1L6NA

Structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
288
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag Polyprotein
publication title Structure of the N-terminal 283-residue fragment of the immature HIV-1 Gag polyprotein.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 73
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1l6nA01
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1l6nA02
4JMUA 2HMXA 1HEKA 1EM9A 1M9FC 2H3FA 4XFXA 4XROA 4XFYA 4E92A 4B4NA 4WYMA 2M8LA 4XRQA 2NV3A 2LF4A 4PH0A 4E91A 1A6SA 1M9EC 4U0BA 2KGFA 2PXRC 2GOLA 3MGEA 3BP9A 4NX4C 1D1DA 2LYBA 1M9XC 4XFZA 2K4IA 2JMGA 4U0DA 4U0AA 2H3QA 2XDEA 1AK4C 1QRJA 2M8NA 1L6NA 1P7NA 2H3ZA 4LQWC 2WLVB 2WLVA 2PWOA 3P05A 1M9CC 4INBA 1AFVA 2JPRA 5HGKA 2PWMA 4DGEC 2XGYA 1E6JP 4U0FA 4PH3A 4IC9A 2K4HA 4ICAA 2GOLB 2X83A 2H3IA 1U7KA 2LYAA 1GWPA 1UPHA 1ECWA 5JPAA 1TAMA 4HTWA 1G03A 2K4EA 4PH2A 2X82A 5HGOA 2GONA 1HIWA 2H3VA 4DGAC 4QNBA 2EIAA 2XGUA 3H47A 1ED1A 4J93A 2Y4ZA 5HGNA 2N1RA 1M9DC 4U0EA 3H4EA 1EIAA 2V4XA 5HGMA 1M9YC 3NTEA 5HGLA 2XGVA 4U0CA 2M8PA 2X2DD
chains in the Genus database with same CATH superfamily
3WK6A 3PV8A 3OHAA 4IR1A 3ONNA 1MQ3A 1QSYA 3OSPA 4NXZA 4TUPA 4M6WA 1WWVA 4CF5A 2ATLA 5KFJA 1J2NA 5D4BA 4XRQA 3ZDEA 2K8AA 4UB5A 3KHLA 4RQ1A 3JPRA 4DL3A 1M9EC 1ZD5A 4UBBA 3V7KA 1ZQEA 3KKAA 3N7RC 4QZ9A 3C2MA 7ICPA 1NZPA 3BP9A 5C0YA 4ZH4A 1NK7A 4NX4C 1SWVA 1QQ7A 3VC8A 4YD1A 3A0HU 3CRXA 5HHIA 1P7NA 4O3QA 4TUQA 2ZXIA 3P05A 2WF9A 3RB6A 7ICRA 4KN4A 3C23A 2VIXA 3QYPA 1NK0A 3TFRA 4KLTA 4FFDA 3V6KA 4YCXA 5DQGA 5KG1A 5J2DA 3UPQA 5AKGA 4Y2JA 4O3RA 4J9QA 1SXDA 4O5KA 2WHEA 3KD3A 5HMMA 2Y0SC 2VA2A 3QUBA 4Y2QA 4TQRA 3LWMA 2KJ8A 1C20A 4DFDA 2ZIXB 3BS7A 2F44A 5HR6A 1ZXIA 2FDRA 3I28A 1DGJA 3KBBA 3HKZF 2N1RA 4ED7A 3CYMA 3IV6A 1ZQSA 4J9SA 2Y0SF 2KD1A 3NTEA 5EOZA 1N61A 1U4BA 8ICVA 4P0PB 1RQNA 3MGHA 3BS5B 3TI0A 2GO7A 4DEZA 3HWTA 5DB7A 2CN1A 1SWWA 1Z4OA 3RB4A 4KLOA 2HBJA 5J2KA 1X6IA 2P6RA 3MC1A 5DLGA 3UQ2A 1ZQPA 3AL0B 4FE3A 4RPXA 5KFBA 1LV5A 4XRHA 4C4TA 2A1JA 3RH6A 1Z3EB 4M9LA 2BPFA 2FMPA 7ICHA 4CRXA 1FFUA 4I28A 3D2SA 3WKCA 2RDJA 4KLSA 3QUQA 5KFRA 1N48A 3FC4A 5G5HA 2F77X 1QLNA 5AK5A 1WG8A 3SYZA 1K5OA 3T3FA 4ECXA 2EDUA 1IG6A 2QB0A 4FO6A 3T5JA 3QEAZ 5AK4A 3KKAC 1BPEA 4DFPA 3AUOA 2Y1IA 5KT2A 5J0YA 2FPMA 1TKDA 3I1YA 4Q45A 4F72A 1TVAA 4KMUA 3M6KA 4CCHA 4UBCA 4DOCA 1X9SA 9ICFA 2KSOB 4RNNA 4ED0A 4KX5A 2K4EA 5KL8B 4O0IA 1O08A 4PH2A 5J2FA 4US8A 4DGAC 5AM1A 3OTQA 3N7SC 4F5OA 3BZCA 2LBOA 2FPKA 1KFSA 2E1FA 5KFDA 2O6KA 9ICKA 2C28A 3HILA 5KT6A 4JB3A 1A76A 2VA8A 2ZIWB 4F5NA 1SV0A 2ZUBA 1NI3A 4B9TA 2HSZA 3PSFA 4F5PA 2IMWP 5ALXA 2IOFA 3ED5A 3H4BA 2HDOA 4QZHA 1BPZA 1URJA 5AI6A 2R8KA 3RJIA 2R8GA 3E0FA 5J2EA 1EM9A 4ED3A 3A0BU 4AP9A 2K4PA 2ZIUB 4E92A 4KLMA 2YX8A 3QU4A 4C80A 1ZYQA 2G07A 4YVZA 3V6JA 3ZD9A 4YXJA 4GIBA 4QNLA 1WWUA 5GTIU 4KLEA 5KFMA 5J0WA 3C28A 3K1RB 4FBTA 2GLEA 2W43A 2DPIA 3T5HA 2BQ3A 1BVSA 3JPNA 4MEXA 2MAXA 1U45A 3F2BA 4DOBA 2OWOA 3FAHA 4LZDA 4U0FA 2MRLA 2KV2A 4IC9A 3HP6A 2VJ4A 2YB1A 3WKEA 1BPYA 5KFNA 1YT3A 3PNCA 4M2YA 4P2HA 2HHQA 1G03A 2IOFK 2ZJAA 4Q8EA 4QWBA 4RNOA 2HHTA 4QZEA 4DS5A 4C4SA 4J9RA 5J0SA 2UVWA 2P66A 1PK1A 2ODGA 2OHFA 4NM2A 1KEJA 4O3MA 2E8OA 5KFSA 3PR4A 2XY5A 5H2FU 3GU3A 5HGNA 1SKRA 4QW9A 3C29A 5J2JA 4J9MA 4Z6DA 4QJFB 1SXEA 7ICIA 2G08A 5AKXA 3PX0A 4RQ5A 2A1AA 5ALPA 4YR0A 2KTQA 4C8OA 5ALUA 9ICSA 2DPJA 4O3PA 4DSKA 2OYYA 1ZQKA 2WB1C 9ICCA 1KQQA 4I2GA 3QU5A 3PMNA 4ED2A 1UHUA 1V38A 2PFPA 3PSTA 4F92B 2FMSA 1Y88A 1MQ2A 8ICUA 1M9FC 3Q8LA 3DDHA 2ESEA 3H8JA 1A0PA 1SV0C 5AM2A 2H5XA 4M9JA 5ALKA 2JZBA 2WB1F 4YXMA 5KFGA 4NM1A 4U0BA 3LVVA 1L3UA 2JEJA 3PSPA 2V4RA 5L1IA 4PHAA 2I1QA 3OGUA 4U0AA 3QUCA 4HAIA 5IIOA 4NWIA 1UA0A 2YQEA 2ZJ5A 7ICVA 2KK0A 2IA6A 1M9CC 4OJ6A 4U6PA 2EANA 3RAQA 2ASLA 8ICIA 3IM1A 3WK8A 4Y2VA 4DL7A 4RQNA 3L5KA 2GWSA 3IDWA 2NRZA 4PZNA 2NYVA 2QARA 2BHNA 8ICHA 5IIJA 2XO7A 3MR5A 3GV7B 1TAMA 1OUQA 3WK7A 3NRZA 5AKIA 3PX6A 3HRDD 2BCVA 5KFYA 1Q8KA 4YP3A 3H47A 4QZAA 2RHFA 2KEYA 3LK9A 3SAGA 4QWDA 2BCUA 2JEFA 8ICJA 2C2DA 2Q4TA 1S0OA 1RDFA 1LVHA 2CXYA 1JMSA 4OO1J 2C2RA 2ALZA 1Z4NA 2J6SA 1XO1A 3I76A 8ICNA 4RT2A 5DGBA 3NTUA 8ICGA 5CJ7A 2E5SA 5HGLA 4WJ3B 4UB2A 9ICWA 3LVWA 5ALQA 1SL0A 1N56A 1WCLA 4FZNA 4PZOA 5KG7A 2W9BB 4RPZA 5KTQA 1RYUA 2W11A 3UXOA 4UAWA 4USAA 3N7PD 2FLLA 1SL1A 3WKDA 3AU2A 5IINA 4C4RA 9ICMA 2ZUCA 4X5VA 4C8LA 3GIJA 4PHEA 2DKXA 4R8UB 3CP8A 2KGFA 4C7YA 2PXRC 3QU2A 3Q8PB 3NVVA 5DDMA 1DXSA 2XC9A 2KJ5A 2XDEA 3PO5A 4I2HA 4CF3A 4KN7A 3H8SA 3SQIA 2BCQA 2DF4B 5ALJA 4DSJA 3K75D 2XGYA 1RM6C 5T14A 2GOLB 4ECVA 2PFOA 7ICUA 4EENA 4RUAA 1NK5A 1RPLA 5J2GA 2E1EA 3C2KA 2H3VA 4QZFA 2PXIA 9ICBA 5DB6A 1COKA 2QB1A 5AM3A 4B6JA 2XGUA 