1L6NA

Structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
288
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal 283-residue fragment of the immature HIV-1 Gag polyprotein.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag Polyprotein
total genus 73
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1l6nA01
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1l6nA02
2XGYA 1D1DA 1M9CC 4LQWC 2K4EA 4B4NA 2XGVA 2X2DD 2X82A 5HGKA 1GWPA 1L6NA 2NV3A 5HGNA 3BP9A 4U0FA 1HIWA 2H3VA 2XDEA 2LYBA 4XFYA 1M9DC 1UPHA 4J93A 1TAMA 2GOLA 4U0CA 4XRQA 3NTEA 4U0BA 1HEKA 2WLVA 2H3FA 4XROA 2V4XA 4E91A 2HMXA 1AK4C 2LF4A 3H4EA 2GONA 4HTWA 2PWOA 4IC9A 2Y4ZA 4INBA 2JPRA 1G03A 4XFZA 2X83A 2H3QA 4NX4C 2M8PA 4E92A 1M9YC 4XFXA 1M9XC 5HGLA 2M8LA 1A6SA 1ED1A 2K4HA 1EIAA 2XGUA 1P7NA 2H3IA 1M9FC 4U0AA 1M9EC 1E6JP 4DGEC 2WLVB 4PH0A 3MGEA 2GOLB 1AFVA 4QNBA 5HGOA 2K4IA 1QRJA 4U0DA 4PH3A 4WYMA 2PWMA 5JPAA 2M8NA 2N1RA 2KGFA 3H47A 5HGMA 4PH2A 2H3ZA 4JMUA 1U7KA 2PXRC 2EIAA 1ECWA 4U0EA 1EM9A 4ICAA 3P05A 2LYAA 4DGAC 2JMGA
chains in the Genus database with same CATH superfamily
1TK8A 3H8SA 1PVQA 1M9CC 4M0AA 2UVVA 4KMOB 1CI4A 5HGKA 5EWFA 3QNMA 5DQIA 4E0DA 1T3QA 1SL2A 3BQTA 5DQHA 4YP3A 1HIWA 4O9MA 9ICPA 5KFVA 3M6ZA 2P6UA 2HVIA 5KFDA 3H4BA 5L1JA 4ECVA 4RQ2A 4XRQA 2G06A 1SV0C 3H8MA 2WAQC 3WK8A 2JRZA 2IA6A 1S8OA 5AIAA 1S0MA 1PK1B 2E8OA 2W3RA 4XFZA 5CHGA 3NVWA 5AKGA 1JN3A 4KLDA 3H4DA 3IV6A 4F2RA 5KFNA 2VIXA 2KD1A 2H3IA 3I28A 3SAFA 2DBYA 3RRHA 4C0ZA 1ZQ1C 3SV4A 3MR3A 3HWTA 3CRXA 4IR1A 4CCHA 2OWOA 3C2MA 3PSTA 3RB0A 2G09A 2VANA 5KG1A 5AI6A 5AI0A 1ZQCA 2KZMA 9ICKA 5AM4A 4PH0A 4DF8A 4Q8FA 3T79A 5L1KA 2W9CB 1MQ3A 2W9BB 4P0QA 2C28A 2V9WA 2QLTA 8ICRA 1T94A 1B43A 3WKCA 4U7CA 5CB1A 1BGXT 3PX6A 3D6JA 2DPJA 2W9CA 3C1YA 3NTUA 4Z6DA 2FLPA 3A0HU 4J9QA 1DK2A 4DGAC 5KFTA 1BPDA 3TANA 2KEYA 5J0YA 1JROA 3MR5A 2OHFA 2OEHA 3V72A 5KFYA 1SXEA 1B0XA 1JXEA 1PUZA 3GV7B 2H5XA 4NL9C 1L6NA 2XO7A 5D46A 4F5RA 5EWGA 2FDRA 3HX0A 1NOMA 2BCRA 4Y2TA 2YMPA 2D6FC 1TAMA 4C7ZA 4EEKA 1QSSA 4YR0A 2ASLA 3GDXA 5KT5A 5DB7A 4IS7A 7ICRA 5DBAA 3T5HA 3MABA 4YQWA 3TFRA 1U47A 7ICGA 1UA1A 2E1FA 1O03A 3F2DA 4P2HA 4NLZA 4ECTA 5ALYA 1HUOA 4CF4A 2J6SA 1FEZA 3V7KA 4NLNA 1ZETA 2HOFA 5J2CA 4UAYA 4ECSA 1A6SA 2ZUCA 2BCVA 2BDUA 1IM4A 4YVZA 2XICA 4U0AA 1K1QA 2B6GA 5EE0A 1Q46A 4IQUA 4J03A 5CP2A 1E6JP 2OM6A 3GIJA 9ICEA 3MBYA 2OCEA 5DB9A 5ALFA 8ICMA 3GFKB 2D8CA 4J9MA 4F4ZA 2XCPA 2NRVA 5AKYA 1QSYA 1KLNA 8ICTA 3JPSA 2FE9A 4PHPA 1NKCA 3SV3A 1ZQXA 4ELTA 4CF3A 5C0YA 1X6IA 3IG8A 4GLXA 4O3SA 1SIJA 4PH5A 7ICUA 8ICGA 2LMRA 4C8MA 1Q8KA 3M8SA 3D2NA 4Y2QA 5ALIA 2OYYA 3EZ5A 5J0XA 1ZXIA 3F2BA 5GTHU 4UW9A 1N61A 5EE3A 4Y2JA 2R8IA 2RP5A 3H40A 4ECXA 1AROP 5HGNA 1SV4A 4QZIA 1X6JA 1S10A 3KHGA 3UMGA 1T3NA 2VKQA 4UB8U 5G5HA 1ZJMA 3QUBA 2Z7JA 4BWMA 4QW8A 4U6PA 1UPHA 4FZNA 1MN8A 2KG5A 4CDGA 4GXIA 2YB4A 2LPEA 2E3TA 3THVA 5ALSA 2BDPA 2AGPA 4ECYA 4NWIA 4P0QB 4IC9A 3TFSA 2VJ4A 3TADC 2G5HB 2UVWA 1D8YA 4DO9A 3F53A 2BZFA 1L5UA 5AK5A 1ZQPA 3PO5A 3F5AA 3HRDD 3PX0A 1RZTA 2W3SA 5AM1A 2R8HA 3DDHA 3AQFA 4M6WB 3WU2U 1L3SA 1B22A 4YMOA 2ZTDA 1ZQGA 3NVZA 2JGAA 4NLCA 5KT7A 5AM0A 2CXYA 2Q0ZX 2FLLA 2W03A 1AFVA 5EE9A 3AMZA 1NJYA 2KJ9A 3MDAA 4KX3A 1QRJA 3E2EA 1D9DA 1RYSA 4U0DA 2GLEA 2ZIXA 3E0FA 3PW7A 1DGJA 4GC7A 5DB6A 5ALJA 2YX8A 3ED5A 1AQ6A 4KN7A 2K89A 5J2FA 3MC1A 3PSFA 4ECZA 4ICAA 3BQ0A 1KN5A 1CUKA 4DSIA 4RQ7A 2NRZA 3C1ZA 3PW4A 5KTQA 3RAQA 1N56A 4UB5A 2FLNA 2BPFA 3BDPA 1D1DA 4UAWA 3ETRA 3SMVA 8ICFA 2BPGA 4J9KA 4CE6A 4KLUA 3QEAZ 5KFFA 5DKWA 3RH5A 3PZPA 2BCQA 3BP9A 3ZDCA 3IM1A 2W7OA 2XDEA 4XA5A 1N5WA 1UT8A 4GXJA 1M9DC 5J2HA 3RR8A 5CJ7A 4ED0A 3RJEA 1SZHA 4U0BA 5KFSA 4XRHA 2HW3A 1PK1A 2HMXA 2LF4A 2ZIWA 2MAXA 8ICAA 2PWOA 4DQIA 5AHXA 9ICLA 2Y4ZA 7ICQA 2V4RA 1RQLA 2JPRA 4DL5A 3AM9A 3QU9A 2EZYA 3Q8RB 3MGHA 2W9AA 4KX5A 2AH5A 1UHUA 2Y9UA 2XY5A 2HHVA 4IR9A 2XGUA 4Q8EA 5IIKA 3JPOA 2DWQA 3PR4A 2L5YA 4DSLA 4RT3A 3WK6A 2MU2A 2ODGA 3M9NB 2WLVB 1DOQA 5KT3A 4DF4A 3HILA 3D2SA 1TVAA 5ALRA 4DSJA 5TZVA 2DQNB 1Z1BA 1SGGA 2I1QA 1N63A 1VJ5A 3BJYA 5L1IA 9ICVA 1PVPA 1IV8A 1F44A 1COOA 4QZFA 1RQNA 2HBKA 2XIDA 1BPXA 5HNKA 5IIJA 2KNJA 1Q3UA 1RPLA 4KLHA 4PGQA 4OJ5A 3NS1A 1A76A 3LYSA 2HOQA 3EW9A 3QUTA 4TQSA 2WB1C 2ZIVA 5IINA 2AU0A 1JMSA 5KFQA 2F76X 3V6HA 3MR2A 5L1MA 2EDUA 4GC6A 3QZ8A 5AKLA 3LVVA 3U26A 2ASDA 9ICSA 1QCKA 2HHXA 3K1RB 4F3OA 4M9HA 2UVUA 1XU4A 3KHHA 4ELVA 4DLEA 1JUDA 1ZQNA 1AK4C 3HW8A 2F2AB 1G03A 3RBDA 4K4GA 2X83A 2WHEA 4I2GA 1JI7A 2WF8A 4AYBC 5DG8A 2DKZA 3G6VA 5HGLA 2IOFK 2PFQA 1TAQA 4USAA 4DQQA 5ALDA 5J29A 2KVSA 2E8PA 4I2CA 1ZQWA 5H2FU 4RUCA 1XNSA 4PL2A 4DL2A 4NY8A 2W7PA 2QKQA 2ZIUB 1KFSA 2KN7A 4BWJA 3MGVA 3FDSA 1RG6A 2ZJ8A 4UAZA 