV A;  5HGK A;  4QNB A;  3DS2 A;  1M9D C;  2KGF A;  2X83 A;  2Y4Z A;  4U0B A;  3NTE A;  1GWP A;  1M9C C;  2GON A;  4IPY A;  4XRO A;  2KOD A;  1AK4 C;  2EIA A;  2XDE A;  2BUO A;  1EOQ A;  4J93 A;  2XGV A;  1M9Y C;  3P05 A;  1A8O A;  2JPR A;  3DS1 A;  2X2D D;  2PXR C;  3DS4 A;  1M9E C;  3MGE A;  2PWM A;  3DS5 A; 
#chains in the Genus database with same CATH topology
 1RO2 A;  1F80 D;  2K0Y A;  2KG9 A;  1K8A Q;  5I4T G;  1N8R Q;  1K73 Q;  3EJD A;  3CCL P;  4E91 A;  4MRT C;  2QEX P;  4XFZ A;  1IMQ A;  1L6N A;  2JYL A;  3CMA P;  1QVF O;  2V4X A;  3CCQ P;  3G1G A;  3G0V A;  3E2D A;  3EJE A;  2ERH A;  1IMP A;  2PY8 A;  3G28 A;  2MD9 A;  4DG9 A;  2FVF A;  2N5H A;  2KOP A;  1VQM P;  2OAR A;  1BAJ A;  4U0A A;  4R0M A;  1Z6M A;  1OR5 A;  2KOR A;  4NX4 C;  1X3O A;  2KGA A;  3CCM P;  2XGY A;  2GZF A;  2XXM A;  3BP9 A;  4XRQ A;  2ROQ A;  1M9X C;  3G6E P;  1EM9 A;  3G21 A;  1L0H A;  2M5R A;  2EHT A;  2AFD A;  1IUQ A;  4QKO A;  1Q82 Q;  2GOL B;  2Z45 A;  1DNY A;  2Z46 A;  3RG2 A;  2JO0 A;  2KG8 A;  4NEO A;  2WLV A;  3DS2 A;  3I56 P;  2FAE A;  2KWL A;  4IZ6 A;  2Y4Z A;  5EJD A;  2JBG A;  2GON A;  1ZMB A;  2L22 A;  1VQ6 P;  1M6N A;  2KOD A;  1ACP A;  1AK4 C;  2PEJ A;  1EOQ A;  1VQ8 P;  4F37 A;  2FAC A;  2XGV A;  2GDX A;  2L9F A;  3G4S P;  2MR8 A;  1A8O A;  2JPR A;  1MZ8 A;  1YIT P;  2PXR C;  1UNK A;  2E1M A;  2KOS A;  3MGE A;  3HYB A;  5KP6 B;  4U0D A;  2K2Q A;  1G03 A;  3DS3 A;  2JGP A;  2P9X A;  1U7K A;  2MVU A;  1NQ4 A;  1AFV A;  4H2Y C;  3H0D A;  3G1I A;  2L4B A;  3H47 A;  2EFJ A;  4LQW C;  3CCV P;  3GKL C;  2N98 A;  1GPJ A;  4PH2 A;  4PXH B;  1KLP A;  2AF8 A;  3CCU P;  1NJI Q;  1YJW P;  2GZJ A;  2KG6 A;  3DPH A;  1D1D A;  1YJN P;  2BHV A;  2PNG A;  2WLV B;  1BXI A;  3CE7 A;  2FQ1 A;  1AF8 A;  2K0D X;  1AUM A;  2AVA A;  2GYK A;  3CCJ P;  2JU1 A;  4COP A;  2PWO A;  1A43 A;  2QNW A;  2LML A;  4GR6 A;  5EW5 E;  3DS0 A;  2KOO A;  2EHS A;  4BPG A;  4XFY A;  2GZG A;  4U0E A;  2FQ0 A;  2CNR A;  2NO8 A;  4GR2 A;  3WBH A;  1KC8 Q;  2GZE A;  5HGK A;  4QNB A;  3CXC O;  1E0H A;  2K5X A;  2LOL A;  4U0B A;  3NTE A;  1GWP A;  3OW2 