2DBYA 5L1LA 1NK9A 1XU4A 5ALNA 4EELA 5DQIA 3UXPA 4QIWF 5AKEA 1B4FA 3MBYA 1XSNA 4R63A 5KG5A 4UAYA 2CPRA 2NO5A 5CHGA 3Q8SB 3C1ZA 3NS1A 5A0LA 4YG2A 4I2EA 4UB8U 2WF5A 3M6ZA 4DLEA 2W7OA 2ZJ8A 5KAIU 1Z19A 3EW9A 2MUTB 4EEKA 1JI7A 4ELVA 2QKQA 1BPXA 1LKYA 5KFPA 4O3NA 4BX9C 3BQ1A 4EX7A 4IQWA 3PW2A 4M6WB 4F5QA 4PGQA 1N63A 4DQRA 1UA1A 1KFTA 2V9WA 4DSFA 4P0QA 4C7ZA 4I2FA 2KICA 1C7YA 2PI5A 1UT5A 2R18A 1QH9A 5TISU 3L3FX 5KFAA 2MA1A 3S6JA 3SENA 3QE9Y 1IIPA 3WK4A 4R66A 4QZ8A 5HNKA 3ORYA 3RF9A 4UB4A 1U48A 1KN5A 3QU9A 8ICSA 1SZHA 1L6NA 4FS1A 1ZQHA 3RJJA 4KITB 1AROP 1ZD3A 2C2EA 2JRZA 2A19A 2YMLA 2KZZA 2KKPA 4PHPA 4ICAA 3RRGA 2EZYA 2FLNA 2DGZA 2F2AB 4DS4A 1S97A 1UPHA 8ICBA 2JGAA 1ECWA 1U9LA 2P35A 2IOHA 3F53A 4KLDA 1ZQVA 7ICSA 5IILA 1DRGA 1RQLA 4UB3A 2D8CA 4I2DA 4DSLA 4A8EA 3KTQA 1ZQXA 4KLFA 7ICFA 1VLBA 4JV2A 5AKKA 4B9MA 4PJ0U 1XC9A 3TFSA 2Y4ZA 4CDGA 2DFLA 1S0VA 1NJYA 1N62A 5JUMA 1PUZA 3E2EA 4QWCA 5C5JA 3ETLA 3HKZC 4J9PA 2WAQC 5KFHA 4ECSA 1O03A 2A3VA 3TARA 1S10A 1T3NA 2HBLA 2BGWA 1B22A 3TADC 5AI8A 2JV3A 2HHSA 4BGDA 3HX0A 5GTHU 1X9XA 2ZIVA 3PMLA 4OCZA 4CGZA 1ZQWA 4IQVA 5J0QA 3PSIA 5CA7A 1OXJA 2WAQF 4BXOA 1NKBA 5EE0A 3B0XA 4LVSA 4DL4A 1TV9A 4E91A 4HYKA 2G5HB 2A1JB 2WF7A 1KBUA 8ICZA 4DSIA 5AKZA 1FO4A 4Y2SA 3D6JA 1SB3C 4K4IA 3MGEA 1SZPA 1XO0A 1L8LA 1PVPA 1MN8A 1K1QA 4C0ZA 2F1IA 1ZJNA 3KHGA 4PH5A 2W9CA 5AHXA 1X66A 2PWOA 1KLNA 2QB0B 4DL5A 5TZVA 4M0AA 2K4HA 2FLPA 1L3SA 2H3IA 8ICTA 1GWPA 7ICKA 4F71A 1S76D 3BJYA 2B6GA 5AI4A 5J8YA 5HP4A 1L5UA 4UB1A 1ZQGA 2DKZA 5HGOA 2KP7A 4B9UA 4JWNA 4C8MA 2XIDA 2RRDA 4B9LA 1Z00A 4PPXA 2IHMA 3WK5A 3ZDAA 2K89A 4RZRA 5J0PA 3JPSA 2W04A 3VCBA 2LYHA 4IL6U 2KE7A 1L7NA 2MU2A 4ELTA 1PZNA 2HHXA 1M9DC 5DG9A 4F2SA 2KFNA 1L7PA 2LMRA 3H0LB 2E8PA 3SMVA 2XGVA 3QX7A 5ALVA 2KVSA 1KRPA 5EWFA 1RYRA 4BDPA 8ICXA 2M8PA 1L7OA 3U26A 2HW3A 2LKYA 4M9NA 4DFJA 3QZ8A 3AQEA 4I2IA 3PW4A 1TE2A 8ICOA 4NLCA 1ZQLA 4XFXA 5KFVA 4P4OA 2ZXHA 1QSSA 1XNSA 4KLHA 4WYMA 1DK3A 2XCAA 5DBBA 4KX3A 4IR9A 4NV0A 3QUTA 4ECWA 4FBUA 3PW0A 5ALMA 4IRKA 7ICOA 1M9XC 2D3DA 2MSNA 4DFMA 5ALWA 1QRJA 5B5EU 2JH1A 3KZXA 2QLTA 7ICQA 5IIKA 4P4MA 3ZDDA 1JRPA 5ALZA 4PL1A 3N4MB 1ZQAA 3KHHA 2VA3A 5KFCA 1WYGA 3RR7A 2XY7A 3PR5B 1X9WA 2HVHA 2FI1A 4RPYA 5AKHA 5AKLA 1NJXA 2GONA 4RT3A 3N28A 4KLGA 1PK1B 3DEEA 1ZQTA 2G06A 4I29A 2V4QA 5ALHA 4EZ6A 3V7LA 1KDHA 1SIJA 3H0RB 1N60A 3BZKA 1ZQMA 1KSPA 4UATA 5DKWA 4KMOB 5J8YC 4F4KA 4E0DA 4F3OA 1M9YC 3G6XA 3THVA 5ALEA 5J2HA 2G09A 2B0CA 2WFAA 4YMMA 4Y2RA 2W7PA 2K8CB 2XICA 3M9MB 2AU0A 1Q46A 3CW2C 3HW8A 4UQGA 4ECTA 4J9OA 7ICEA 2B21A 2E8NA 4J03A 5ALTA 4YFKA 3F2CA 5KFQA 2JZBB 5DGAA 1LB2B 4I2CA 4EYHB 3JPTA 3L4PA 1T3QA 4YMNA 2HOQA 5ALSA 3PVXA 8ICYA 1NKCA 4QW8A 5KT7A 1SL2A 1SKSA 4NL9A 1D1DA 1TFRA 3UMCA 5JU5A 4F91B 5ALRA 4RNMA 2XCPA 2OXOA 2YMPA 2LM1A 1F5SA 4DO9A 1WCNA 1QSLA 2J6UA 1JALA 2CRXA 4O3OA 2ZUDA 4INBA 4Z6CA 2JPRA 1N2XA 2LM4A 1P7DA 3OJSA 3ISBA 5K4LA 3C5FA 2BPCA 4UW9A 1RYSA 3IHQB 4TUSA 3C1YA 3M8RA 3Q8QB 2QARB 1Q3VA 5L1JA 3R9KA 4TQSA 4YQWA 5DB9A 9ICVA 2RP5A 4NLGA 2X82A 9ICTA 3ISDA 3N97B 1XS9D 4QWAA 3MDCA 4PGXA 9ICQA 2NRWA 3F5AA 4RQ3A 1VDVA 4IS7A 5BPCA 3TKAA 9ICAA 4B9NA 3T5LA 4EZ9A 1ZD4A 1T7PA 4DFKA 1D8LA 1ZQCA 5AM5A 2Z7JA 4EBEA 1ZQQA 3H7IA 3PO4A 1IV8A 2EZXA 1L3VA 4Q44A 4O9MA 4FZMA 4J9KA 2I6XA 1V9PA 2HMXA 3RH4A 5ALFA 2W03A 3C5GA 3BDPA 1D9DA 4ED8A 1ZQ1C 2DUYA 3F2DA 3QXGA 1RG6A 5E79U 2M8LA 4PHDA 1SKWA 2WF6A 5J2BA 3H8WA 4NJ8A 3GIIA 4JV1A 2JEIA 4ECYA 5AIBA 2HOIA 1X2IA 2BR0A 3UXNA 1MC8A 4K4HA 9ICUA 3ICXA 5DBCA 2W3RA 3SAFA 1KL9A 1DGSA 2Q0ZX 1NZBA 3RAXA 3Q8MA 1COOA 2HBKA 2I5HA 5BOMA 3KHRA 1NKEA 4DL2A 3PX4A 4NL9C 4IRDA 1K1SA 3GFKB 1JUDA 5AKYA 3DV9A 2BCRA 1WUDA 5FP0A 1HUZA 4GXKA 5CWRA 9ICIA 4GLXA 5DG8A 9ICNA 5F9NA 5AI5A 1UCVA 1T94A 2AXTU 3M8SA 4NLKA 2GH1A 3JPPA 7ICGA 2W9BA 1Z1BA 5HR7A 3RB0A 8ICWA 3ZDCA 1RXWA 1AQ6A 2BCSA 5ALOA 3MDAA 4ECRA 4P4PA 2YMMA 3UMBA 2F8LA 4QIWC 5D46A 3TANA 2LHTA 1Q3UA 3EZ5A 8ICEA 2NRXA 4JK1A 1V85A 3TADA 5KNIA 4XUSA 2AHOB 1LKYB 3AU6A 4JMUA 1KW4A 3FDSA 4I2AA 5KT3A 1HUOA 4BUGA 2HI0A 5KFFA 4YD2A 2KVCA 2ZG6A 1JXEA 4DQSA 4DCCA 5EWEA 4LJXA 1QCKA 4P0QB 5EE3A 2R8HA 3EUB2 4YR2A 2GOLA 2W8KA 1S9FA 4RQ0A 2Y9TA 3NVYA 4F5RA 2LYBA 4DSEA 2AJQA 3RJHA 1NJWA 2LPEA 5KFUA 1AK4C 2E8MA 3GIMA 5BOLA 1B0XA 4M47A 8ICLA 4FS2A 2HVIA 2ISPA 4OJ5A 2WLVA 2KN7A 8ICMA 9ICLA 3MABA 2HHVA 2DQNB 4DQQA 2X83A 2PMZF 1BPBA 3O0FA 3OHBA 5J29A 5KFZA 3J81j 1ZQDA 2DL0A 1YZ6A 5AK6A 1KKXA 3RRHA 8ICCA 4OJLA 4F4ZA 2OEHA 3UQ0A 1ZQJA 4F8RA 1N5XA 3GIKA 3QEBZ 1A77A 2M9NA 1BPDA 4DWIA 4CE6A 4QZGA 2AGPA 3PW5A 3ZDBA 4DLGA 2XGQA 1JROA 2NRTA 9ICPA 2W55A 4NLBA 1EIAA 2EQYA 3AM9A 1IM4A 2FMQA 5ALLA 2EAMA 3RJKA 4ZOHC 4UARA 5CEHA 2OH2A 4RQMA 1CUKA 4U0CA 4J9LA 1TAQA 2JXJA 1JXLA 