1NZPA 3RAXA 5DB8A 1U9LA 1L7OA 2IOFA 3N28A 4O3NA 8ICCA 1BVSA 2H3ZA 5KFOA 8ICJA 4RNNA 1A0PA 4UB4A 1EM9A 8ICSA 1U49A 4O3OA 4Y2UA 4F5PA 2NRTA 5AI5A 1YT3A 2K8CB 3MGIA 2BR0A 2KMDA 3L5KA 1ZQAA 4YXMA 4O3PA 3L3FX 1JALA 2HHUA 1Z4NA 4QZEA 4BX9C 2F1HA 4O5KA 4O3RA 2LYBA 4PHAA 2PI5A 4XFYA 4EENA 4QZHA 5DLFA 3TQ1A 4F91B 5KT4A 3NTEA 1HEKA 3QUCA 2KJ5A 2WLVA 4UASA 3QX7A 1YZ6A 4UQGA 2V4QA 4LZGA 2C2DA 2BKEA 4BXOA 5HR6A 4NLGA 2H3QA 2WF9A 4C8LA 2YMLA 2M8LA 3O0FA 4DQRA 4X5VA 4O5EA 4BDPA 3BQ2A 1QQ6A 1S76D 8ICVA 1M9FC 4JV1A 4TQRA 1BNOA 1EXNA 3LVWA 4PJ0U 2KJ8A 4XQ8A 1S97A 4F72A 4GXKA 2KKPA 3RF9A 4B9TA 2E1EA 1T8EA 5J2JA 2MSNA 4EX6A 2ZIVB 4OJLA 2Y1JA 1S0VA 2VJ5A 5HGOA 2YTUA 3PW5A 4C4RA 4I2IA 2D3DA 4UB2A 4TUPA 3SR6A 2XY6A 1NK8A 4DSFA 4KLLA 4EX7A 1X40A 2N1RA 5HGMA 4Q45A 4C4SA 2KIWA 2JZBA 4QZDA 4M04A 2A1AA 4OO1J 2AHOB 2Y0SC 4QW9A 3GV5B 2KTQA 2R18A 4J9LA 8ICKA 4LVSA 4NM1A 4ED6A 1RYRA 4ED8A 3OJSA 4MFAA 5BOMA 4F4WA 2X82A 4ED3A 4R64A 1J2NA 2NV3A 2HHWA 3TARA 2ESEA 3I76A 3SEIA 2UVRA 5HHHA 4RPXA 5J8YC 1NK9A 1PK3A 3EWAA 3KFUF 1NJXA 1V38A 4RT2A 1KFTA 5KFAA 2RLTA 5AK3A 3EUB2 3C28A 2LYHA 2GOLA 4IQVA 5KFUA 2E8MA 4KLQA 1Z1VA 2H3FA 1ZQFA 3V6JA 3IHQB 4E91A 1TFRA 1QQ5A 4EEYA 8ICUA 4DOBA 5J8YA 1GO3F 2GWSA 3QU7A 3L4PA 5DBCA 2W11A 2WF6A 5AI8A 4EYHB 1N62A 1XSPA 3PW2A 9ICFA 2FJ6A 1ZQHA 2K4HA 3GZFA 5CRXA 1P7NA 4QWDA 1KBUA 2JXJA 4IRKA 4A8EA 5KFZA 2RRDA 4LZDA 2DUYA 2DKXA 3QZ7A 3RJJA 2LM1A 3RR7A 4M47A 2KHQA 4OCZA 1ZQRA 1FIQA 7ICPA 1YZ7A 4I2EA 2K4IA 9ICIA 3WKEA 5ALXA 3TADA 4PH3A 3R9KA 1NNLA 4ZOHC 5JPAA 3T3FA 1OW5A 3ISDA 5HMMA 3IDWA 5KFEA 1L7MA 2JHDA 1U48A 1OUQA 1ZQSA 5DG9A 1TE2A 2IOHA 3P05A 2JEFA 3N4MB 2JH7A 5E79U 4C7YA 2K4EA 4B4NA 4DLGA 2BCUA 1JRPA 3VCBA 2EANA 4QZ9A 2Y0SF 4KTQA 3H0RB 3UMBA 1ZQVA 1NK7A 4B9LA 3PO4A 4O0IA 3OPXA 1KDHA 2EZZA 3FAHA 3OSNA 4YN4A 2W43A 4UB3A 5ALGA 2CPRA 4RQMA 4JV0A 3PMNA 2IMWP 2BQUA 8ICYA 2XCAA 5HP4A 1TK0A 1X9XA 3Q8SB 4B9SA 7ICNA 2PFPA 4DFKA 3ICXA 4R8UB 5J2EA 3WK9A 2P35A 2GONA 4ED1A 1QTMA 2PI4A 5EE1A 4G3IA 2QARA 3AU6A 3QEBZ 4CRXA 3GIKA 4CGZA 4JWNA 1QH9A 2AXTU 4PZNA 3PNCA 3LWLA 5ALPA 1L3UA 1J2MA 2F8KA 4KLTA 4KITB 4RQ1A 1LB2B 1F0MA 1X42A 1Q3VA 4K4HA 3MDCA 3V7LA 1NK4A 2J6TA 1A77A 4O5CA 2ZUDA 1XO1A 2GOLB 5AK6A 3HT3A 4MF8A 4HYKA 4M2YA 1ZD5A 9ICXA 2NRXA 4F4KA 3RH6A 1UCVA 2XGPA 3RJHA 4FZLA 2HDOA 1X9SA 4RQ3A 3H7IA 3IN5A 4CNQA 3QE9Y 4R65A 1BNPA 1TAUA 3CP8A 2QB1A 5DGBA 1SWVA 1DGSA 2A3VA 1SL0A 3UPQA 3BZCA 4RZRA 5J2KA 5AM5A 3QU4A 3KKAC 4YMNA 4DQSA 2K4PA 3KZIU 1NK6A 4RU9A 4NV0A 2K8BB 5KFGA 4QNLA 2MA1A 2PXIA 2WFAA 4F8RA 5KFMA 2LI6A 7ICEA 1ZQEA 3WK5A 4I27A 3K1ZA 4DS4A 3JPRA 3RH4A 4DL7A 4U0CA 4F93B 2YMQA 5CA7A 3KTQA 1D8LA 2F44A 4JB3A 4QIWC 4DL4A 3RBEA 5EWEA 5KT2A 5J2AA 4B9MA 4HTWA 4DOAA 4QJFB 4INBA 3LK9A 1KL9A 2YMMA 2KE7A 4KLGA 4YXJA 3SAGA 2HOIA 1M9YC 5C5JA 3OSPA 9ICCA 4QWEA 4KLJA 2ZJAA 3IP4B 1ZJNA 3SD7A 7ICLA 3ONNA 3AN1A 4BXOB 2E5SA 5BPCA 7ICFA 4C8NA 1ZQIA 2LM4A 1NZBA 1ZQDA 1L7PA 2WF5A 5J2IA 1L8LA 1NJWA 1SV0A 3C21A 3KHLA 4MFCA 4QNBA 2M0NA 5ALVA 1KQQA 2MUTA 2W55A 4MF2A 3MR6A 2VA3A 2KGFA 5T14A 2W04A 4JK1A 3OHAA 2W9BA 3CNHA 3KKAA 4EZ9A 3TKAA 4K4IA 2NO5A 3SYZA 1X9WA 5D4BA 4EELA 4TUQA 2JMGA 4PGXA 4P0PB 5AK4A 5ALWA 2B21A 4I2FA 3M6KA 2JEGA 2ZUBA 2EH9A 2AQ0A 1XS9D 2QB0A 5ALUA 5KFRA 2BQRA 3GV8B 1ZQTA 3JPNA 1VLBA 4YFKA 2W8KA 4UAUA 5ALMA 1FFVA 1ZQUA 2G0AA 2RDJA 1NKEA 3MFHA 1WWVA 3PVXA 5AKZA 4PHDA 2F1IA 3NRZA 4BUGA 3PW0A 3LDAA 1S77D 5F3XB 4RQNA 2G07A 2ZIXB 5JRTA 2EAMA 5KG5A 2ZIUA 1SKSA 5AICA 3F2CA 2LKYA 4Y2PA 2YY6A 5B5EU 3N7SC 1DRGA 1Z00B 4C4TA 4DEZA 1COKA 3KOOA 5AKKA 1NK0A 5KAFU 5KG6A 3VC8A 4GFJA 2JV3A 3TACB 3IRUA 3S6JA 2HBJA 5KFBA 1T4GA 3HKZC 2W54A 3NGDA 3GQCA 3AUOA 4DFDA 3RB6A 1NKBA 1SKRA 8ICLA 3H8WA 1S5LU 4F92B 4RNOA 2ALZA 3H47A 3ZD8A 4TUSA 2C2EA 4JMUA 4PHEA 4EYIB 2B0CA 1RDFA 5JUMA 1UT5A 4RQ4A 1RXVA 3SI8A 3BS5A 1ZRNA 4F4XA 3QYPA 5EOZA 4HAIA 5AM2A 9ICOA 7ICTA 3B0XA 8ICQA 4Y2SA 3CW2C 2KZZA 4C80A 1UQVA 1XSLA 3WK7A 3WK4A 3BS5B 4OJ6A 9ICUA 5KG7A 4NLBA 3EPGA 2M9NA 4U0FA 4TURA 2ZTEA 5DDYA 4NM2A 4B9UA 5J0QA 4WJ3B 4XUSA 3QUQA 5J2GA 9ICNA 3H8JA 3GU3A 2OXOA 1JIHA 4OJOA 4QZGA 4FFDA 8ICPA 2CN1A 1IG6A 5KFKA 3KZXA 3ZDEA 1ZD4A 4MFFA 4NLKA 1S9FA 3CYMA 3RB3A 3HP6A 2DFLA 1NI3A 3T5JA 2GH1A 4UBCA 3NRWA 1M9EC 4B9VA 7ICHA 4US9A 3UXPA 8ICOA 4J9SA 2EAOA 4NJ8A 1SB3C 2HBMA 4UATA 4ACOA 4FO6A 1KRPA 4DFJA 3M9MB 5KG3A 4DL6A 4WYMA 2XC9A 1C20A 2A1JB 4IRCA 5IIMA 5L1LA 3NASA 4MEYA 1ZYQA 2WF7A 1O08A 1WUDA 5J0WA 2O6KA 1ECWA 1XSNA 4G9BA 3I1YA 3RB4A 2HCFA 2F3NA 5GTIU 2I6XA 1VDVA 5ALZA 1N5XA 4C8KA 2NYVA 3FYHA 5J0OA 1J97A 2JEJA 2AQ4A 2DF4B 4LQWC 5JTIA 3A0BU 3FM9A 3QU5A 2XGVA 9ICRA 1M6YA 5TISU 4DCCA 4YG2A 2AJQA 4JUZA 4P4OA 5J0SA 5L9XA 3GILA 1SL1A 4I2AA 2K60A 2ZIWB 