1L6NA

Structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
288
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag Polyprotein
publication title Structure of the N-terminal 283-residue fragment of the immature HIV-1 Gag polyprotein.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 73
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1l6nA01
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1l6nA02
2GOLB 1EM9A 2HMXA 2Y4ZA 4NX4C 4B4NA 1L6NA 3MGEA 4U0EA 2XDEA 2M8LA 2LF4A 4J93A 4U0DA 2JPRA 1M9YC 5HGKA 5HGOA 4U0AA 2H3FA 2X82A 4U0BA 2K4EA 4ICAA 4IC9A 1D1DA 2H3ZA 1M9FC 4U0CA 1M9CC 1QRJA 2WLVA 2K4IA 2XGYA 5HGLA 2JMGA 1M9EC 2KGFA 5HGMA 1M9DC 2V4XA 3P05A 4LQWC 2LYAA 4XFYA 1ED1A 4PH0A 4HTWA 4XFZA 2PWOA 4JMUA 1HIWA 1EIAA 2XGUA 2M8NA 1TAMA 3NTEA 5JPAA 1A6SA 2WLVB 3BP9A 4DGAC 2K4HA 2XGVA 1U7KA 2M8PA 2H3QA 1M9XC 3H47A 4XFXA 4WYMA 1HEKA 2X83A 4QNBA 2EIAA 1UPHA 2GOLA 2LYBA 2X2DD 4XROA 4XRQA 1AK4C 4U0FA 5HGNA 1AFVA 1ECWA 4INBA 2N1RA 1P7NA 4PH2A 2NV3A 2PXRC 3H4EA 2PWMA 4PH3A 2GONA 2H3IA 4DGEC 2H3VA 1GWPA 1E6JP 4E91A 1G03A 4E92A
chains in the Genus database with same CATH superfamily
3C5FA 4M47A 4KN7A 3JPOA 1ZD4A 4PZOA 7ICQA 1NJYA 2BR0A 1ZQLA 3T3FA 1MA7A 2KZ3A 5AI6A 1KBUA 3T5HA 4CF3A 1X66A 4ECXA 7ICGA 4ELUA 3HP6A 2X82A 3RBDA 4DF4A 5ALUA 2ZJ8A 5DDMA 1TK0A 2YMMA 5JUMA 2XIDA 1QSYA 4RQ1A 1ZQSA 4US9A 2IMWP 9ICPA 5ALTA 1JN3A 4QW9A 3B9JA 1JXLA 3Q8RB 4QZBA 5BPCA 4QIWF 1RYSA 2JV3A 3N7SC 3GFKB 4YD2A 3BQ0A 2OYYA 2ZIXA 4G3IA 2WB1F 3KKAC 1IIPA 1SZPA 4UB8U 5KAIU 5F3XB 5J2BA 3HWTA 2GWSA 1A6SA 3V6KA 2KEYA 4J9PA 3L3FX 4BJQA 5G5GA 1QLNA 3RB4A 4R63A 5KFHA 5IIOA 3F2DA 3LVWA 3C23A 2ZTDA 4RNOA 4UB2A 4U0FA 4CDGA 2FE9A 1NK5A 2Y1JA 3ETLA 8ICCA 1UQVA 1KW4A 4DL7A 2AQ0A 1JALA 4DQRA 1BGXT 1BPYA 1UCVA 2ODGA 3C1YA 5DGAA 2F8LA 4NWIA 1ZQBA 1YZ7A 2WTFA 1WUDA 3H8WA 1TE2A 1CRXA 5IILA 2R8JA 3L4PA 2RQ5A 4Q45A 2QLTA 8ICNA 2DBYA 2QB0B 2C22A 2ZIXB 4FBUA 2E8PA 7ICRA 2HOQA 3U26A 3G6VA 4P0QB 4UQGA 2WHEA 1S5LU 5KG5A 2GLEA 4FZNA 3RBEA 5ALXA 1ZQNA 4OO1J 5IIJA 1S0OA 1UT5A 2B6GA 4CRXA 5CB1A 5KFXA 5J2GA 2H3ZA 3PR4A 3BS5A 4NLZA 5KFFA 3SR6A 3C1ZA 1NK4A 2YY6A 3ED5A 2HBLA 2JMGA 4PGQA 2VKQA 5TISU 3ISCA 4KLJA 4ED1A 4HTWA 1Z19A 4ED0A 2D3DA 1FO4A 4YR0A 3Q8KA 2QB1A 2ALZA 4DL3A 4UB3A 