1ZETA 3H0MB 3WKAA 3T5KA 2ZIVB 3B0YA 8ICRA 3OJUA 2M0NA 4BXOB 3NGDA 5AM4A 4XROA 3C2LA 1JN3A 4Z6FA 2F3NA 4B4NA 2NRVA 2W9MA 3JPOA 2BPGA 2ES6A 5KG0A 3H4DA 2EH9A 4J9NA 3MGVA 4QWEA 2XY6A 3PZPA 3NUQA 4CNQA 2K8BB 4C8NA 1ZQIA 1S5LU 4F2RA 2VJ5A 1ZOLA 3D2NA 2W9CB 1FIQA 3GDXA 3MR2A 2H3ZA 4ECUA 4Q8FA 2PI4A 1HJPA 4LZGA 1T8EA 4UB6U 2BKEA 2G0AA 1CRXA 5HGKA 4DGEC 1D8BA 5AK3A 3RFAA 2FE9A 4Y2UA 2XGPA 2LYAA 4RUCA 3TACB 1ZQBA 2ZTEA 2KFZA 5JPAA 4MEYA 4F93B 4ECZA 2AQ4A 2PFQA 3NVWA 2FJ6A 3K4GA 2ASDA 4K4GA 3SD7A 4F4XA 3TAPA 3ISCA 1Z00B 2EIAA 2JR5A 1ZRNA 4TURA 4KLJA 1ED1A 4DOAA 2ZIXA 2KMDA 2OM6A 4PGYA 1ZQYA 3OSNA 3AQFA 5J0XA 4U0EA 2KIVA 1N5WA 2WF8A 2V4XA 2AQ0A 3V6HA 5DBAA 5L1KA 5KFTA 4OD0A 3UM9A 4P0PA 2KZ3A 4DL6A 4JWMA 5L1MA 3BS5A 2BDPA 2D6FC 1ZQZA 3SR6A 1BNOA 4FZLA 4M9GA 1D8YA 3LDAA 2H3FA 1GO3F 1Z1VA 5G5GA 2RLTA 3D2QA 4O3SA 4O5EA 4M04A 1XWLA 5KG3A 4JUZA 2YY6A 1DOQA 3E58A 2KOBA 1QQ5A 1X42A 3BQTA 4OJPA 3G6VA 5J0RA 2L5YA 2E3TA 4BJQA 5JRTA 3TQ1A 2XI9A 1PK3A 2YMQA 1FFVA 3KZIU 4QZIA 2DWQA 4QZBA 4RQ8A 5EWGA 3ZD8A 5AKJA 1B43A 5IIIA 1AFVA 5DQHA 2PWMA 3AN1A 1NNLA 4NLZA 1F0MA 5J2AA 5L9XA 2J6TA 4DQIA 3HT3A 1F44A 4XQ8A 2AGQA 3OPXA 3C21A 1PVQA 3AEVA 4HTWA 2KSOA 3EYZA 5CB1A 1X6JA 1DK2A 4MF8A 5KG6A 3WU2U 4F50A 2F76X 4GC6A 3RR8A 3BQ2A 2F1JA 1QTMA 9ICOA 1RXVA 2ASJA 9ICGA 2W8LA 4ELUA 4MF2A 4YMOA 3ZI4A 2KHQA 3IG5A 2KJ9A 3BQ0A 4MFFA 5J0UA 3RBDA 5KFIA 2ZIWA 4F4WA 5AIAA 4IRCA 3QU7A 4U7CA 5J0TA 5DDYA 3IN5A 1UT8A 2JH7A 1YZ7A 5DLFA 2X2DD 1ZQFA 4C8KA 1ZD2P 1QQ6A 3SEIA 4XFYA 4EX6A 1ZRMA 2XVTA 2ZIUA 4MHVA 3T79A 1CI4A 3MFIA 3K1ZA 3M9OB 1MSWD 5DB8A 2BQUA 2HOFA 4QZCA 4QZDA 3RH5A 2KZMA 1NK4A 5DG7A 4RQ6A 1PVRA 5ALYA 4EYIB 3BQ7A 3RBEA 1BGXT 9ICJA 3EPIA 3IG8A 4LQWC 2VKQA 4XA5A 9ICRA 5KG4A 1D9FA 4DF8A 5J0OA 2K60A 4YR3A 1ZQUA 1TK0A 3F5EA 1U49A 3G6YA 1ZJMA 5KT4A 3GZFA 2EZZA 2UVRA 3LYSA 1J2MA 3H8MA 7ICLA 2R8JA 1V97A 3UMGA 4ED6A 3PY8A 4M9HA 1SGGA 4CF4A 3MFHA 4B9SA 5EE9A 2W54A 3M7DA 4DF4A 3RJFA 3RJGA 3H4EA 5HGMA 1L3TA 3JPQA 5KL1B 2KG5A 5AI0A 5CR0A 4ACOA 1T4GA 4KTQA 4Q43A 2KHVA 4ECQA 1ZQNA 4UAVA 3MR3A 3NASA 3CNHA 7ICMA 4I2JA 5CRXA 3WKBA 1UQVA 3M1YA 1HEKA 1OW5A 4O5CA 2FPLA 2AH5A 4DQPA 5ALIA 3KOOA 4G3IA 7ICJA 1M6YA 4EEYA 2NV3A 3GILA 2LF4A 4PH0A 3PW7A 4GXJA 4I2BA 2IHNA 3GQCA 2NO4A 5F9LA 1KFDA 4Y2YA 1TAUA 5EE1A 3MGIA 4XFZA 2K4IA 2JMGA 3HJEA 2I9GA 4U0DA 2BZFA 2PFNA 2H3QA 4IQTA 3SI8A 1J97A 1X40A 2WTFA 8ICKA 4RU9A 4Y2PA 2RQ5A 3V72A 2HBMA 2VANA 2EAPA 8ICAA 4RQ7A 4EBDA 5KAFU 4PH3A 1S0MA 4NLNA 2KIWA 1NJZA 2Y9UA 5F3XB 3QZ7A 1U7KA 3FYHA 1VJ5A 4AYBC 3MR6A 1CEZA 4RQ2A 2KKVA 5KG2A 4G9BA 9ICEA 4GFJA 2W9AA 2F1HA 1HIWA 1IXRA 4MFCA 3QNMA 2BDUA 3NVZA 4YN4A 3KFUF 4QNBA 3SV3A 5AI9A 3IRUA 3SV4A 5AM0A 4Z6EA 4AYBF 1BNPA 8ICFA 3HPOA 4IQUA 3GV8B 2BQRA 4PL2A 5ALDA 3FM9A 4KLQA 4JV0A 2AGOA 2W3SA 3M9NB 1S0NA 5KT5A 7ICTA 1U47A 9ICHA 1S8OA 5HHHA 8ICQA 2YTUA 5JTIA 5ALGA 1SV4A 1NK8A 3AMZA 2R8IA 3NRWA 5KFWA 3H40A 3GV5B 1L7MA 4R64A 3RB3A 4KLIA 5AICA 8ICPA 2UVUA 3LWLA 1JX4A 4BWMA 1S77D 2JEGA 1A6SA 4UASA 2YB4A 4Y2TA 4R8UA 3Q8RB 5KFKA 5J2IA 2EAOA 1TK5A 1NK6A 2C22A 4UAUA 4EBCA 4ED1A 1NOMA 2YN4A 3EWAA 1TK8A 1ZQRA 2UVVA 4UAZA 2ZTCA 1EXNA 4GC7A 1ZQOA 2M8NA 5J2CA 2WLVB 1MA7A 2ZTDA 4US9A 3RTVA 5KFLA 4KLUA 1JIHA 1E6JP 7ICNA 4F4YA 1H38A 5CP2A 2HHWA 4BWJA 3V7JA 3EPGA 5IIMA 1X9MA 5D49A 3RJEA 2Y1JA 4NY8A 2IBKA 4B9VA 2HCFA 2PMZC 1KTQA 2JHDA 5HMLA 4KLLA 4I27A 9ICXA 3B9JA 5KFEA 4Y2XA 2PKEA 5KFXA 5KFOA 2KNJA 4RQ4A 2LI6A 4R65A 4J93A 1RZTA 2OCEA 2RDIA 3SZ2A 4OJOA 1FEZA 3IP4B 3ALRA 1XSLA 2P6UA 4GXIA 2F8KA 3WK9A 3TAQA 1L8OA 1XSPA 2ISOA 3Q8KA 5B66U 4MFAA 2HHUA 3SAHA 3ETRA 2G5IB 2MUTA
chains in the Genus database with same CATH topology
2W7PA 2K8CB 2XICA 2D6FC 3ONNA 4FZLA 2H3FA 3N7PD 1GO3F 3F2CA 3D2QA 4XRQA 2K8AA 1M9EC 2KGFA 3CP8A 2HOQA 3N7RC 2PXRC 2KOBA 3BP9A 5C0YA 4NX4C 1D1DA 4OJPA 2KJ5A 4BJQA 2XDEA 3VC8A 2XI9A 2OXOA 3CRXA 1P7NA 3SQIA 2ZXIA 2DF4B 3P05A 2CRXA 4INBA 1AFVA 2VIXA 1P7DA 2JPRA 2PWMA 2XGYA 5T14A 2GOLB 1F44A 1Q3VA 3OPXA 1PVQA 4HTWA 2RP5A 2E1EA 2X82A 2H3VA 2Y0SC 2F76X 2XGUA 2KJ8A 2ZIXB 5HR6A 3F5AA 3HKZF 2N1RA 4QIWF 2KHQA 3IG5A 2KJ9A 2CPRA 3CYMA 2Y0SF 2KD1A 3NTEA 5A0LA 2Z7JA 2ZIWA 4P0PB 4U7CA 3M6ZA 2W7OA 3IN5A 1Z19A 2JH7A 2X2DD 4FZMA 2CN1A 4BX9C 2HBJA 2HMXA 2W03A 1ZQ1C 4XFYA 2XVTA 2ZIUA 3T79A 3F2DA 3AL0B 4FE3A 2M8LA 3K1ZA 2HOFA 4P0QA 2KICA 2HOIA 4CRXA 3D2SA 2R18A 1PVRA 3ICXA 3L3FX 2MA1A 3SAFA 1IIPA 3RF9A 1SZHA 2F77X 1NZBA 1L6NA 3IG8A 4LQWC 2VKQA 2HBKA 2KKPA 4ICAA 3F5EA 2DGZA 2F2AB 1UPHA 2JGAA 1ECWA 3F53A 3M6KA 3GZFA 3LYSA 1DRGA 4KX5A 2K4EA 5KL8B 4PH2A 1WUDA 4A8EA 4DGAC 3N7SC 2Y4ZA 4CDGA 1T94A 2GH1A 2LBOA 1Z1BA 5HR7A 2E1FA 3M7DA 3H4EA 3HKZC 2F8LA 4QIWC 2WAQC 5HGMA 2ZIWB 2A3VA 2LHTA 5KL1B 4ACOA 