8ICXA 5KNIA 2FPLA 5ALOA 2HHQA 4KLSA 3TAPA 2KVCA 5ALTA 4RQ0A 2HHSA 1RXWA 5CR0A 2K8AA 3H4EA 2Y9TA 2ISPA 1N60A 2PFOA 4M9NA 4F5OA 4MEXA 4RQ6A 1KFDA 1KSPA 4I29A 1M9XC 1SKWA 2WAQF 3KHRA 3PSIA 2RHFA 3DV9A 1ZQZA 2EQYA 2QARB 3KD3A 3N7RC 5AKXA 3ZI4A 2I9GA 3C23A 1BPBA 4I2BA 3V7JA 4FS1A 3HKZF 2XGQA 2HVHA 4RUAA 3MFIA 3GIIA 1ZQBA 2ZG6A 4Q43A 5KFHA 4NXZA 3Q8KA 5FP0A 3PSPA 4YD2A 4F5NA 2NO4A 5KFCA 4ED7A 4OD0A 2PXRC 2EIAA 4I2DA 4O3QA 5ALNA 2DPIA 4IL6U 5J2BA 3DEEA 1NJZA 1H38A 1URJA 2G08A 3C2LA 2EZXA 4F2SA 3OGUA 2QB0B 2ASJA 1D9FA 2Y1IA 5KL8B 4RNMA 3UQ0A 4R66A 1IIPA 4EZ6A 1HJPA 4DFPA 1HUZA 3RJFA 2F77X 1Y88A 4RPZA 2R8JA 4XROA 9ICTA 5B66U 2V4XA 1K1SA 2J6UA 3WKAA 2XY7A 4J9RA 5D49A 4GIBA 4JV2A 4IQWA 3SAHA 1U4BA 5KAIU 1Z00A 4J9OA 2M8PA 2BPCA 2EAPA 3C5FA 4I2HA 3JPQA 5DG7A 2VA2A 2JZBB 1ZQJA 5KG2A 3E58A 4P4PA 5ALHA 3NVVA 1C7YA 3PX4A 7ICVA 2IBKA 9ICBA 2KICA 4J9NA 1BPEA 3BQ1A 4DGEC 2JH1A 3PMLA 5BOLA 2HBLA 2ZTCA 1V97A 2HI0A 4KLIA 3EYZA 3C29A 2BHNA 1LVHA 2KP7A 4ED2A 7ICJA 5CEHA 1ZQOA 9ICAA 2FPMA 3WKBA 2P6RA 3Q8PB 1ZQQA 1X2IA 1L8OA 4PPXA 5K4LA 1WG8A 1U7KA 9ICGA 5ALQA 4U0EA 4FE3A 1ZRMA 4QWAA 4QZBA 2LYAA 4KLOA 4R8UA 5AI4A 8ICWA 4O3MA 1XC9A 2FMQA 5J0RA 4B9NA 2ZJ5A 1QSLA 4Z6CA 2ISOA 1N2XA 1L3VA 2KFNA 1ZQYA 2KHVA 3SENA 2A19A 1L3TA 1SXDA 2AGOA 5DQGA 2H3VA 4Y2RA 3RJKA 1TK5A 3T5LA 4I28A 3ISCA 4UB6U 4LJXA 4J93A 2WB1F 1V9PA 2FMSA 4M9LA 9ICJA 3OJUA 3ZD9A 4BJQA 2W8LA 3IG5A 3PR5B 1JXLA 4P4MA 5AM3A 3RRGA 2YN4A 1P7DA 3PY8A 2GO7A 3BZKA 3K4GA 4DOCA 3B0YA 4KLEA 3ZDBA 3PV8A 4B6JA 1N48A 9ICHA 1MSWD 4FBUA 3HJEA 4DSKA 3V6KA 5KFJA 2BQ3A 2YB1A 3QXGA 3UXNA 1Z19A 1LKYA 1UA0A 1QLNA 2PMZC 5J0TA 5AKJA 4FS2A 3GIMA 1KKXA 3NVYA 5ALEA 4QZAA 3EPIA 4F5QA 1WCLA 1CRXA 5J2DA 1ZD3A 4QWBA 5KT6A 4UBBA 3RJIA 3G6XA 2RDIA 3K75D 5JU5A 5AKHA 5HR7A 1XO0A 3TAQA 2C22A 4I2JA 2IHNA 1IXRA 2ES6A 1ZQKA 2A1JA 2KK0A 4KLFA 1LV5A 2Q4TA 4KLMA 8ICNA 4RPYA 7ICSA 1PZNA 2E8NA 4PH2A 5KFWA 3ISBA 5AIBA 4DWIA 4IQTA 1ZD2P 1KTQA 1QQ7A 1X66A 1S0NA 2FMPA 3OTQA 2KFZA 3RTVA 1SWWA 4RQ5A 3JPTA 7ICOA 4ECUA 3FC4A 1MQ2A 5KFPA 4ECWA 1DK3A 4UB1A 2KV2A 1WYGA 3KBBA 4M6WA 4ECQA 2F8LA 5J0PA 8ICZA 1Z4OA 3RFAA 2X2DD 1S0OA 1GWPA 3QU2A 2G5IB 2KZ3A 5DBBA 5IILA 3M1YA 3JPPA 4ELUA 4Y2VA 1ZQLA 2ZXIA 4Q44A 3OHBA 2PFNA 1XWLA 3C2KA 7ICMA 4F71A 3F5EA 4QWCA 2LBOA 4QZCA 2IHMA 3AL0B 4CF5A 5HMLA 5IIOA 4UAVA 4PGYA 5F9NA 1FFUA 4Z6EA 3UXOA 4YMMA 3BQ7A 4EBCA 4P0PA 5KL1B 3N97B 5AI9A 3HPOA 1OXJA 2P66A 1F5SA 5KFIA 4PL1A 1L7NA 2MUTB 4NX4C 4E92A 4YR3A 4EBDA 2XVTA 3ZDDA 5G5GA 1EIAA 3LWMA 1NK5A 1WWUA 5DGAA 5ALKA 4ECRA 1D8BA 5J0UA 3Q8QB 3G6YA 1B4FA 2DL0A 3SQIA 1V85A 3ALRA 2F1JA 4BGDA 5CWRA 3T5KA 5KFXA 8ICHA 1RYUA 4PZOA 4Z6FA 5IIIA 5KFLA 1CEZA 7ICIA 3MGEA 1K5OA 2PMZF 2HHTA 3N7PD 1ZOLA 1X9MA 4RQ8A 4EBEA 3B9JA 4US8A 2R8GA 1MC8A 5KG0A 3UM9A 2OH2A 1PVRA 3TI0A 1SZPA 2M8NA 3UMCA 4DQPA 2LHTA 3ZDAA 2ATLA 2HSZA 5DLGA 5KG4A 4FBTA 4AYBF 2KOBA 4AP9A 4F50A 3AEVA 3AU2A 3J81j 2ZXHA 4YD1A 4F4YA 2XGYA 1FO4A 4DFMA 4KN4A 2FPKA 3C5GA 2JR5A 4UARA 2KKVA 2RQ5A 4Y2XA 2KSOA 4QIWF 4Y2YA 1RM6C 2MRLA 1ZQMA 1KEJA 2PKEA 2WTFA 2AGQA 1DXSA 9ICWA 1LKYB 5AKIA 3BS7A 3ETLA 5AKEA 1KW4A 3Q8MA 3NUQA 3RJGA 1U45A 3H0MB 2VA8A 4MHVA 2XI9A 1BPYA 3ORYA 4YCXA 4R63A 5DDMA 2FI1A 4M9GA 3Q8LA 2I5HA 4KMUA 1MA7A 4C8OA 3SZ2A 8ICBA 2YQEA 4DL3A 4JWMA 4J9PA 3M8RA 4XFXA 1ED1A 3M7DA 4QZ8A 3M9OB 4YR2A 5F9LA 1WCNA 3WKDA 1TKDA 2KSOB 1BPZA 4DS5A 2NRWA 1TV9A 5A0LA 2BCSA 3D2QA 7ICKA 8ICEA 4FZMA 4IRDA 8ICIA 2PWMA 2R8KA 3UQ2A 4NL9A 2JEIA 5HHIA 2C2RA 1Z3EB 9ICQA 9ICMA 2KIVA 3H0LB 2CRXA 2BGWA 2DGZA 4DSEA 4M9JA 3AQEA 1JX4A 2W9MA 4OJPA 1T7PA 5ALLA 4ZH4A
chains in the Genus database with same CATH topology
3DEEA 3LYSA 2HOQA 2A3VA 1PVQA 2WB1C 1M9CC 2ZIVA 1URJA 2G08A 4KMOB 2F76X 5HGKA 5KL8B 4NV0A 2K8BB 4QNLA 2MA1A 1IIPA 1HIWA 3LVVA 3M6ZA 3K1ZA 2F77X 4U0CA 4XRQA 2G06A 4XROA 2WAQC 2V4XA 4QIWC 1AK4C 4HTWA 4QJFB 2F2AB 3SAHA 4INBA 1G03A 4XFZA 2X83A 4AYBC 3SAGA 2M8PA 2HOIA 1M9YC 5HGLA 2VIXA 2H3IA 2KD1A 3IP4B 3SAFA 1XNSA 3ONNA 4C0ZA 1ZQ1C 2E5SA 4PL2A 3CRXA 2KICA 2W7PA 3PSTA 1NZBA 2G09A 4DGEC 2JH1A 2HBLA 2ZIUB 4PH0A 3T79A 3C29A 3MGVA 4P0QA 4QNBA 2M0NA 1T94A 4U7CA 2KGFA 5T14A 2W04A 2H3ZA 1U7KA 1A0PA 4U0EA 1EM9A 4FE3A 2LYAA 1YT3A 4DGAC 4P0PB 2K8CB 2JMGA 4O3MA 2KEYA 3L3FX 3M6KA 4BX9C 2KHVA 1L6NA 2H3VA 2LYBA 2G0AA 4XFYA 2D6FC 4J93A 2WB1F 1TAMA 4BJQA 3NTEA 3IG5A 1HEKA 2KJ5A 2WLVA 2E1FA 3F2DA 1P7DA 4BUGA 2G07A 5HR6A 2ZIXB 2ZIUA 2H3QA 2HOFA 3F2CA 2YB1A 2LKYA 1DRGA 1Z19A 3N7SC 2M8LA 3O0FA 1A6SA 2PMZC 2BDUA 1M9FC 2XICA 3LVWA 4U0AA 2KJ8A 1CRXA 2KKPA 3RF9A 3VC8A 1E6JP 2OM6A 2E1EA 4GFJA 2ZIVB 2HBJA 3HKZC 4OJLA 5HR7A 2VJ5A 1XO0A 5HGOA 2Q4TA 2N1RA 5HGMA 3H47A 4PH2A 4JMUA 2KIWA 5C0YA 4OO1J 3IG8A 2Y0SC 2R18A 3D2NA 