1N63A 1WG8A 3ZDAA 5EE3A 9ICAA 2EH9A 9ICGA 4J9KA 5AK5A 1Z1BA 5J0UA 1L3VA 4C8OA 4P0PA 2A19A 2G07A 9ICEA 2EZYA 2D6FC 4RQMA 3BQ1A 1A77A 5ALKA 7ICMA 5DLFA 3HKZF 3PMNA 1L7PA 1DXSA 1ZD2P 2MRLA 3H4EA 2XGPA 1J2NA 2Y0SC 1A0PA 4DFMA 5KFOA 2R18A 2BCRA 1F5SA 1KLNA 5KFMA 1WWVA 1SKWA 3BZKA 5AM5A 5KT5A 2WF9A 3NVZA 1BPEA 1EM9A 1N60A 5C5JA 2Y4ZA 5KFQA 4CE6A 1D9FA 3G6XA 3BQ2A 4DSFA 5AIBA 1QSSA 4Q8FA 3UMBA 3KHLA 5AKHA 4PGYA 1YT3A 4C8MA 1IG6A 3UXOA 5AKXA 1C20A 1Q8KA 2F76X 5HGKA 4NM1A 4QZDA 2YN4A 5KG4A 2W9CB 1RM6C 4F3OA 2WF8A 2W7PA 4YMMA 4F5NA 4U0CA 2ASLA 2EAPA 3MDCA 1QRJA 2A1AA 5CEHA 4WJ3B 3B0YA 4UATA 2IOFK 1JIHA 2VA2A 1M9DC 3E58A 3Q8MA 1RYRA 2UVRA 2KVCA 4LQWC 1SV0A 3OPXA 1U4BA 4F72A 1XSNA 4F4XA 1L7NA 2RDJA 1RXVA 5T14A 4XFZA 4I2DA 4ECVA 1JX4A 3PW4A 2KICA 1ZOLA 4DEZA 2EAOA 4C80A 5KT6A 4P4OA 2K89A 4NL9A 3GIMA 5J8YA 2JH7A 1SXDA 2XY6A 3OTQA 3ICXA 1TFRA 5KFRA 3GV8B 1KRPA 7ICUA 1RPLA 3C2KA 1X6JA 4K4IA 4ED2A 3M7DA 2A1JB 4RU9A 1ZD3A 3GZFA 2X2DD 1NZPA 3BQ7A 1CUKA 1L7MA 2KHVA 5AK3A 1ZYQA 5DB7A 3C5GA 4OJOA 2HDOA 3UQ2A 9ICFA 3SYZA 2HHSA 3MDAA 4C8NA 5ALFA 4YFKA 4FS2A 2HOIA 2XVTA 3BZCA 3ONNA 4Q44A 2NRXA 4CNQA 3N7RC 5ALIA 4P4PA 5AK6A 4ZH4A 3Q8PB 4TQSA 4AP9A 5ALPA 1TAQA 4KMUA 3GDXA 1PK1B 5L1KA 3SENA 3LDAA 4DQPA 4FBTA 3QX7A 4YQWA 2ZIVA 4F92B 3PX0A 4KLMA 5J2HA 3JPTA 2F77X 1RQLA 3VC8A 3RRGA 9ICXA 3KHGA 3PZPA 4MF8A 1ZD5A 1XSLA 1S97A 3NGDA 4M9GA 4QZEA 4AYBC 1ZETA 3MBYA 4F93B 2Y9UA 2NYVA 3H8MA 3CNHA 1VLBA 4J9OA 8ICYA 1Z1VA 1N2XA 4YCXA 3RB3A 5EWEA 5AM2A 5D46A 1ZQXA 4PHDA 4EBEA 2Q0ZX 5J2EA 5ALMA 4US8A 3PW7A 1PVQA 4XUSA 3LK9A 2KTQA 2UVUA 3LWMA 4UAZA 4M04A 1ZQPA 2ZIVB 2LYBA 1DK3A 5DLGA 2KVSA 2AXTU 4EEYA 1RYUA 5EE9A 5J0XA 4JV2A 4DO9A 1SL1A 4YR3A 3DDHA 3PMLA 4I2GA 4F91B 3RJKA 1T94A 1NJZA 4IQWA 4QNLA 3OJSA 4IQUA 1SXEA 3WK4A 2BQUA 4HAIA 4Z6EA 2PMZC 3KKAA 2FMPA 5L1IA 5KFDA 1SGGA 4R8UB 1SV0C 2HHUA 1DGJA 5KFEA 2G08A 4BXOA 5ALYA 3MGVA 2K8CB 4RQ7A 3SMVA 3V6JA 5EWGA 2BKEA 5KFWA 3TFSA 3SAHA 4NL9C 4J03A 2PI5A 5J8YC 1N5WA 4KLGA 2JEJA 4K4GA 1HUOA 4LZGA 4JUZA 1XSPA 1X9XA 1BVSA 2WFAA 1MSWD 2NO4A 5GTHU 1ED1A 2AGOA 2YX8A 1KDHA 4PH0A 2J6UA 3CYMA 3F2CA 4DSLA 5KFJA 4RPYA 4QZ8A 4UB1A 3CRXA 1K1QA 8ICSA 3NRWA 1JROA 3NTEA 4JWMA 4C4RA 2FMSA 4JK1A 2F2AB 5CWRA 3D2SA 1PZNA 4UB6U 5AI8A 4EBDA 2EAMA 5DG9A 