O;  2LIW A;  2JQ4 A;  3CC4 P;  2MR7 A;  1KQS O;  1T8K A;  2LKI A;  4J93 A;  1VQ9 P;  5KP7 B;  2JU2 A;  2VLP A;  1M9Y C;  3G71 P;  3DS1 A;  3RG6 C;  2X2D D;  3U43 A;  1AYI A;  3GJN A;  2OTJ P;  2M8N A;  5F2O A;  1K9M Q;  5HGO A;  1HQB A;  5HGM A;  1GXH A;  4U0C A;  2KR5 A;  1M9F C;  4BPH A;  4H2W C;  5F2N A;  3CCR P;  2K92 A;  4PH1 A;  2LTE A;  1EMV A;  1QRJ A;  2VLQ A;  2DNW A;  2MVV A;  2GDW A;  3Q20 A;  4BPF A;  3B5I A;  1KD1 Q;  3DTJ A;  2MF4 A;  4PH3 A;  2JAZ A;  2CWO A;  2DGY A;  1CEI A;  4UHP B;  3CCS P;  1E6J P;  3G29 A;  1DV5 A;  2XZ1 C;  4M0I A;  3CC2 P;  2XV6 A;  2X2B A;  2XT1 A;  2N50 A;  1JJ2 O;  2JYG A;  1VHN A;  5HGL A;  5DCK A;  3H4E A;  3HZQ A;  2L6E A;  2N6Y A;  4E92 A;  5HV8 A;  7CEI A;  2CQ8 A;  1RO0 A;  3NY7 B;  4INB A;  4PH0 A;  2LF4 A;  4HKG A;  1VQO P;  2GZI A;  4CA3 A;  5CZD B;  1M9C C;  2KGE A;  2KGD A;  4XRO A;  2FAD A;  1M6E X;  4PWV B;  1M90 Q;  2MY5 A;  2AFE A;  2EIA A;  2XDE A;  5F2K A;  2BUO A;  2VLN A;  2FVA A;  1RNI A;  2L0Q A;  1L0I A;  2PEQ A;  4H2X C;  2LPK A;  1YIJ P;  2OTL P;  3I55 P;  2PEK A;  4B4N A;  1YHQ P;  3VRL C;  2K0X A;  1HY8 A;  2PEM A;  1VQ4 P;  2M8P A;  2LL8 A;  2Z44 A;  2QA4 P;  1W2B O;  4DGA C;  1Q81 Q;  5KP8 B;  2FHS C;  1K30 A;  3CC7 P;  2ONT A;  4HTW A;  2VSQ A;  1VKU A;  4WYM A;  1UJZ A;  4XFX A;  1P7N A;  2JB0 A;  2X82 A;  1EIA A;  2N6Z A;  2PEI A;  5HGN A;  2FVE A;  4COC A;  3GZL A;  3G26 A;  3CD6 P;  3CPW O;  1VQK P;  2M8L A;  3CME P;  1VQP P;  3B4Q A;  1VQL P;  2CG5 B;  1S72 P;  1M74 A;  2N5I A;  1ZNV A;  1VQ5 P;  4U0F A;  2VLO A;  2K93 A;  5BS1 A;  3M1M A;  5JPA A;  3LRY A;  1YJ9 P;  2KOQ A;  2GDY A;  1VQN P;  1FR2 A;  2FQ2 A;  2LIU A;  2XGU A;  2K94 A;  1Q86 Q;  3LMO A;  2WPT A;  4DGE C;  2XZ0 D;  1M9D C;  2KGF A;  1YI2 P;  2X83 A;  3EJB A;  3GZM A;  4IPY A;  2EG5 A;  2KW2 A;  5HVC A;  2KGC A;  5BS2 A;  3CCE P;  1Q7Y Q;  1M1K Q;  1QVG O;  2PEN A;  1GXG A;  1VQ7 P;  3P05 A;  2CGQ A;  3DS4 A;  1M9E C;  2PWM A;  2PEO A;  3DS5 A; 
#chains in the Genus database with same CATH homology