2OYYA 2KV2A 3F2BA 2F8LA 4OJ6A 3RFAA 2X2DD 2X82A 2RP5A 1GWPA 4NLBA 2NV3A 5HGNA 2G5IB 4U0FA 2VKQA 2ZXIA 2Z7JA 4U6PA 1UPHA 3KFUF 4FZNA 4CDGA 3F5EA 3C28A 2GOLA 2YB4A 2LBOA 3AL0B 4WJ3B 2H3FA 4E91A 3GU3A 4P0PA 5KL1B 2OXOA 4NWIA 4P0QB 4IC9A 2VJ4A 4OJOA 2G5HB 1GO3F 3F53A 4PL1A 2CN1A 4NX4C 3KZXA 4E92A 3F5AA 2XVTA 3CYMA 2K4HA 3GZFA 1EIAA 3AQFA 5CRXA 1P7NA 1D8BA 1KBUA 4A8EA 2GH1A 2RRDA 3NRWA 1M9EC 3SQIA 2JGAA 4NLCA 3ALRA 2HBMA 4ACOA 3MGEA 2W03A 2KHQA 1AFVA 2PMZF 3N7PD 2K4IA 2KJ9A 4KX3A 1QRJA 4U0DA 4PH3A 4WYMA 2ZIXA 2OH2A 3E0FA 1PVRA 5JPAA 2M8NA 2LHTA 2YX8A 1WUDA 4AYBF 1ECWA 2K89A 2JHDA 3PSFA 1OUQA 2KOBA 4ICAA 2ZXHA 3P05A 2JH7A 2XGYA 1D1DA 2DF4B 4LQWC 2K4EA 2KKVA 3SMVA 4B4NA 2XGVA 3VCBA 4QIWF 2Y0SF 3PZPA 3BP9A 2MRLA 3H0RB 2W7OA 2XDEA 3OPXA 1M9DC 2ZIWB 2CPRA 3NUQA 3H0MB 1SZHA 4U0BA 2KVCA 2HMXA 2XI9A 3ICXA 2K8AA 2LF4A 3H4EA 2ZIWA 2GONA 2PWOA 2Y4ZA 1MA7A 2JPRA 4CRXA 4CGZA 4KX5A 4XFXA 1M9XC 2WAQF 1ED1A 3PSIA 2RHFA 3M7DA 2XGUA 3N7RC 1Q3VA 3HKZF 2WLVB 3D2SA 2ZG6A 2GOLB 5A0LA 2DQNB 1Z1BA 3D2QA 3PSPA 4FZMA 2PWMA 1PVPA 4FZLA 1F44A 2HBKA 2XIDA 2PXRC 3H0LB 2EIAA 2CRXA 2KNJA 2DGZA 1Q3UA 3IN5A 3AQEA 4OJ5A 3CP8A 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGY A;  1D1D A;  1M9C C;  4LQW C;  2K4E A;  4B4N A;  2XGV A;  2X2D D;  2X82 A;  5HGK A;  1GWP A;  1L6N A;  2NV3 A;  5HGN A;  3BP9 A;  4U0F A;  1HIW A;  2H3V A;  2XDE A;  2LYB A;  4XFY A;  1M9D C;  1UPH A;  4J93 A;  1TAM A;  2GOL A;  4U0C A;  4XRQ A;  3NTE A;  4U0B A;  1HEK A;  2WLV A;  2H3F A;  4XRO A;  2V4X A;  4E91 A;  2HMX A;  1AK4 C;  2LF4 A;  3H4E A;  2GON A;  4HTW A;  2PWO A;  4IC9 A;  2Y4Z A;  4INB A;  2JPR A;  1G03 A;  4XFZ A;  2X83 A;  2H3Q A;  4NX4 C;  2M8P A;  4E92 A;  1M9Y C;  4XFX A;  1M9X C;  5HGL A;  2M8L A;  1A6S A;  1ED1 A;  2K4H A;  1EIA A;  2XGU A;  1P7N A;  2H3I A;  1M9F C;  4U0A A;  1M9E C;  1E6J P;  4DGE C;  2WLV B;  4PH0 A;  3MGE A;  2GOL B;  1AFV A;  4QNB A;  5HGO A;  2K4I A;  1QRJ A;  4U0D A;  4PH3 A;  4WYM A;  2PWM A;  5JPA A;  2M8N A;  2N1R A;  2KGF A;  3H47 A;  5HGM A;  4PH2 A;  2H3Z A;  4JMU A;  1U7K A;  2PXR C;  2EIA A;  1ECW A;  4U0E A;  1EM9 A;  4ICA A;  3P05 A;  2LYA A;  4DGA C;  2JMG A; 
#chains in the Genus database with same CATH topology
 1TK8 A;  3H8S A;  1PVQ A;  1M9C C;  4M0A A;  2UVV A;  4KMO B;  1CI4 A;  5HGK A;  5EWF A;  3QNM A;  5DQI A;  4E0D A;  1T3Q A;  1SL2 A;  3BQT A;  5DQH A;  4YP3 A;  1HIW A;  4O9M A;  9ICP A;  5KFV A;  3M6Z A;  2P6U A;  2HVI A;  5KFD A;  3H4B A;  5L1J A;  4ECV A;  4RQ2 A;  4XRQ A;  2G06 A;  1SV0 C;  3H8M A;  2WAQ C;  3WK8 A;  2JRZ A;  2IA6 A;  1S8O A;  5AIA A;  1S0M A;  1PK1 B;  2E8O A;  2W3R A;  4XFZ A;  5CHG A;  3NVW A;  5AKG A;  1JN3 A;  4KLD A;  3H4D A;  3IV6 A;  4F2R A;  5KFN A;  2VIX A;  2KD1 A;  2H3I A;  3I28 A;  3SAF A;  2DBY A;  3RRH A;  4C0Z A;  1ZQ1 C;  3SV4 A;  3MR3 A;  3HWT A;  3CRX A;  4IR1 A;  4CCH A;  2OWO A;  3C2M A;  3PST A;  3RB0 A;  2G09 A;  2VAN A;  5KG1 A;  5AI6 A;  5AI0 A;  1ZQC A;  2KZM A;  9ICK A;  5AM4 A;  4PH0 A;  4DF8 A;  4Q8F A;  3T79 A;  5L1K A;  2W9C B;  1MQ3 A;  2W9B B;  4P0Q A;  2C28 A;  2V9W A;  2QLT A;  8ICR A;  1T94 A;  1B43 A;  3WKC A;  4U7C A;  5CB1 A;  1BGX T;  3PX6 A;  3D6J A;  2DPJ A;  2W9C A;  3C1Y A;  3NTU A;  4Z6D A;  2FLP A;  3A0H U;  4J9Q A;  1DK2 A;  4DGA C;  5KFT A;  1BPD A;  3TAN A;  2KEY A;  5J0Y A;  1JRO A;  3MR5 A;  2OHF A;  2OEH A;  3V72 A;  5KFY A;  1SXE A;  1B0X A;  1JXE A;  1PUZ A;  3GV7 B;  2H5X A;  4NL9 C;  1L6N A;  2XO7 A;  5D46 A;  4F5R A;  5EWG A;  2FDR A;  3HX0 A;  1NOM A;  2BCR A;  4Y2T A;  2YMP A;  2D6F C;  1TAM A;  4C7Z A;  4EEK A;  1QSS A;  4YR0 A;  2ASL A;  3GDX A;  5KT5 A;  5DB7 A;  4IS7 A;  7ICR A;  5DBA A;  3T5H A;  3MAB A;  4YQW A;  3TFR A;  1U47 A;  7ICG A;  1UA1 A;  2E1F A;  1O03 A;  3F2D A;  4P2H A;  4NLZ A;  4ECT A;  5ALY A;  1HUO A;  4CF4 A;  2J6S A;  1FEZ A;  3V7K A;  4NLN A;  1ZET A;  2HOF A;  5J2C A;  4UAY A;  4ECS A;  1A6S A;  2ZUC A;  2BCV A;  2BDU A;  1IM4 A;  4YVZ A;  2XIC A;  4U0A A;  1K1Q A;  2B6G A;  5EE0 A;  1Q46 A;  4IQU A;  4J03 A;  5CP2 A;  1E6J P;  2OM6 A;  3GIJ A;  9ICE A;  3MBY A;  2OCE A;  5DB9 A;  5ALF A;  8ICM A;  3GFK B;  2D8C A;  4J9M A;  4F4Z A;  2XCP A;  2NRV A;  5AKY A;  1QSY A;  1KLN A;  8ICT A;  3JPS A;  2FE9 A;  4PHP A;  1NKC A;  3SV3 A;  1ZQX A;  4ELT A;  4CF3 A;  5C0Y A;  1X6I A;  3IG8 A;  4GLX A;  4O3S A;  1SIJ A;  4PH5 A;  7ICU A;  8ICG A;  2LMR A;  4C8M A;  1Q8K A;  3M8S A;  3D2N A;  4Y2Q A;  5ALI A;  2OYY A;  3EZ5 A;  5J0X A;  1ZXI A;  3F2B A;  5GTH U;  4UW9 A;  1N61 A;  5EE3 A;  4Y2J A;  2R8I A;  2RP5 A;  3H40 A;  4ECX A;  1ARO P;  5HGN A;  1SV4 A;  4QZI A;  1X6J