2HBLA 1Q3UA 3PSFA 2KHVA 1URJA 4JMUA 5CRXA 2ZIVA 4CGZA 3E0FA 1HEKA 3PSIA 4BUGA 1EM9A 2WAQF 2KVCA 2ZG6A 2ZIUB 4E92A 2YX8A 2NV3A 2LF4A 4PH0A 4E91A 4P0QB 2G5HB 2G07A 1KBUA 2GOLA 4QNLA 3MGEA 2LYBA 1XO0A 4XFZA 2K4IA 2JMGA 3C28A 1PVPA 4U0DA 2H3QA 4C0ZA 1AK4C 4OJ5A 2WLVA 2PWOA 3F2BA 2HBMA 4U0FA 2DQNB 4PH3A 2MRLA 2KV2A 2KIWA 2K4HA 4IC9A 2X83A 2VJ4A 2H3IA 2YB1A 1U7KA 1GWPA 2PMZF 3O0FA 4AYBC 1YT3A 2KKVA 1G03A 4GFJA 5HGOA 1HIWA 2XIDA 4OJLA 2RRDA 2BDUA 3KFUF 4QNBA 4O3MA 5HGNA 3GU3A 2K89A 3C29A 2W04A 3VCBA 4AYBF 4QJFB 2G08A 1M9DC 4PL2A 4NLBA 1EIAA 3H0LB 3SMVA 2XGVA 2OH2A 2OYYA 2WB1C 4U0CA 2M8PA 3H0MB 2LKYA 2ZIVB 3AQEA 3PSTA 2M0NA 4NLCA 3NRWA 1M9FC 4XFXA 4XROA 2ZXHA 4B4NA 1XNSA 4WYMA 1A0PA 2WB1F 4KX3A 1A6SA 4U0BA 3LVVA 3MGVA 2YB4A 4NV0A 3PSPA 3PZPA 3NUQA 2K8BB 1M9XC 4U0AA 2VJ5A 1QRJA 3D2NA 2M8NA 2JH1A 4NWIA 2H3ZA 2WLVB 3KZXA 1MA7A 1M9CC 4OJ6A 4U6PA 2G0AA 1CRXA 5HGKA 4DGEC 1D8BA 1E6JP 4PL1A 3RFAA 2LYAA 5JPAA 1TAMA 2PMZC 1OUQA 2JHDA 2GONA 3DEEA 2G06A 2EIAA 3H47A 2KNJA 2RHFA 2KEYA 1ED1A 4J93A 3SAGA 2ZIXA 2OM6A 2Q4TA 4OJOA 3IP4B 3ALRA 3H0RB 3AQFA 4OO1J 4U0EA 4KMOB 2V4XA 1M9YC 2E5SA 2G09A 5HGLA 4WJ3B 4P0PA 3LVWA 3SAHA 4FZNA 2G5IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMU A;  2HMX A;  1HEK A;  1EM9 A;  1M9F C;  2H3F A;  4XFX A;  4XRO A;  4XFY A;  4E92 A;  4B4N A;  4WYM A;  2M8L A;  4XRQ A;  2NV3 A;  2LF4 A;  4PH0 A;  4E91 A;  1A6S A;  1M9E C;  4U0B A;  2KGF A;  2PXR C;  2GOL A;  3MGE A;  3BP9 A;  4NX4 C;  1D1D A;  2LYB A;  1M9X C;  4XFZ A;  2K4I A;  2JMG A;  4U0D A;  4U0A A;  2H3Q A;  2XDE A;  1AK4 C;  1QRJ A;  2M8N A;  1L6N A;  1P7N A;  2H3Z A;  4LQW C;  2WLV B;  2WLV A;  2PWO A;  3P05 A;  1M9C C;  4INB A;  1AFV A;  2JPR A;  5HGK A;  2PWM A;  4DGE C;  2XGY A;  1E6J P;  4U0F A;  4PH3 A;  4IC9 A;  2K4H A;  4ICA A;  2GOL B;  2X83 A;  2H3I A;  1U7K A;  2LYA A;  1GWP A;  1UPH A;  1ECW A;  5JPA A;  1TAM A;  4HTW A;  1G03 A;  2K4E A;  4PH2 A;  2X82 A;  5HGO A;  2GON A;  1HIW A;  2H3V A;  4DGA C;  4QNB A;  2EIA A;  2XGU A;  3H47 A;  1ED1 A;  4J93 A;  2Y4Z A;  5HGN A;  2N1R A;  1M9D C;  4U0E A;  3H4E A;  1EIA A;  2V4X A;  5HGM A;  1M9Y C;  3NTE A;  5HGL A;  2XGV A;  4U0C A;  2M8P A;  2X2D D; 
#chains in the Genus database with same CATH topology
 3WK6 A;  3PV8 A;  3OHA A;  4IR1 A;  3ONN A;  1MQ3 A;  1QSY A;  3OSP A;  4NXZ A;  4TUP A;  4M6W A;  1WWV A;  4CF5 A;  2ATL A;  5KFJ A;  1J2N A;  5D4B A;  4XRQ A;  3ZDE A;  2K8A A;  4UB5 A;  3KHL A;  4RQ1 A;  3JPR A;  4DL3 A;  1M9E C;  1ZD5 A;  4UBB A;  3V7K A;  1ZQE A;  3KKA A;  3N7R C;  4QZ9 A;  3C2M A;  7ICP A;  1NZP A;  3BP9 A;  5C0Y A;  4ZH4 A;  1NK7 A;  4NX4 C;  1SWV A;  1QQ7 A;  3VC8 A;  4YD1 A;  3A0H U;  3CRX A;  5HHI A;  1P7N A;  4O3Q A;  4TUQ A;  2ZXI A;  3P05 A;  2WF9 A;  3RB6 A;  7ICR A;  4KN4 A;  3C23 A;  2VIX A;  3QYP A;  1NK0 A;  3TFR A;  4KLT A;  4FFD A;  3V6K A;  4YCX A;  5DQG A;  5KG1 A;  5J2D A;  3UPQ A;  5AKG A;  4Y2J A;  4O3R A;  4J9Q A;  1SXD A;  4O5K A;  2WHE A;  3KD3 A;  5HMM A;  2Y0S C;  2VA2 A;  3QUB A;  4Y2Q A;  4TQR A;  3LWM A;  2KJ8 A;  1C20 A;  4DFD A;  2ZIX B;  3BS7 A;  2F44 A;  5HR6 A;  1ZXI A;  2FDR A;  3I28 A;  1DGJ A;  3KBB A;  3HKZ F;  2N1R A;  4ED7 A;  3CYM A;  3IV6 A;  1ZQS A;  4J9S A;  2Y0S F;  2KD1 A;  3NTE A;  5EOZ A;  1N61 A;  1U4B A;  8ICV A;  4P0P B;  1RQN A;  3MGH A;  3BS5 B;  3TI0 A;  2GO7 A;  4DEZ A;  3HWT A;  5DB7 A;  2CN1 A;  1SWW A;  1Z4O A;  3RB4 A;  4KLO A;  2HBJ A;  5J2K A;  1X6I A;  2P6R A;  3MC1 A;  5DLG A;  3UQ2 A;  1ZQP A;  3AL0 B;  4FE3 A;  4RPX A;  5KFB A;  1LV5 A;  4XRH A;  4C4T A;  2A1J A;  3RH6 A;  1Z3E B;  4M9L A;  2BPF A;  2FMP A;  7ICH A;  4CRX A;  1FFU A;  4I28 A;  3D2S A;  3WKC A;  2RDJ A;  4KLS A;  3QUQ A;  5KFR A;  1N48 A;  3FC4 A;  5G5H A;  2F77 X;  1QLN A;  5AK5 A;  1WG8 A;  3SYZ A;  1K5O A;  3T3F A;  4ECX A;  2EDU A;  1IG6 A;  2QB0 A;  4FO6 A;  3T5J A;  3QEA Z;  5AK4 A;  3KKA C;  1BPE A;  4DFP A;  3AUO A;  2Y1I A;  5KT2 A;  5J0Y A;  2FPM A;  1TKD A;  3I1Y A;  4Q45 A;  4F72 A;  1TVA A;  4KMU A;  3M6K A;  4CCH A;  4UBC A;  4DOC A;  1X9S A;  9ICF A;  2KSO B;  4RNN A;  4ED0 A;  4KX5 A;  2K4E A;  5KL8 B;  4O0I A;  1O08 A;  4PH2 A;  5J2F A;  4US8 A;  4DGA C;  5AM1 A;  3OTQ A;  3N7S C;  4F5O A;  3BZC A;  2LBO A;  2FPK A;  1KFS A;  2E1F A;  5KFD A;  2O6K A;  9ICK A;  2C28 A;  3HIL A;  5KT6 A;  4JB3 A;  1A76 A;  2VA8 A;  2ZIW B;  4F5N A;  1SV0 A;  2ZUB A;  1NI3 A;  4B9T A;  2HSZ A;  3PSF A;  4F5P A;  2IMW P;  5ALX A;  2IOF A;  3ED5 A;  3H4B A;  2HDO A;  4QZH A;  1BPZ A;  1URJ A;  5AI6 A;  2R8K A;  3RJI A;  2R8G A;  3E0F A;  5J2E A;  1EM9 A;  4ED3 A;  3A0B U;  4AP9 A;  2K4P A;  2ZIU B;  4E92 