 4U0D A;  4B4N A;  1G03 A;  3DS3 A;  2OTJ P;  2M8N A;  1RO2 A;  5F2O A;  1YHQ P;  1K8A Q;  2P9X A;  3VRL C;  5I4T G;  1N8R Q;  1K73 Q;  1U7K A;  2PEM A;  1K9M Q;  5HGO A;  3CCL P;  4E91 A;  2QEX P;  4XFZ A;  5HGM A;  1VQ4 P;  4U0C A;  2M8P A;  1L6N A;  2JYL A;  3CMA P;  1AFV A;  2Z44 A;  1QVF O;  2QA4 P;  1M9F C;  2V4X A;  3CCQ P;  1W2B O;  4DGA C;  3H0D A;  3G1G A;  1Q81 Q;  3G1I A;  3G0V A;  3E2D A;  5F2N A;  3H47 A;  2EFJ A;  4PH1 A;  3CCR P;  4LQW C;  3CCV P;  1K30 A;  3CC7 P;  2ONT A;  2PY8 A;  3G28 A;  1QRJ A;  4HTW A;  4PH2 A;  3CCU P;  4WYM A;  4XFX A;  1P7N A;  2OAR A;  3Q20 A;  1VQM P;  1NJI Q;  2X82 A;  1BAJ A;  1EIA A;  3B5I A;  3DTJ A;  1KD1 Q;  1YJW P;  4U0A A;  2PEI A;  5HGN A;  3DPH A;  4COC A;  1D1D A;  4NX4 C;  1YJN P;  4PH3 A;  2BHV A;  3CCM P;  2XGY A;  3G26 A;  2WLV B;  3CD6 P;  2XXM A;  2CWO A;  2DGY A;  3CPW O;  3BP9 A;  2M8L A;  1AUM A;  1VQK P;  1VQP P;  3CME P;  3CCS P;  1VQL P;  4XRQ A;  1E6J P;  3G29 A;  1S72 P;  4M0I A;  3CCJ P;  1M9X C;  3G6E P;  2XV6 A;  1EM9 A;  3CC2 P;  2PEO A;  1M74 A;  3G21 A;  4COP A;  2PWO A;  1A43 A;  1VQ5 P;  4GR6 A;  4U0F A;  2XT1 A;  3DS0 A;  5BS1 A;  1JJ2 O;  3M1M A;  2JYG A;  4XFY A;  5JPA A;  1IUQ A;  5HGL A;  3LRY A;  4U0E A;  1YJ9 P;  1Q82 Q;  2GOL B;  5DCK A;  3H4E A;  1VQN P;  3HZQ A;  2L6E A;  4E92 A;  2Z45 A;  4GR2 A;  3WBH A;  2Z46 A;  1KC8 Q;  2XGU A;  1RO0 A;  2JO0 A;  4INB A;  4PH0 A;  2LF4 A;  1Q86 Q;  4DGE C;  2WLV A;  5HGK A;  4QNB A;  3DS2 A;  3I56 P;  3CXC O;  1M9D C;  2KGF A;  1YI2 P;  1VQO P;  2X83 A;  2Y4Z A;  4U0B A;  3NTE A;  1GWP A;  1M9C C;  2GON A;  3OW2 O;  1ZMB A;  1VQ6 P;  4IPY A;  4XRO A;  3CC4 P;  1M6N A;  1M6E X;  2KOD A;  1AK4 C;  2EG5 A;  1M90 Q;  2EIA A;  2XDE A;  5F2K A;  2BUO A;  2PEJ A;  1KQS O;  5BS2 A;  3CCE P;  1EOQ A;  1VQ8 P;  1Q7Y Q;  1M1K Q;  1QVG O;  4J93 A;  1RNI A;  1VQ9 P;  2PEN A;  2XGV A;  1VQ7 P;  3G4S P;  2PEQ A;  1M9Y C;  3P05 A;  1A8O A;  3G71 P;  2JPR A;  3DS1 A;  3RG6 C;  2X2D D;  2PXR C;  3DS4 A;  1YIT P;  2E1M A;  1M9E C;  1YIJ P;  3MGE A;  2PWM A;  3HYB A;  3I55 P;  2OTL P;  2PEK A;  3DS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...