A;  1S10 A;  3KHG A;  3UMG A;  1T3N A;  2VKQ A;  4UB8 U;  5G5H A;  1ZJM A;  3QUB A;  2Z7J A;  4BWM A;  4QW8 A;  4U6P A;  1UPH A;  4FZN A;  1MN8 A;  2KG5 A;  4CDG A;  4GXI A;  2YB4 A;  2LPE A;  2E3T A;  3THV A;  5ALS A;  2BDP A;  2AGP A;  4ECY A;  4NWI A;  4P0Q B;  4IC9 A;  3TFS A;  2VJ4 A;  3TAD C;  2G5H B;  2UVW A;  1D8Y A;  4DO9 A;  3F53 A;  2BZF A;  1L5U A;  5AK5 A;  1ZQP A;  3PO5 A;  3F5A A;  3HRD D;  3PX0 A;  1RZT A;  2W3S A;  5AM1 A;  2R8H A;  3DDH A;  3AQF A;  4M6W B;  3WU2 U;  1L3S A;  1B22 A;  4YMO A;  2ZTD A;  1ZQG A;  3NVZ A;  2JGA A;  4NLC A;  5KT7 A;  5AM0 A;  2CXY A;  2Q0Z X;  2FLL A;  2W03 A;  1AFV A;  5EE9 A;  3AMZ A;  1NJY A;  2KJ9 A;  3MDA A;  4KX3 A;  1QRJ A;  3E2E A;  1D9D A;  1RYS A;  4U0D A;  2GLE A;  2ZIX A;  3E0F A;  3PW7 A;  1DGJ A;  4GC7 A;  5DB6 A;  5ALJ A;  2YX8 A;  3ED5 A;  1AQ6 A;  4KN7 A;  2K89 A;  5J2F A;  3MC1 A;  3PSF A;  4ECZ A;  4ICA A;  3BQ0 A;  1KN5 A;  1CUK A;  4DSI A;  4RQ7 A;  2NRZ A;  3C1Z A;  3PW4 A;  5KTQ A;  3RAQ A;  1N56 A;  4UB5 A;  2FLN A;  2BPF A;  3BDP A;  1D1D A;  4UAW A;  3ETR A;  3SMV A;  8ICF A;  2BPG A;  4J9K A;  4CE6 A;  4KLU A;  3QEA Z;  5KFF A;  5DKW A;  3RH5 A;  3PZP A;  2BCQ A;  3BP9 A;  3ZDC A;  3IM1 A;  2W7O A;  2XDE A;  4XA5 A;  1N5W A;  1UT8 A;  4GXJ A;  1M9D C;  5J2H A;  3RR8 A;  5CJ7 A;  4ED0 A;  3RJE A;  1SZH A;  4U0B A;  5KFS A;  4XRH A;  2HW3 A;  1PK1 A;  2HMX A;  2LF4 A;  2ZIW A;  2MAX A;  8ICA A;  2PWO A;  4DQI A;  5AHX A;  9ICL A;  2Y4Z A;  7ICQ A;  2V4R A;  1RQL A;  2JPR A;  4DL5 A;  3AM9 A;  3QU9 A;  2EZY A;  3Q8R B;  3MGH A;  2W9A A;  4KX5 A;  2AH5 A;  1UHU A;  2Y9U A;  2XY5 A;  2HHV A;  4IR9 A;  2XGU A;  4Q8E A;  5IIK A;  3JPO A;  2DWQ A;  3PR4 A;  2L5Y A;  4DSL A;  4RT3 A;  3WK6 A;  2MU2 A;  2ODG A;  3M9N B;  2WLV B;  1DOQ A;  5KT3 A;  4DF4 A;  3HIL A;  3D2S A;  1TVA A;  5ALR A;  4DSJ A;  5TZV A;  2DQN B;  1Z1B A;  1SGG A;  2I1Q A;  1N63 A;  1VJ5 A;  3BJY A;  5L1I A;  9ICV A;  1PVP A;  1IV8 A;  1F44 A;  1COO A;  4QZF A;  1RQN A;  2HBK A;  2XID A;  1BPX A;  5HNK A;  5IIJ A;  2KNJ A;  1Q3U A;  1RPL A;  4KLH A;  4PGQ A;  4OJ5 A;  3NS1 A;  1A76 A;  3LYS A;  2HOQ A;  3EW9 A;  3QUT A;  4TQS A;  2WB1 C;  2ZIV A;  5IIN A;  2AU0 A;  1JMS A;  5KFQ A;  2F76 X;  3V6H A;  3MR2 A;  5L1M A;  2EDU A;  4GC6 A;  3QZ8 A;  5AKL A;  3LVV A;  3U26 A;  2ASD A;  9ICS A;  1QCK A;  2HHX A;  3K1R B;  4F3O A;  4M9H A;  2UVU A;  1XU4 A;  3KHH A;  4ELV A;  4DLE A;  1JUD A;  1ZQN A;  1AK4 C;  3HW8 A;  2F2A B;  1G03 A;  3RBD A;  4K4G A;  2X83 A;  2WHE A;  4I2G A;  1JI7 A;  2WF8 A;  4AYB C;  5DG8 A;  2DKZ A;  3G6V A;  5HGL A;  2IOF K;  2PFQ A;  1TAQ A;  4USA A;  4DQQ A;  5ALD A;  5J29 A;  2KVS A;  2E8P A;  4I2C A;  1ZQW A;  5H2F U;  4RUC A;  1XNS A;  4PL2 A;  4DL2 A;  4NY8 A;  2W7P A;  2QKQ A;  2ZIU B;  1KFS A;  2KN7 A;  4BWJ A;  3MGV A;  3FDS A;  1RG6 A;  2ZJ8 A;  4UAZ A;  1NZP A;  3RAX A;  5DB8 A;  1U9L A;  1L7O A;  2IOF A;  3N28 A;  4O3N A;  8ICC A;  1BVS A;  2H3Z A;  5KFO A;  8ICJ A;  4RNN A;  1A0P A;  4UB4 A;  1EM9 A;  8ICS A;  1U49 A;  4O3O A;  4Y2U A;  4F5P A;  2NRT A;  5AI5 A;  1YT3 A;  2K8C B;  3MGI A;  2BR0 A;  2KMD A;  3L5K A;  1ZQA A;  4YXM A;  4O3P A;  3L3F X;  1JAL A;  2HHU A;  1Z4N A;  4QZE A;  4BX9 C;  2F1H A;  4O5K A;  4O3R A;  2LYB A;  4PHA A;  2PI5 A;  4XFY A;  4EEN A;  4QZH A;  5DLF A;  3TQ1 A;  4F91 B;  5KT4 A;  3NTE A;  1HEK A;  3QUC A;  2KJ5 A;  2WLV A;  4UAS A;  3QX7 A;  1YZ6 A;  4UQG A;  2V4Q A;  4LZG A;  2C2D A;  2BKE A;  4BXO A;  5HR6 A;  4NLG A;  2H3Q A;  2WF9 A;  4C8L A;  2YML A;  2M8L A;  3O0F A;  4DQR A;  4X5V A;  4O5E A;  4BDP A;  3BQ2 A;  1QQ6 A;  1S76 D;  8ICV A;  1M9F C;  4JV1 A;  4TQR A;  1BNO A;  1EXN A;  3LVW A;  4PJ0 U;  2KJ8 A;  4XQ8 A;  1S97 A;  4F72 A;  4GXK A;  2KKP A;  3RF9 A;  4B9T A;  2E1E A;  1T8E A;  5J2J A;  2MSN A;  4EX6 A;  2ZIV B;  4OJL A;  2Y1J A;  1S0V A;  2VJ5 A;  5HGO A;  2YTU A;  3PW5 A;  4C4R A;  4I2I A;  2D3D A;  4UB2 A;  4TUP A;  3SR6 A;  2XY6 A;  1NK8 A;  4DSF A;  4KLL A;  4EX7 A;  1X40 A;  2N1R A;  5HGM A;  4Q45 A;  4C4S A;  2KIW A;  2JZB A;  4QZD A;  4M04 A;  2A1A A;  4OO1 J;  2AHO B;  2Y0S C;  4QW9 A;  3GV5 B;  2KTQ A;  2R18 A;  4J9L A;  8ICK A;  4LVS A;  4NM1 A;  4ED6 A;  1RYR A;  4ED8 A;  3OJS A;  4MFA A;  5BOM A;  4F4W A;  2X82 A;  4ED3 A;  4R64 A;  1J2N A;  2NV3 A;  2HHW A;  3TAR A;  2ESE A;  3I76 A;  3SEI A;  2UVR A;  5HHH A;  4RPX A;  5J8Y C;  1NK9 A;  1PK3 A;  3EWA A;  3KFU F;  1NJX A;  1V38 A;  4RT2 A;  1KFT A;  5KFA A;  2RLT A;  5AK3 A;  3EUB 2;  3C28 A;  2LYH A;  2GOL A;  4IQV A;  5KFU A;  2E8M A;  4KLQ A;  1Z1V A;  2H3F A;  1ZQF A;  3V6J A;  3IHQ B;  4E91 