A;  4KLM A;  2YX8 A;  3QU4 A;  4C80 A;  1ZYQ A;  2G07 A;  4YVZ A;  3V6J A;  3ZD9 A;  4YXJ A;  4GIB A;  4QNL A;  1WWU A;  5GTI U;  4KLE A;  5KFM A;  5J0W A;  3C28 A;  3K1R B;  4FBT A;  2GLE A;  2W43 A;  2DPI A;  3T5H A;  2BQ3 A;  1BVS A;  3JPN A;  4MEX A;  2MAX A;  1U45 A;  3F2B A;  4DOB A;  2OWO A;  3FAH A;  4LZD A;  4U0F A;  2MRL A;  2KV2 A;  4IC9 A;  3HP6 A;  2VJ4 A;  2YB1 A;  3WKE A;  1BPY A;  5KFN A;  1YT3 A;  3PNC A;  4M2Y A;  4P2H A;  2HHQ A;  1G03 A;  2IOF K;  2ZJA A;  4Q8E A;  4QWB A;  4RNO A;  2HHT A;  4QZE A;  4DS5 A;  4C4S A;  4J9R A;  5J0S A;  2UVW A;  2P66 A;  1PK1 A;  2ODG A;  2OHF A;  4NM2 A;  1KEJ A;  4O3M A;  2E8O A;  5KFS A;  3PR4 A;  2XY5 A;  5H2F U;  3GU3 A;  5HGN A;  1SKR A;  4QW9 A;  3C29 A;  5J2J A;  4J9M A;  4Z6D A;  4QJF B;  1SXE A;  7ICI A;  2G08 A;  5AKX A;  3PX0 A;  4RQ5 A;  2A1A A;  5ALP A;  4YR0 A;  2KTQ A;  4C8O A;  5ALU A;  9ICS A;  2DPJ A;  4O3P A;  4DSK A;  2OYY A;  1ZQK A;  2WB1 C;  9ICC A;  1KQQ A;  4I2G A;  3QU5 A;  3PMN A;  4ED2 A;  1UHU A;  1V38 A;  2PFP A;  3PST A;  4F92 B;  2FMS A;  1Y88 A;  1MQ2 A;  8ICU A;  1M9F C;  3Q8L A;  3DDH A;  2ESE A;  3H8J A;  1A0P A;  1SV0 C;  5AM2 A;  2H5X A;  4M9J A;  5ALK A;  2JZB A;  2WB1 F;  4YXM A;  5KFG A;  4NM1 A;  4U0B A;  3LVV A;  1L3U A;  2JEJ A;  3PSP A;  2V4R A;  5L1I A;  4PHA A;  2I1Q A;  3OGU A;  4U0A A;  3QUC A;  4HAI A;  5IIO A;  4NWI A;  1UA0 A;  2YQE A;  2ZJ5 A;  7ICV A;  2KK0 A;  2IA6 A;  1M9C C;  4OJ6 A;  4U6P A;  2EAN A;  3RAQ A;  2ASL A;  8ICI A;  3IM1 A;  3WK8 A;  4Y2V A;  4DL7 A;  4RQN A;  3L5K A;  2GWS A;  3IDW A;  2NRZ A;  4PZN A;  2NYV A;  2QAR A;  2BHN A;  8ICH A;  5IIJ A;  2XO7 A;  3MR5 A;  3GV7 B;  1TAM A;  1OUQ A;  3WK7 A;  3NRZ A;  5AKI A;  3PX6 A;  3HRD D;  2BCV A;  5KFY A;  1Q8K A;  4YP3 A;  3H47 A;  4QZA A;  2RHF A;  2KEY A;  3LK9 A;  3SAG A;  4QWD A;  2BCU A;  2JEF A;  8ICJ A;  2C2D A;  2Q4T A;  1S0O A;  1RDF A;  1LVH A;  2CXY A;  1JMS A;  4OO1 J;  2C2R A;  2ALZ A;  1Z4N A;  2J6S A;  1XO1 A;  3I76 A;  8ICN A;  4RT2 A;  5DGB A;  3NTU A;  8ICG A;  5CJ7 A;  2E5S A;  5HGL A;  4WJ3 B;  4UB2 A;  9ICW A;  3LVW A;  5ALQ A;  1SL0 A;  1N56 A;  1WCL A;  4FZN A;  4PZO A;  5KG7 A;  2W9B B;  4RPZ A;  5KTQ A;  1RYU A;  2W11 A;  3UXO A;  4UAW A;  4USA A;  3N7P D;  2FLL A;  1SL1 A;  3WKD A;  3AU2 A;  5IIN A;  4C4R A;  9ICM A;  2ZUC A;  4X5V A;  4C8L A;  3GIJ A;  4PHE A;  2DKX A;  4R8U B;  3CP8 A;  2KGF A;  4C7Y A;  2PXR C;  3QU2 A;  3Q8P B;  3NVV A;  5DDM A;  1DXS A;  2XC9 A;  2KJ5 A;  2XDE A;  3PO5 A;  4I2H A;  4CF3 A;  4KN7 A;  3H8S A;  3SQI A;  2BCQ A;  2DF4 B;  5ALJ A;  4DSJ A;  3K75 D;  2XGY A;  1RM6 C;  5T14 A;  2GOL B;  4ECV A;  2PFO A;  7ICU A;  4EEN A;  4RUA A;  1NK5 A;  1RPL A;  5J2G A;  2E1E A;  3C2K A;  2H3V A;  4QZF A;  2PXI A;  9ICB A;  5DB6 A;  1COK A;  2QB1 A;  5AM3 A;  4B6J A;  2XGU A;  2DBY A;  5L1L A;  1NK9 A;  1XU4 A;  5ALN A;  4EEL A;  5DQI A;  3UXP A;  4QIW F;  5AKE A;  1B4F A;  3MBY A;  1XSN A;  4R63 A;  5KG5 A;  4UAY A;  2CPR A;  2NO5 A;  5CHG A;  3Q8S B;  3C1Z A;  3NS1 A;  5A0L A;  4YG2 A;  4I2E A;  4UB8 U;  2WF5 A;  3M6Z A;  4DLE A;  2W7O A;  2ZJ8 A;  5KAI U;  1Z19 A;  3EW9 A;  2MUT B;  4EEK A;  1JI7 A;  4ELV A;  2QKQ A;  1BPX A;  1LKY A;  5KFP A;  4O3N A;  4BX9 C;  3BQ1 A;  4EX7 A;  4IQW A;  3PW2 A;  4M6W B;  4F5Q A;  4PGQ A;  1N63 A;  4DQR A;  1UA1 A;  1KFT A;  2V9W A;  4DSF A;  4P0Q A;  4C7Z A;  4I2F A;  2KIC A;  1C7Y A;  2PI5 A;  1UT5 A;  2R18 A;  1QH9 A;  5TIS U;  3L3F X;  5KFA A;  2MA1 A;  3S6J A;  3SEN A;  3QE9 Y;  1IIP A;  3WK4 A;  4R66 A;  4QZ8 A;  5HNK A;  3ORY A;  3RF9 A;  4UB4 A;  1U48 A;  1KN5 A;  3QU9 A;  8ICS A;  1SZH A;  1L6N A;  4FS1 A;  1ZQH A;  3RJJ A;  4KIT B;  1ARO P;  1ZD3 A;  2C2E A;  2JRZ A;  2A19 A;  2YML A;  2KZZ A;  2KKP A;  4PHP A;  4ICA A;  3RRG A;  2EZY A;  2FLN A;  2DGZ A;  2F2A B;  4DS4 A;  1S97 A;  1UPH A;  8ICB A;  2JGA A;  1ECW A;  1U9L A;  2P35 A;  2IOH A;  3F53 A;  4KLD A;  1ZQV A;  7ICS A;  5IIL A;  1DRG A;  1RQL A;  4UB3 A;  2D8C A;  4I2D A;  4DSL A;  4A8E A;  3KTQ A;  1ZQX A;  4KLF A;  7ICF A;  1VLB A;  4JV2 A;  5AKK A;  4B9M A;  4PJ0 U;  1XC9 A;  3TFS A;  2Y4Z A;  4CDG A;  2DFL A;  1S0V A;  1NJY A;  1N62 A;  5JUM A;  1PUZ A;  3E2E A;  4QWC A;  5C5J A;  3ETL A;  3HKZ C;  4J9P A;  2WAQ C;  5KFH A;  4ECS A;  1O03 A;  2A3V A;  3TAR A;  1S10 A;  1T3N A;  2HBL A;  2BGW A;  1B22 A;  3TAD C;  5AI8 A;  2JV3 A;  2HHS A;  4BGD A;  3HX0 A;  5GTH U;  1X9X A;  2ZIV A;  3PML A;  4OCZ A;  4CGZ A;  1ZQW A;  4IQV A;  5J0Q A;  3PSI A;  5CA7 A;  1OXJ A;  2WAQ F;  4BXO A;  1NKB A;  5EE0 A;  3B0X A;  4LVS A;  4DL4 A;  1TV9 A;  4E91 A;  4HYK A;  2G5H B;  2A1J B;  2WF7 A;  1KBU A;  8ICZ A;  4DSI A;  5AKZ A;  1FO4 A;  4Y2S A;  3D6J A;  1SB3 C;  4K4I A;  3MGE A;  1SZP A;  1XO0 A;  1L8L A;  1PVP A;  1MN8 A;  1K1Q A;  4C0Z A;  2F1I A;  1ZJN A;  3KHG A;  4PH5 A;  2W9C A;  5AHX A;  1X66 A;  2PWO A;  1KLN A;  2QB0 B;  4DL5 A;  5TZV A;  4M0A A;  2K4H A;  2FLP A;  1L3S A;  2H3I A;  8ICT A;  1GWP A;  7ICK A;  4F71 A;  1S76 D;  3BJY A;  2B6G A;  5AI4 A;  5J8Y A;  5HP4 A;  1L5U A;  4UB1 A;  1ZQG A;  2DKZ A;  5HGO A;  2KP7 A;  4B9U A;  4JWN A;  4C8M A;  2XID A;  2RRD A;  4B9L A;  1Z00 A;  4PPX A;  2IHM A;  3WK5 A;  3ZDA A;  2K89 A;  4RZR A;  5J0P A;  3JPS A;  2W04 A;  3VCB A;  2LYH A;  4IL6 U;  2KE7 A;  1L7N A;  2MU2 A;  4ELT A;  1PZN A;  2HHX A;  1M9D C;  5DG9 A;  4F2S A;  2KFN A;  1L7P A;  2LMR A;  3H0L B;  2E8P A;  3SMV A;  2XGV A;  3QX7 A;  5ALV A;  2KVS A;  1KRP A;  5EWF A;  1RYR A;  4BDP A;  8ICX A;  2M8P A;  1L7O A;  3U26 A;  2HW3 A;  2LKY A;  4M9N A;  4DFJ A;  3QZ8 A;  3AQE A;  4I2I A;  3PW4 A;  1TE2 A;  8ICO A;  4NLC A;  1ZQL A;  4XFX A;  5KFV A;  4P4O A;  2ZXH A;  1QSS A;  1XNS A;  4KLH A;  4WYM A;  1DK3 A;  2XCA A;  5DBB A;  4KX3 A;  4IR9 A;  4NV0 A;  3QUT A;  4ECW A;  4FBU A;  3PW0 A;  5ALM A;  4IRK A;  7ICO A;  1M9X C;  2D3D A;  2MSN A;  4DFM A;  5ALW A;  1QRJ A;  5B5E U;  2JH1 A;  3KZX A;  2QLT A;  7ICQ A;  5IIK A;  4P4M A;  3ZDD A;  1JRP A;  5ALZ A;  4PL1 A;  3N4M B;  1ZQA A;  3KHH A;  2VA3 A;  5KFC A;  1WYG A;  3RR7 A;  2XY7 A;  3PR5 B;  1X9W A;  2HVH A;  2FI1 A;  4RPY A;  5AKH A;  5AKL A;  1NJX A;  2GON A;  4RT3 A;  3N28 A;  4KLG A;  1PK1 B;  3DEE A;  1ZQT A;  2G06 A;  4I29 A;  2V4Q A;  5ALH A;  4EZ6 A;  3V7L A;  1KDH A;  1SIJ A;  3H0R B;  1N60 A;  3BZK A;  1ZQM A;  1KSP A;  4UAT A;  5DKW A;  4KMO B;  5J8Y C;  4F4K A;  4E0D A;  4F3O A;  1M9Y C;  3G6X A;  3THV A;  5ALE A;  5J2H A;  2G09 A;  2B0C A;  2WFA A;  4YMM A;  4Y2R A;  2W7P A;  2K8C B;  2XIC A;  3M9M B;  2AU0 A;  1Q46 A;  3CW2 C;  3HW8 A;  4UQG A;  4ECT A;  4J9O A;  7ICE A;  2B21 A;  2E8N A;  4J03 A;  5ALT A;  4YFK A;  3F2C A;  5KFQ A;  2JZB B;  5DGA A;  1LB2 B;  4I2C A;  4EYH B;  3JPT A;  3L4P A;  1T3Q A;  4YMN A;  2HOQ A;  5ALS A;  3PVX A;  8ICY A;  1NKC A;  4QW8 A;  5KT7 A;  1SL2 A;  1SKS A;  4NL9 A;  1D1D A;  1TFR A;  3UMC A;  5JU5 A;  4F91 B;  5ALR A;  4RNM A;  2XCP A;  2OXO A;  2YMP A;  2LM1 A;  1F5S A;  4DO9 A;  1WCN A;  1QSL A;  2J6U A;  1JAL A;  2CRX A;  4O3O A;  2ZUD A;  4INB A;  4Z6C A;  2JPR A;  1N2X A;  2LM4 A;  1P7D A;  3OJS A;  3ISB A;  5K4L A;  3C5F A;  2BPC A;  4UW9 A;  1RYS A;  3IHQ B;  4TUS A;  3C1Y A;  3M8R A;  3Q8Q B;  2QAR B;  1Q3V A;  5L1J A;  3R9K A;  4TQS A;  4YQW A;  5DB9 A;  9ICV A;  2RP5 A;  4NLG A;  2X82 A;  9ICT A;  3ISD A;  3N97 B;  1XS9 D;  4QWA A;  3MDC A;  4PGX A;  9ICQ A;  2NRW A;  3F5A A;  4RQ3 A;  1VDV A;  4IS7 A;  5BPC A;  3TKA A;  9ICA A;  4B9N A;  3T5L A;  4EZ9 A;  1ZD4 A;  1T7P A;  4DFK A;  1D8L A;  1ZQC A;  5AM5 A;  2Z7J A;  4EBE A;  1ZQQ A;  3H7I A;  3PO4 A;  1IV8 A;  2EZX A;  1L3V A;  4Q44 A;  4O9M A;  4FZM A;  4J9K A;  2I6X A;  1V9P A;  2HMX A;  3RH4 A;  5ALF A;  2W03 A;  3C5G A;  3BDP A;  1D9D A;  4ED8 A;  1ZQ1 C;  2DUY A;  3F2D A;  3QXG A;  1RG6 A;  5E79 U;  2M8L A;  4PHD A;  1SKW A;  2WF6 A;  5J2B A;  3H8W A;  4NJ8 A;  3GII A;  4JV1 A;  2JEI A;  4ECY A;  5AIB A;  2HOI A;  1X2I A;  2BR0 A;  3UXN A;  1MC8 A;  4K4H A;  9ICU A;  3ICX A;  5DBC A;  2W3R A;  3SAF A;  1KL9 A;  1DGS A;  2Q0Z X;  1NZB A;  3RAX A;  3Q8M A;  1COO A;  2HBK A;  2I5H A;  5BOM A;  3KHR A;  1NKE A;  4DL2 A;  3PX4 A;  4NL9 C;  4IRD A;  1K1S A;  3GFK B;  1JUD A;  5AKY A;  3DV9 A;  2BCR A;  1WUD A;  5FP0 A;  1HUZ A;  4GXK A;  5CWR A;  9ICI A;  4GLX A;  5DG8 A;  9ICN A;  5F9N A;  5AI5 A;  1UCV A;  1T94 A;  2AXT U;  3M8S A;  4NLK A;  2GH1 A;  3JPP A;  7ICG A;  2W9B A;  1Z1B A;  5HR7 A;  3RB0 A;  8ICW A;  3ZDC A;  1RXW A;  1AQ6 A;  2BCS A;  5ALO A;  3MDA A;  4ECR A;  4P4P A;  2YMM A;  3UMB A;  2F8L A;  4QIW C;  5D46 A;  3TAN A;  2LHT A;  1Q3U A;  3EZ5 A;  8ICE A;  2NRX A;  4JK1 A;  1V85 A;  3TAD A;  5KNI A;  4XUS A;  2AHO B;  1LKY B;  3AU6 A;  4JMU A;  1KW4 A;  3FDS A;  4I2A A;  5KT3 A;  1HUO A;  4BUG A;  2HI0 A;  5KFF A;  4YD2 A;  2KVC A;  2ZG6 A;  1JXE A;  4DQS A;  4DCC A;  5EWE A;  4LJX A;  1QCK A;  4P0Q B;  5EE3 A;  2R8H A;  3EUB 2;  4YR2 A;  2GOL A;  2W8K A;  1S9F A;  4RQ0 A;  2Y9T A;  3NVY A;  4F5R A;  2LYB A;  4DSE A;  2AJQ A;  3RJH A;  1NJW A;  2LPE A;  5KFU A;  1AK4 C;  2E8M A;  3GIM A;  5BOL A;  1B0X A;  4M47 A;  8ICL A;  4FS2 A;  2HVI A;  2ISP A;  4OJ5 A;  2WLV A;  2KN7 A;  8ICM A;  9ICL A;  3MAB A;  2HHV A;  2DQN B;  4DQQ A;  2X83 A;  2PMZ F;  1BPB A;  3O0F A;  3OHB A;  5J29 A;  5KFZ A;  3J81 j;  1ZQD A;  2DL0 A;  1YZ6 A;  5AK6 A;  1KKX A;  3RRH A;  8ICC A;  4OJL A;  4F4Z A;  2OEH A;  3UQ0 A;  1ZQJ A;  4F8R A;  1N5X A;  3GIK A;  3QEB Z;  1A77 A;  2M9N A;  1BPD A;  4DWI A;  4CE6 A;  4QZG A;  2AGP A;  3PW5 A;  3ZDB A;  4DLG A;  2XGQ A;  1JRO A;  2NRT A;  9ICP A;  2W55 A;  4NLB A;  1EIA A;  2EQY A;  3AM9 A;  1IM4 A;  2FMQ A;  5ALL A;  2EAM A;  3RJK A;  4ZOH C;  4UAR A;  5CEH A;  2OH2 A;  4RQM A;  1CUK A;  4U0C A;  4J9L A;  1TAQ A;  2JXJ A;  1JXL A;  1ZET A;  3H0M B;  3WKA A;  3T5K A;  2ZIV B;  3B0Y A;  8ICR A;  3OJU A;  2M0N A;  4BXO B;  3NGD A;  5AM4 A;  4XRO A;  3C2L A;  1JN3 A;  4Z6F A;  2F3N A;  4B4N A;  2NRV A;  2W9M A;  3JPO A;  2BPG A;  2ES6 A;  5KG0 A;  3H4D A;  2EH9 A;  4J9N A;  3MGV A;  4QWE A;  2XY6 A;  3PZP A;  3NUQ A;  4CNQ A;  2K8B B;  4C8N A;  1ZQI A;  1S5L U;  4F2R A;  2VJ5 A;  1ZOL A;  3D2N A;  2W9C B;  1FIQ A;  3GDX A;  3MR2 A;  2H3Z A;  4ECU A;  4Q8F A;  2PI4 A;  1HJP A;  4LZG A;  1T8E A;  4UB6 U;  2BKE A;  2G0A A;  1CRX A;  5HGK A;  4DGE C;  1D8B A;  5AK3 A;  3RFA A;  2FE9 A;  4Y2U A;  2XGP A;  2LYA A;  4RUC A;  3TAC B;  1ZQB A;  2ZTE A;  2KFZ A;  5JPA A;  4MEY A;  4F93 B;  4ECZ A;  2AQ4 A;  2PFQ A;  3NVW A;  2FJ6 A;  3K4G A;  2ASD A;  4K4G A;  3SD7 A;  4F4X A;  3TAP A;  3ISC A;  1Z00 B;  2EIA A;  2JR5 A;  1ZRN A;  4TUR A;  4KLJ A;  1ED1 A;  4DOA A;  2ZIX A;  2KMD A;  2OM6 A;  4PGY A;  1ZQY A;  3OSN A;  3AQF A;  5J0X A;  4U0E A;  2KIV A;  1N5W A;  2WF8 A;  2V4X A;  2AQ0 A;  3V6H A;  5DBA A;  5L1K A;  5KFT A;  4OD0 A;  3UM9 A;  4P0P A;  2KZ3 A;  4DL6 A;  4JWM A;  5L1M A;  3BS5 A;  2BDP A;  2D6F C;  1ZQZ A;  3SR6 A;  1BNO A;  4FZL A;  4M9G A;  1D8Y A;  3LDA A;  2H3F A;  1GO3 F;  1Z1V A;  5G5G A;  2RLT A;  3D2Q A;  4O3S A;  4O5E A;  4M04 A;  1XWL A;  5KG3 A;  4JUZ A;  2YY6 A;  1DOQ A;  3E58 A;  2KOB A;  1QQ5 A;  1X42 A;  3BQT A;  4OJP A;  3G6V A;  5J0R A;  2L5Y A;  2E3T A;  4BJQ A;  5JRT A;  3TQ1 A;  2XI9 A;  1PK3 A;  2YMQ A;  1FFV A;  3KZI U;  4QZI A;  2DWQ A;  4QZB A;  4RQ8 A;  5EWG A;  3ZD8 A;  5AKJ A;  1B43 A;  5III A;  1AFV A;  5DQH A;  2PWM A;  3AN1 A;  1NNL A;  4NLZ A;  1F0M A;  5J2A A;  5L9X A;  2J6T A;  4DQI A;  3HT3 A;  1F44 A;  4XQ8 A;  2AGQ A;  3OPX A;  3C21 A;  1PVQ A;  3AEV A;  4HTW A;  2KSO A;  3EYZ A;  5CB1 A;  1X6J A;  1DK2 A;  4MF8 A;  5KG6 A;  3WU2 U;  4F50 A;  2F76 X;  4GC6 A;  3RR8 A;  3BQ2 A;  2F1J A;  1QTM A;  9ICO A;  1RXV A;  2ASJ A;  9ICG A;  2W8L A;  4ELU A;  4MF2 A;  4YMO A;  3ZI4 A;  2KHQ A;  3IG5 A;  2KJ9 A;  3BQ0 A;  4MFF A;  5J0U A;  3RBD A;  5KFI A;  2ZIW A;  4F4W A;  5AIA A;  4IRC A;  3QU7 A;  4U7C A;  5J0T A;  5DDY A;  3IN5 A;  1UT8 A;  2JH7 A;  1YZ7 A;  5DLF A;  2X2D D;  1ZQF A;  4C8K A;  1ZD2 P;  1QQ6 A;  3SEI A;  4XFY A;  4EX6 A;  1ZRM A;  2XVT A;  2ZIU A;  4MHV A;  3T79 A;  1CI4 A;  3MFI A;  3K1Z A;  3M9O B;  1MSW D;  5DB8 A;  2BQU A;  2HOF A;  4QZC A;  4QZD A;  3RH5 A;  2KZM A;  1NK4 A;  5DG7 A;  4RQ6 A;  1PVR A;  5ALY A;  4EYI B;  3BQ7 A;  3RBE A;  1BGX T;  9ICJ A;  3EPI A;  3IG8 A;  4LQW C;  2VKQ A;  4XA5 A;  9ICR A;  5KG4 A;  1D9F A;  4DF8 A;  5J0O A;  2K60 A;  4YR3 A;  1ZQU A;  1TK0 A;  3F5E A;  1U49 A;  3G6Y A;  1ZJM A;  5KT4 A;  3GZF A;  2EZZ A;  2UVR A;  3LYS A;  1J2M A;  3H8M A;  7ICL A;  2R8J A;  1V97 A;  3UMG A;  4ED6 A;  3PY8 A;  4M9H A;  1SGG A;  4CF4 A;  3MFH A;  4B9S A;  5EE9 A;  2W54 A;  3M7D A;  4DF4 A;  3RJF A;  3RJG A;  3H4E A;  5HGM A;  1L3T A;  3JPQ A;  5KL1 B;  2KG5 A;  5AI0 A;  5CR0 A;  4ACO A;  1T4G A;  4KTQ A;  4Q43 A;  2KHV A;  4ECQ A;  1ZQN A;  4UAV A;  3MR3 A;  3NAS A;  3CNH A;  7ICM A;  4I2J A;  5CRX A;  3WKB A;  1UQV A;  3M1Y A;  1HEK A;  1OW5 A;  4O5C A;  2FPL A;  2AH5 A;  4DQP A;  5ALI A;  3KOO A;  4G3I A;  7ICJ A;  1M6Y A;  4EEY A;  2NV3 A;  3GIL A;  2LF4 A;  4PH0 A;  3PW7 A;  4GXJ A;  4I2B A;  2IHN A;  3GQC A;  2NO4 A;  5F9L A;  1KFD A;  4Y2Y A;  1TAU A;  5EE1 A;  3MGI A;  4XFZ A;  2K4I A;  2JMG A;  3HJE A;  2I9G A;  4U0D A;  2BZF A;  2PFN A;  2H3Q A;  4IQT A;  3SI8 A;  1J97 A;  1X40 A;  2WTF A;  8ICK A;  4RU9 A;  4Y2P A;  2RQ5 A;  3V72 A;  2HBM A;  2VAN A;  2EAP A;  8ICA A;  4RQ7 A;  4EBD A;  5KAF U;  4PH3 A;  1S0M A;  4NLN A;  2KIW A;  1NJZ A;  2Y9U A;  5F3X B;  3QZ7 A;  1U7K A;  3FYH A;  1VJ5 A;  4AYB C;  3MR6 A;  1CEZ A;  4RQ2 A;  2KKV A;  5KG2 A;  4G9B A;  9ICE A;  4GFJ A;  2W9A A;  2F1H A;  1HIW A;  1IXR A;  4MFC A;  3QNM A;  2BDU A;  3NVZ A;  4YN4 A;  3KFU F;  4QNB A;  3SV3 A;  5AI9 A;  3IRU A;  3SV4 A;  5AM0 A;  4Z6E A;  4AYB F;  1BNP A;  8ICF A;  3HPO A;  4IQU A;  3GV8 B;  2BQR A;  4PL2 A;  5ALD A;  3FM9 A;  4KLQ A;  