A;  1TFR A;  1QQ5 A;  4EEY A;  8ICU A;  4DOB A;  5J8Y A;  1GO3 F;  2GWS A;  3QU7 A;  3L4P A;  5DBC A;  2W11 A;  2WF6 A;  5AI8 A;  4EYH B;  1N62 A;  1XSP A;  3PW2 A;  9ICF A;  2FJ6 A;  1ZQH A;  2K4H A;  3GZF A;  5CRX A;  1P7N A;  4QWD A;  1KBU A;  2JXJ A;  4IRK A;  4A8E A;  5KFZ A;  2RRD A;  4LZD A;  2DUY A;  2DKX A;  3QZ7 A;  3RJJ A;  2LM1 A;  3RR7 A;  4M47 A;  2KHQ A;  4OCZ A;  1ZQR A;  1FIQ A;  7ICP A;  1YZ7 A;  4I2E A;  2K4I A;  9ICI A;  3WKE A;  5ALX A;  3TAD A;  4PH3 A;  3R9K A;  1NNL A;  4ZOH C;  5JPA A;  3T3F A;  1OW5 A;  3ISD A;  5HMM A;  3IDW A;  5KFE A;  1L7M A;  2JHD A;  1U48 A;  1OUQ A;  1ZQS A;  5DG9 A;  1TE2 A;  2IOH A;  3P05 A;  2JEF A;  3N4M B;  2JH7 A;  5E79 U;  4C7Y A;  2K4E A;  4B4N A;  4DLG A;  2BCU A;  1JRP A;  3VCB A;  2EAN A;  4QZ9 A;  2Y0S F;  4KTQ A;  3H0R B;  3UMB A;  1ZQV A;  1NK7 A;  4B9L A;  3PO4 A;  4O0I A;  3OPX A;  1KDH A;  2EZZ A;  3FAH A;  3OSN A;  4YN4 A;  2W43 A;  4UB3 A;  5ALG A;  2CPR A;  4RQM A;  4JV0 A;  3PMN A;  2IMW P;  2BQU A;  8ICY A;  2XCA A;  5HP4 A;  1TK0 A;  1X9X A;  3Q8S B;  4B9S A;  7ICN A;  2PFP A;  4DFK A;  3ICX A;  4R8U B;  5J2E A;  3WK9 A;  2P35 A;  2GON A;  4ED1 A;  1QTM A;  2PI4 A;  5EE1 A;  4G3I A;  2QAR A;  3AU6 A;  3QEB Z;  4CRX A;  3GIK A;  4CGZ A;  4JWN A;  1QH9 A;  2AXT U;  4PZN A;  3PNC A;  3LWL A;  5ALP A;  1L3U A;  1J2M A;  2F8K A;  4KLT A;  4KIT B;  4RQ1 A;  1LB2 B;  1F0M A;  1X42 A;  1Q3V A;  4K4H A;  3MDC A;  3V7L A;  1NK4 A;  2J6T A;  1A77 A;  4O5C A;  2ZUD A;  1XO1 A;  2GOL B;  5AK6 A;  3HT3 A;  4MF8 A;  4HYK A;  4M2Y A;  1ZD5 A;  9ICX A;  2NRX A;  4F4K A;  3RH6 A;  1UCV A;  2XGP A;  3RJH A;  4FZL A;  2HDO A;  1X9S A;  4RQ3 A;  3H7I A;  3IN5 A;  4CNQ A;  3QE9 Y;  4R65 A;  1BNP A;  1TAU A;  3CP8 A;  2QB1 A;  5DGB A;  1SWV A;  1DGS A;  2A3V A;  1SL0 A;  3UPQ A;  3BZC A;  4RZR A;  5J2K A;  5AM5 A;  3QU4 A;  3KKA C;  4YMN A;  4DQS A;  2K4P A;  3KZI U;  1NK6 A;  4RU9 A;  4NV0 A;  2K8B B;  5KFG A;  4QNL A;  2MA1 A;  2PXI A;  2WFA A;  4F8R A;  5KFM A;  2LI6 A;  7ICE A;  1ZQE A;  3WK5 A;  4I27 A;  3K1Z A;  4DS4 A;  3JPR A;  3RH4 A;  4DL7 A;  4U0C A;  4F93 B;  2YMQ A;  5CA7 A;  3KTQ A;  1D8L A;  2F44 A;  4JB3 A;  4QIW C;  4DL4 A;  3RBE A;  5EWE A;  5KT2 A;  5J2A A;  4B9M A;  4HTW A;  4DOA A;  4QJF B;  4INB A;  3LK9 A;  1KL9 A;  2YMM A;  2KE7 A;  4KLG A;  4YXJ A;  3SAG A;  2HOI A;  1M9Y C;  5C5J A;  3OSP A;  9ICC A;  4QWE A;  4KLJ A;  2ZJA A;  3IP4 B;  1ZJN A;  3SD7 A;  7ICL A;  3ONN A;  3AN1 A;  4BXO B;  2E5S A;  5BPC A;  7ICF A;  4C8N A;  1ZQI A;  2LM4 A;  1NZB A;  1ZQD A;  1L7P A;  2WF5 A;  5J2I A;  1L8L A;  1NJW A;  1SV0 A;  3C21 A;  3KHL A;  4MFC A;  4QNB A;  2M0N A;  5ALV A;  1KQQ A;  2MUT A;  2W55 A;  4MF2 A;  3MR6 A;  2VA3 A;  2KGF A;  5T14 A;  2W04 A;  4JK1 A;  3OHA A;  2W9B A;  3CNH A;  3KKA A;  4EZ9 A;  3TKA A;  4K4I A;  2NO5 A;  3SYZ A;  1X9W A;  5D4B A;  4EEL A;  4TUQ A;  2JMG A;  4PGX A;  4P0P B;  5AK4 A;  5ALW A;  2B21 A;  4I2F A;  3M6K A;  2JEG A;  2ZUB A;  2EH9 A;  2AQ0 A;  1XS9 D;  2QB0 A;  5ALU A;  5KFR A;  2BQR A;  3GV8 B;  1ZQT A;  3JPN A;  1VLB A;  4YFK A;  2W8K A;  4UAU A;  5ALM A;  1FFV A;  1ZQU A;  2G0A A;  2RDJ A;  1NKE A;  3MFH A;  1WWV A;  3PVX A;  5AKZ A;  4PHD A;  2F1I A;  3NRZ A;  4BUG A;  3PW0 A;  3LDA A;  1S77 D;  5F3X B;  4RQN A;  2G07 A;  2ZIX B;  5JRT A;  2EAM A;  5KG5 A;  2ZIU A;  1SKS A;  5AIC A;  3F2C A;  2LKY A;  4Y2P A;  2YY6 A;  5B5E U;  3N7S C;  1DRG A;  1Z00 B;  4C4T A;  4DEZ A;  1COK A;  3KOO A;  5AKK A;  1NK0 A;  5KAF U;  5KG6 A;  3VC8 A;  4GFJ A;  2JV3 A;  3TAC B;  3IRU A;  3S6J A;  2HBJ A;  5KFB A;  1T4G A;  3HKZ C;  2W54 A;  3NGD A;  3GQC A;  3AUO A;  4DFD A;  3RB6 A;  1NKB A;  1SKR A;  8ICL A;  3H8W A;  1S5L U;  4F92 B;  4RNO A;  2ALZ A;  3H47 A;  3ZD8 A;  4TUS A;  2C2E A;  4JMU A;  4PHE A;  4EYI B;  2B0C A;  1RDF A;  5JUM A;  1UT5 A;  4RQ4 A;  1RXV A;  3SI8 A;  3BS5 A;  1ZRN A;  4F4X A;  3QYP A;  5EOZ A;  4HAI A;  5AM2 A;  9ICO A;  7ICT A;  3B0X A;  8ICQ A;  4Y2S A;  3CW2 C;  2KZZ A;  4C80 A;  1UQV A;  1XSL A;  3WK7 A;  3WK4 A;  3BS5 B;  4OJ6 A;  9ICU A;  5KG7 A;  4NLB A;  3EPG A;  2M9N A;  4U0F A;  4TUR A;  2ZTE A;  5DDY A;  4NM2 A;  4B9U A;  5J0Q A;  4WJ3 B;  4XUS A;  3QUQ A;  5J2G A;  9ICN A;  3H8J A;  3GU3 A;  2OXO A;  1JIH A;  4OJO A;  4QZG A;  4FFD A;  8ICP A;  2CN1 A;  1IG6 A;  5KFK A;  3KZX A;  3ZDE A;  1ZD4 A;  4MFF A;  4NLK A;  1S9F A;  3CYM A;  3RB3 A;  3HP6 A;  2DFL A;  1NI3 A;  3T5J A;  2GH1 A;  4UBC A;  3NRW A;  1M9E C;  4B9V A;  7ICH A;  4US9 A;  3UXP A;  8ICO A;  4J9S A;  2EAO A;  4NJ8 A;  1SB3 C;  2HBM A;  4UAT A;  4ACO A;  4FO6 A;  1KRP A;  4DFJ A;  3M9M B;  5KG3 A;  4DL6 A;  4WYM A;  2XC9 A;  1C20 A;  2A1J B;  4IRC A;  5IIM A;  5L1L A;  3NAS A;  4MEY A;  1ZYQ A;  2WF7 A;  1O08 A;  1WUD A;  5J0W A;  2O6K A;  1ECW A;  1XSN A;  4G9B A;  3I1Y A;  3RB4 A;  2HCF A;  2F3N A;  5GTI U;  2I6X A;  1VDV A;  5ALZ A;  1N5X A;  4C8K A;  2NYV A;  3FYH A;  5J0O A;  1J97 A;  2JEJ A;  2AQ4 A;  2DF4 B;  4LQW C;  5JTI A;  3A0B U;  3FM9 A;  3QU5 A;  2XGV A;  9ICR A;  1M6Y A;  5TIS U;  4DCC A;  4YG2 A;  2AJQ A;  4JUZ A;  4P4O A;  5J0S A;  5L9X A;  3GIL A;  1SL1 A;  4I2A A;  2K60 A;  2ZIW B;  8ICX A;  5KNI A;  2FPL A;  5ALO A;  2HHQ A;  4KLS A;  3TAP A;  2KVC A;  5ALT A;  4RQ0 A;  2HHS A;  1RXW A;  5CR0 A;  2K8A A;  3H4E A;  2Y9T A;  2ISP A;  1N60 A;  2PFO A;  4M9N A;  4F5O A;  4MEX A;  4RQ6 A;  1KFD A;  1KSP A;  4I29 A;  1M9X C;  1SKW A;  2WAQ F;  3KHR A;  3PSI A;  2RHF A;  3DV9 A;  1ZQZ A;  2EQY A;  2QAR B;  3KD3 A;  3N7R C;  5AKX A;  3ZI4 A;  2I9G A;  3C23 A;  1BPB A;  4I2B A;  3V7J A;  4FS1 A;  3HKZ F;  2XGQ A;  2HVH A;  4RUA A;  3MFI A;  3GII A;  1ZQB A;  2ZG6 A;  4Q43 A;  5KFH A;  4NXZ A;  3Q8K A;  5FP0 A;  3PSP A;  4YD2 A;  4F5N A;  2NO4 A;  5KFC A;  4ED7 A;  4OD0 A;  2PXR C;  2EIA A;  4I2D A;  4O3Q A;  5ALN A;  2DPI A;  4IL6 U;  5J2B A;  3DEE A;  1NJZ A;  1H38 A;  1URJ A;  2G08 A;  3C2L A;  2EZX A;  4F2S A;  3OGU A;  2QB0 B;  2ASJ A;  1D9F A;  2Y1I A;  5KL8 B;  4RNM A;  3UQ0 A;  4R66 A;  1IIP A;  4EZ6 A;  1HJP A;  4DFP A;  1HUZ A;  3RJF A;  2F77 X;  1Y88 A;  4RPZ A;  2R8J A;  4XRO A;  9ICT A;  5B66 U;  2V4X A;  1K1S A;  2J6U A;  3WKA A;  2XY7 A;  4J9R A;  5D49 A;  4GIB A;  4JV2 A;  4IQW A;  3SAH A;  1U4B A;  5KAI U;  1Z00 A;  4J9O A;  2M8P A;  2BPC A;  2EAP A;  3C5F A;  4I2H A;  3JPQ A;  5DG7 A;  2VA2 A;  2JZB B;  1ZQJ A;  5KG2 A;  3E58 A;  4P4P A;  5ALH A;  3NVV A;  1C7Y A;  3PX4 A;  7ICV A;  2IBK A;  9ICB A;  2KIC A;  4J9N A;  1BPE A;  3BQ1 A;  4DGE C;  2JH1 A;  3PML A;  5BOL A;  2HBL A;  2ZTC A;  1V97 A;  2HI0 A;  4KLI A;  3EYZ A;  3C29 A;  2BHN A;  1LVH A;  2KP7 A;  4ED2 A;  7ICJ A;  5CEH A;  1ZQO A;  9ICA A;  2FPM A;  3WKB A;  2P6R A;  3Q8P B;  1ZQQ A;  1X2I A;  1L8O A;  4PPX A;  5K4L A;  1WG8 A;  1U7K A;  9ICG A;  5ALQ A;  4U0E A;  4FE3 A;  1ZRM A;  4QWA A;  4QZB A;  2LYA A;  4KLO A;  4R8U A;  5AI4 A;  8ICW A;  4O3M A;  1XC9 A;  2FMQ A;  5J0R A;  4B9N A;  2ZJ5 A;  1QSL A;  4Z6C A;  2ISO A;  1N2X A;  1L3V A;  2KFN A;  1ZQY A;  2KHV A;  3SEN A;  2A19 A;  1L3T A;  1SXD A;  2AGO A;  5DQG A;  2H3V A;  4Y2R A;  3RJK A;  1TK5 A;  3T5L A;  4I28 A;  3ISC A;  4UB6 U;  4LJX A;  4J93 A;  2WB1 F;  1V9P A;  2FMS A;  4M9L A;  9ICJ A;  3OJU A;  3ZD9 A;  4BJQ A;  2W8L A;  3IG5 A;  3PR5 B;  1JXL A;  4P4M A;  5AM3 A;  3RRG A;  2YN4 A;  1P7D A;  3PY8 A;  2GO7 A;  3BZK A;  3K4G A;  4DOC A;  3B0Y A;  4KLE A;  3ZDB A;  3PV8 A;  4B6J A;  1N48 A;  9ICH A;  1MSW D;  4FBU A;  3HJE A;  4DSK A;  3V6K A;  5KFJ A;  2BQ3 A;  2YB1 A;  3QXG A;  3UXN A;  1Z19 A;  1LKY A;  1UA0 A;  1QLN A;  2PMZ C;  5J0T A;  5AKJ A;  4FS2 A;  3GIM A;  1KKX A;  3NVY A;  5ALE A;  4QZA A;  3EPI A;  4F5Q A;  1WCL A;  1CRX A;  5J2D A;  1ZD3 A;  4QWB A;  5KT6 A;  4UBB A;  3RJI A;  3G6X A;  2RDI A;  3K75 D;  5JU5 A;  5AKH A;  5HR7 A;  1XO0 A;  3TAQ A;  2C22 A;  4I2J A;  2IHN A;  1IXR A;  2ES6 A;  1ZQK A;  2A1J A;  2KK0 A;  4KLF A;  1LV5 A;  2Q4T A;  4KLM A;  8ICN A;  4RPY A;  7ICS A;  1PZN A;  2E8N A;  4PH2 A;  5KFW A;  3ISB A;  5AIB A;  4DWI A;  4IQT A;  1ZD2 P;  1KTQ A;  1QQ7 A;  1X66 A;  1S0N A;  2FMP A;  3OTQ A;  2KFZ A;  3RTV A;  1SWW A;  4RQ5 A;  3JPT A;  7ICO A;  4ECU A;  3FC4 A;  1MQ2 A;  5KFP A;  4ECW A;  1DK3 A;  4UB1 A;  2KV2 A;  1WYG A;  3KBB A;  4M6W A;  4ECQ A;  2F8L A;  5J0P A;  8ICZ A;  1Z4O A;  3RFA A;  2X2D D;  1S0O A;  1GWP A;  3QU2 A;  2G5I B;  2KZ3 A;  5DBB A;  5IIL A;  3M1Y A;  3JPP A;  4ELU A;  4Y2V A;  1ZQL A;  2ZXI A;  4Q44 A;  3OHB A;  2PFN A;  1XWL A;  3C2K A;  7ICM A;  4F71 A;  3F5E A;  4QWC A;  2LBO A;  4QZC A;  2IHM A;  3AL0 B;  4CF5 A;  5HML A;  5IIO A;  4UAV A;  4PGY A;  5F9N A;  1FFU A;  4Z6E A;  3UXO A;  4YMM A;  3BQ7 A;  4EBC A;  4P0P A;  5KL1 B;  3N97 B;  5AI9 A;  3HPO A;  1OXJ A;  2P66 A;  1F5S A;  5KFI A;  4PL1 A;  1L7N A;  2MUT B;  4NX4 C;  4E92 A;  4YR3 A;  4EBD A;  2XVT A;  3ZDD A;  5G5G A;  1EIA A;  3LWM A;  1NK5 A;  1WWU A;  5DGA A;  5ALK A;  4ECR A;  1D8B A;  5J0U A;  3Q8Q B;  3G6Y A;  1B4F A;  2DL0 A;  3SQI A;  1V85 A;  3ALR A;  2F1J A;  4BGD A;  5CWR A;  3T5K A;  5KFX A;  8ICH A;  1RYU A;  4PZO A;  4Z6F A;  5III A;  5KFL A;  1CEZ A;  7ICI A;  3MGE A;  1K5O A;  2PMZ F;  2HHT A;  3N7P D;  1ZOL A;  1X9M A;  4RQ8 A;  4EBE A;  3B9J A;  