4JV0 A;  2AGO A;  2W3S A;  3M9N B;  1S0N A;  5KT5 A;  7ICT A;  1U47 A;  9ICH A;  1S8O A;  5HHH A;  8ICQ A;  2YTU A;  5JTI A;  5ALG A;  1SV4 A;  1NK8 A;  3AMZ A;  2R8I A;  3NRW A;  5KFW A;  3H40 A;  3GV5 B;  1L7M A;  4R64 A;  3RB3 A;  4KLI A;  5AIC A;  8ICP A;  2UVU A;  3LWL A;  1JX4 A;  4BWM A;  1S77 D;  2JEG A;  1A6S A;  4UAS A;  2YB4 A;  4Y2T A;  4R8U A;  3Q8R B;  5KFK A;  5J2I A;  2EAO A;  1TK5 A;  1NK6 A;  2C22 A;  4UAU A;  4EBC A;  4ED1 A;  1NOM A;  2YN4 A;  3EWA A;  1TK8 A;  1ZQR A;  2UVV A;  4UAZ A;  2ZTC A;  1EXN A;  4GC7 A;  1ZQO A;  2M8N A;  5J2C A;  2WLV B;  1MA7 A;  2ZTD A;  4US9 A;  3RTV A;  5KFL A;  4KLU A;  1JIH A;  1E6J P;  7ICN A;  4F4Y A;  1H38 A;  5CP2 A;  2HHW A;  4BWJ A;  3V7J A;  3EPG A;  5IIM A;  1X9M A;  5D49 A;  3RJE A;  2Y1J A;  4NY8 A;  2IBK A;  4B9V A;  2HCF A;  2PMZ C;  1KTQ A;  2JHD A;  5HML A;  4KLL A;  4I27 A;  9ICX A;  3B9J A;  5KFE A;  4Y2X A;  2PKE A;  5KFX A;  5KFO A;  2KNJ A;  4RQ4 A;  2LI6 A;  4R65 A;  4J93 A;  1RZT A;  2OCE A;  2RDI A;  3SZ2 A;  4OJO A;  1FEZ A;  3IP4 B;  3ALR A;  1XSL A;  2P6U A;  4GXI A;  2F8K A;  3WK9 A;  3TAQ A;  1L8O A;  1XSP A;  2ISO A;  3Q8K A;  5B66 U;  4MFA A;  2HHU A;  3SAH A;  3ETR A;  2G5I B;  2MUT A; 
#chains in the Genus database with same CATH homology
 2W7P A;  2K8C B;  2XIC A;  2D6F C;  3ONN A;  4FZL A;  2H3F A;  3N7P D;  1GO3 F;  3F2C A;  3D2Q A;  4XRQ A;  2K8A A;  1M9E C;  2KGF A;  3CP8 A;  2HOQ A;  3N7R C;  2PXR C;  2KOB A;  3BP9 A;  5C0Y A;  4NX4 C;  1D1D A;  4OJP A;  2KJ5 A;  4BJQ A;  2XDE A;  3VC8 A;  2XI9 A;  2OXO A;  3CRX A;  1P7N A;  3SQI A;  2ZXI A;  2DF4 B;  3P05 A;  2CRX A;  4INB A;  1AFV A;  2VIX A;  1P7D A;  2JPR A;  2PWM A;  2XGY A;  5T14 A;  2GOL B;  1F44 A;  1Q3V A;  3OPX A;  1PVQ A;  4HTW A;  2RP5 A;  2E1E A;  2X82 A;  2H3V A;  2Y0S C;  2F76 X;  2XGU A;  2KJ8 A;  2ZIX B;  5HR6 A;  3F5A A;  3HKZ F;  2N1R A;  4QIW F;  2KHQ A;  3IG5 A;  2KJ9 A;  2CPR A;  3CYM A;  2Y0S F;  2KD1 A;  3NTE A;  5A0L A;  2Z7J A;  2ZIW A;  4P0P B;  4U7C A;  3M6Z A;  2W7O A;  3IN5 A;  1Z19 A;  2JH7 A;  2X2D D;  4FZM A;  2CN1 A;  4BX9 C;  2HBJ A;  2HMX A;  2W03 A;  1ZQ1 C;  4XFY A;  2XVT A;  2ZIU A;  3T79 A;  3F2D A;  3AL0 B;  4FE3 A;  2M8L A;  3K1Z A;  2HOF A;  4P0Q A;  2KIC A;  2HOI A;  4CRX A;  3D2S A;  2R18 A;  1PVR A;  3ICX A;  3L3F X;  2MA1 A;  3SAF A;  1IIP A;  3RF9 A;  1SZH A;  2F77 X;  1NZB A;  1L6N A;  3IG8 A;  4LQW C;  2VKQ A;  2HBK A;  2KKP A;  4ICA A;  3F5E A;  2DGZ A;  2F2A B;  1UPH A;  2JGA A;  1ECW A;  3F53 A;  3M6K A;  3GZF A;  3LYS A;  1DRG A;  4KX5 A;  2K4E A;  5KL8 B;  4PH2 A;  1WUD A;  4A8E A;  4DGA C;  3N7S C;  2Y4Z A;  4CDG A;  1T94 A;  2GH1 A;  2LBO A;  1Z1B A;  5HR7 A;  2E1F A;  3M7D A;  3H4E A;  3HKZ C;  2F8L A;  4QIW C;  2WAQ C;  5HGM A;  2ZIW B;  2A3V A;  2LHT A;  5KL1 B;  4ACO A;  2HBL A;  1Q3U A;  3PSF A;  2KHV A;  1URJ A;  4JMU A;  5CRX A;  2ZIV A;  4CGZ A;  3E0F A;  1HEK A;  3PSI A;  4BUG A;  1EM9 A;  2WAQ F;  2KVC A;  2ZG6 A;  2ZIU B;  4E92 A;  2YX8 A;  2NV3 A;  2LF4 A;  4PH0 A;  4E91 A;  4P0Q B;  2G5H B;  2G07 A;  1KBU A;  2GOL A;  4QNL A;  3MGE A;  2LYB A;  1XO0 A;  4XFZ A;  2K4I A;  2JMG A;  3C28 A;  1PVP A;  4U0D A;  2H3Q A;  4C0Z A;  1AK4 C;  4OJ5 A;  2WLV A;  2PWO A;  3F2B A;  2HBM A;  4U0F A;  2DQN B;  4PH3 A;  2MRL A;  2KV2 A;  2KIW A;  2K4H A;  4IC9 A;  2X83 A;  2VJ4 A;  2H3I A;  2YB1 A;  1U7K A;  1GWP A;  2PMZ F;  3O0F A;  4AYB C;  1YT3 A;  2KKV A;  1G03 A;  4GFJ A;  5HGO A;  1HIW A;  2XID A;  4OJL A;  2RRD A;  2BDU A;  3KFU F;  4QNB A;  4O3M A;  5HGN A;  3GU3 A;  2K89 A;  3C29 A;  2W04 A;  3VCB A;  4AYB F;  4QJF B;  2G08 A;  1M9D C;  4PL2 A;  4NLB A;  1EIA A;  3H0L B;  3SMV A;  2XGV A;  2OH2 A;  2OYY A;  2WB1 C;  4U0C A;  2M8P A;  3H0M B;  2LKY A;  2ZIV B;  3AQE A;  3PST A;  2M0N A;  4NLC A;  3NRW A;  1M9F C;  4XFX A;  4XRO A;  2ZXH A;  4B4N A;  1XNS A;  4WYM A;  1A0P A;  2WB1 F;  4KX3 A;  1A6S A;  4U0B A;  3LVV A;  3MGV A;  2YB4 A;  4NV0 A;  3PSP A;  3PZP A;  3NUQ A;  2K8B B;  1M9X C;  4U0A A;  2VJ5 A;  1QRJ A;  3D2N A;  2M8N A;  2JH1 A;  4NWI A;  2H3Z A;  2WLV B;  3KZX A;  1MA7 A;  1M9C C;  4OJ6 A;  4U6P A;  2G0A A;  1CRX A;  5HGK A;  4DGE C;  1D8B A;  1E6J P;  4PL1 A;  3RFA A;  2LYA A;  5JPA A;  1TAM A;  2PMZ C;  1OUQ A;  2JHD A;  2GON A;  3DEE A;  2G06 A;  2EIA A;  3H47 A;  2KNJ A;  2RHF A;  2KEY A;  1ED1 A;  4J93 A;  3SAG A;  2ZIX A;  2OM6 A;  2Q4T A;  4OJO A;  3IP4 B;  3ALR A;  3H0R B;  3AQF A;  4OO1 J;  4U0E A;  4KMO B;  2V4X A;  1M9Y C;  2E5S A;  2G09 A;  5HGL A;  4WJ3 B;  4P0P A;  3LVW A;  3SAH A;  4FZN A;  2G5I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...