4US8 A;  2R8G A;  1MC8 A;  5KG0 A;  3UM9 A;  2OH2 A;  1PVR A;  3TI0 A;  1SZP A;  2M8N A;  3UMC A;  4DQP A;  2LHT A;  3ZDA A;  2ATL A;  2HSZ A;  5DLG A;  5KG4 A;  4FBT A;  4AYB F;  2KOB A;  4AP9 A;  4F50 A;  3AEV A;  3AU2 A;  3J81 j;  2ZXH A;  4YD1 A;  4F4Y A;  2XGY A;  1FO4 A;  4DFM A;  4KN4 A;  2FPK A;  3C5G A;  2JR5 A;  4UAR A;  2KKV A;  2RQ5 A;  4Y2X A;  2KSO A;  4QIW F;  4Y2Y A;  1RM6 C;  2MRL A;  1ZQM A;  1KEJ A;  2PKE A;  2WTF A;  2AGQ A;  1DXS A;  9ICW A;  1LKY B;  5AKI A;  3BS7 A;  3ETL A;  5AKE A;  1KW4 A;  3Q8M A;  3NUQ A;  3RJG A;  1U45 A;  3H0M B;  2VA8 A;  4MHV A;  2XI9 A;  1BPY A;  3ORY A;  4YCX A;  4R63 A;  5DDM A;  2FI1 A;  4M9G A;  3Q8L A;  2I5H A;  4KMU A;  1MA7 A;  4C8O A;  3SZ2 A;  8ICB A;  2YQE A;  4DL3 A;  4JWM A;  4J9P A;  3M8R A;  4XFX A;  1ED1 A;  3M7D A;  4QZ8 A;  3M9O B;  4YR2 A;  5F9L A;  1WCN A;  3WKD A;  1TKD A;  2KSO B;  1BPZ A;  4DS5 A;  2NRW A;  1TV9 A;  5A0L A;  2BCS A;  3D2Q A;  7ICK A;  8ICE A;  4FZM A;  4IRD A;  8ICI A;  2PWM A;  2R8K A;  3UQ2 A;  4NL9 A;  2JEI A;  5HHI A;  2C2R A;  1Z3E B;  9ICQ A;  9ICM A;  2KIV A;  3H0L B;  2CRX A;  2BGW A;  2DGZ A;  4DSE A;  4M9J A;  3AQE A;  1JX4 A;  2W9M A;  4OJP A;  1T7P A;  5ALL A;  4ZH4 A; 
#chains in the Genus database with same CATH homology
 3DEE A;  3LYS A;  2HOQ A;  2A3V A;  1PVQ A;  2WB1 C;  1M9C C;  2ZIV A;  1URJ A;  2G08 A;  4KMO B;  2F76 X;  5HGK A;  5KL8 B;  4NV0 A;  2K8B B;  4QNL A;  2MA1 A;  1IIP A;  1HIW A;  3LVV A;  3M6Z A;  3K1Z A;  2F77 X;  4U0C A;  4XRQ A;  2G06 A;  4XRO A;  2WAQ C;  2V4X A;  4QIW C;  1AK4 C;  4HTW A;  4QJF B;  2F2A B;  3SAH A;  4INB A;  1G03 A;  4XFZ A;  2X83 A;  4AYB C;  3SAG A;  2M8P A;  2HOI A;  1M9Y C;  5HGL A;  2VIX A;  2H3I A;  2KD1 A;  3IP4 B;  3SAF A;  1XNS A;  3ONN A;  4C0Z A;  1ZQ1 C;  2E5S A;  4PL2 A;  3CRX A;  2KIC A;  2W7P A;  3PST A;  1NZB A;  2G09 A;  4DGE C;  2JH1 A;  2HBL A;  2ZIU B;  4PH0 A;  3T79 A;  3C29 A;  3MGV A;  4P0Q A;  4QNB A;  2M0N A;  1T94 A;  4U7C A;  2KGF A;  5T14 A;  2W04 A;  2H3Z A;  1U7K A;  1A0P A;  4U0E A;  1EM9 A;  4FE3 A;  2LYA A;  1YT3 A;  4DGA C;  4P0P B;  2K8C B;  2JMG A;  4O3M A;  2KEY A;  3L3F X;  3M6K A;  4BX9 C;  2KHV A;  1L6N A;  2H3V A;  2LYB A;  2G0A A;  4XFY A;  2D6F C;  4J93 A;  2WB1 F;  1TAM A;  4BJQ A;  3NTE A;  3IG5 A;  1HEK A;  2KJ5 A;  2WLV A;  2E1F A;  3F2D A;  1P7D A;  4BUG A;  2G07 A;  5HR6 A;  2ZIX B;  2ZIU A;  2H3Q A;  2HOF A;  3F2C A;  2YB1 A;  2LKY A;  1DRG A;  1Z19 A;  3N7S C;  2M8L A;  3O0F A;  1A6S A;  2PMZ C;  2BDU A;  1M9F C;  2XIC A;  3LVW A;  4U0A A;  2KJ8 A;  1CRX A;  2KKP A;  3RF9 A;  3VC8 A;  1E6J P;  2OM6 A;  2E1E A;  4GFJ A;  2ZIV B;  2HBJ A;  3HKZ C;  4OJL A;  5HR7 A;  2VJ5 A;  1XO0 A;  5HGO A;  2Q4T A;  2N1R A;  5HGM A;  3H47 A;  4PH2 A;  4JMU A;  2KIW A;  5C0Y A;  4OO1 J;  3IG8 A;  2Y0S C;  2R18 A;  3D2N A;  2OYY A;  2KV2 A;  3F2B A;  2F8L A;  4OJ6 A;  3RFA A;  2X2D D;  2X82 A;  2RP5 A;  1GWP A;  4NLB A;  2NV3 A;  5HGN A;  2G5I B;  4U0F A;  2VKQ A;  2ZXI A;  2Z7J A;  4U6P A;  1UPH A;  3KFU F;  4FZN A;  4CDG A;  3F5E A;  3C28 A;  2GOL A;  2YB4 A;  2LBO A;  3AL0 B;  4WJ3 B;  2H3F A;  4E91 A;  3GU3 A;  4P0P A;  5KL1 B;  2OXO A;  4NWI A;  4P0Q B;  4IC9 A;  2VJ4 A;  4OJO A;  2G5H B;  1GO3 F;  3F53 A;  4PL1 A;  2CN1 A;  4NX4 C;  3KZX A;  4E92 A;  3F5A A;  2XVT A;  3CYM A;  2K4H A;  3GZF A;  1EIA A;  3AQF A;  5CRX A;  1P7N A;  1D8B A;  1KBU A;  4A8E A;  2GH1 A;  2RRD A;  3NRW A;  1M9E C;  3SQI A;  2JGA A;  4NLC A;  3ALR A;  2HBM A;  4ACO A;  3MGE A;  2W03 A;  2KHQ A;  1AFV A;  2PMZ F;  3N7P D;  2K4I A;  2KJ9 A;  4KX3 A;  1QRJ A;  4U0D A;  4PH3 A;  4WYM A;  2ZIX A;  2OH2 A;  3E0F A;  1PVR A;  5JPA A;  2M8N A;  2LHT A;  2YX8 A;  1WUD A;  4AYB F;  1ECW A;  2K89 A;  2JHD A;  3PSF A;  1OUQ A;  2KOB A;  4ICA A;  2ZXH A;  3P05 A;  2JH7 A;  2XGY A;  1D1D A;  2DF4 B;  4LQW C;  2K4E A;  2KKV A;  3SMV A;  4B4N A;  2XGV A;  3VCB A;  4QIW F;  2Y0S F;  3PZP A;  3BP9 A;  2MRL A;  3H0R B;  2W7O A;  2XDE A;  3OPX A;  1M9D C;  2ZIW B;  2CPR A;  3NUQ A;  3H0M B;  1SZH A;  4U0B A;  2KVC A;  2HMX A;  2XI9 A;  3ICX A;  2K8A A;  2LF4 A;  3H4E A;  2ZIW A;  2GON A;  2PWO A;  2Y4Z A;  1MA7 A;  2JPR A;  4CRX A;  4CGZ A;  4KX5 A;  4XFX A;  1M9X C;  2WAQ F;  1ED1 A;  3PSI A;  2RHF A;  3M7D A;  2XGU A;  3N7R C;  1Q3V A;  3HKZ F;  2WLV B;  3D2S A;  2ZG6 A;  2GOL B;  5A0L A;  2DQN B;  1Z1B A;  3D2Q A;  3PSP A;  4FZM A;  2PWM A;  1PVP A;  4FZL A;  1F44 A;  2HBK A;  2XID A;  2PXR C;  3H0L B;  2EIA A;  2CRX A;  2KNJ A;  2DGZ A;  1Q3U A;  3IN5 A;  3AQE A;  4OJ5 A;  3CP8 A;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...