4DSJA 3QU5A 2C2DA 5ALSA 2QARB 3DEEA 5BOLA 4B9SA 4F2SA 3PO5A 4INBA 2BDUA 5J0TA 3AM9A 4QWDA 4QWCA 3TARA 2ESEA 2CN1A 2V4QA 2PXIA 1ZQFA 4O3OA 2FPKA 4Y2QA 2KE7A 5KFCA 4EYIB 2KNJA 1ZRNA 4YG2A 4F5OA 4F5PA 4E91A 3SV4A 7ICHA 2Y0SF 4TUSA 2FLLA 4DSKA 8ICXA 1T3QA 3SAFA 4DLEA 1KFSA 2KZZA 4I2JA 3RTVA 4DFDA 1P7DA 5AKZA 4PHEA 1HJPA 2LF4A 1L8OA 3EWAA 4DF8A 4B9NA 2E5SA 1CI4A 1U49A 9ICWA 1NZBA 2H3FA 4DOAA 4JV1A 4F5RA 1UA0A 2R8GA 1N56A 2HBKA 4IR9A 5KT2A 7ICTA 3QU7A 1X2IA 4IC9A 1D1DA 4X5VA 3C2MA 4KLQA 5KG6A 1WWUA 3V72A 3HILA 5KTQA 3UQ0A 4Y2VA 2DL0A 4P2HA 2DQNB 4OD0A 2ZJ5A 3EPGA 5KFUA 8ICLA 3P05A 1ZQ1C 5HHHA 1NKEA 3C21A 3QZ7A 3JPNA 1MQ3A 1XC9A 4NLCA 1S0MA 2JEFA 2MUTB 5KG3A 3MR2A 2EQYA 1MQ2A 2WAQC 1TAMA 2W3RA 4NY8A 1L7OA 3ZD9A 2I6XA 3HT3A 2KFZA 2OH2A 4NM2A 3RRHA 8ICKA 3WKAA 2ZIWB 3CP8A 3KOOA 3PV8A 4M9LA 4WYMA 1VJ5A 2L5YA 5KG1A 1UPHA 4DSIA 2VJ5A 4EZ6A 4RQ3A 3PR5B 2QB0A 4XRQA 4Y2SA 5TZVA 9ICIA 5KG0A 1U47A 1ZQOA 2HVIA 8ICMA 2FLPA 1HUZA 2NV3A 3EYZA 8ICGA 4YP3A 4P0QA 5J0PA 3JPRA 4PH3A 7ICLA 4DL6A 2XC9A 5KFBA 2H3IA 3N28A 4QZ9A 2WF7A 4DWIA 5DG7A 4OJLA 2VANA 3OSNA 2HBMA 4QZCA 3ZDEA 1JUDA 4MFFA 4RQ4A 3D6JA 3WK6A 3WKDA 4ECTA 3WU2U 2ZTCA 4QJFB 4TQRA 2BPFA 2MAXA 5KFYA 3OSPA 5AKYA 4Y2PA 4UB5A 4EEKA 2HHVA 8ICVA 4TUQA 4C8KA 5EOZA 2E8MA 5ALLA 3PO4A 2EDUA 3ORYA 2DUYA 3OJUA 3B0XA 3ZDBA 1SL0A 1Z4OA 1KKXA 5HGMA 1DK2A 4DL2A 4MEXA 1ZQCA 2LYAA 1PVRA 3C28A 2HHXA 5KFTA 2I1QA 4UBCA 5ALNA 4AYBF 2HHWA 4GC6A 3IP4B 3PW0A 2M8NA 3J81j 8ICZA 1MC8A 5EWFA 2E1FA 5HP4A 2F1HA 4PHAA 2W9BA 3H0MB 1J97A 4Y2JA 4EENA 1XU4A 1Z00B 1X42A 1XNSA 2JGAA 3MGIA 1C7YA 2KIVA 5J2JA 7ICKA 4PH2A 1S10A 3WK5A 4YD1A 3H40A 2KIWA 1M6YA 3E2EA 3THVA 1L5UA 2LMRA 1BPBA 2OCEA 4NLNA 2W9CA 3AQEA 1RDFA 3ZDCA 3ZDDA 3AU6A 1TK5A 2HVHA 2P6UA 1WCLA 5CRXA 2M8LA 2W9BB 2PMZF 2F1JA 4F8RA 3RB6A 3GIIA 4U0AA 1NOMA 3WKCA 5J2DA 1RG6A 5JU5A 3QUBA 2Q4TA 3D2NA 4JB3A 3M9OB 1ZQYA 2XI9A 3FAHA 2XO7A 3RJGA 2JH1A 3ALRA 2R8IA 5J2CA 4RQ2A 2A1JA 2LBOA 1AQ6A 1SL2A 1KFTA 4FZMA 3MFHA 5EE0A 4UW9A 3NVYA 2ZUDA 5KT4A 3RR8A 1JXEA 2HOFA 4PL1A 2PFNA 4NLGA 2YMQA 4KLLA 1KN5A 3TADC 2FDRA 3AMZA 4B9LA 4ECZA 1TK8A 1U7KA 2PFOA 2IHNA 2AU0A 2G5IB 4DQIA 4OCZA 4F4KA 2KKPA 1ZQMA 4KLUA 1HEKA 5HMLA 4UB4A 1U9LA 5JRTA 2B21A 4Z6DA 4I2FA 2JZBB 1ECWA 4IRDA 5J2FA 3KBBA 3BDPA 5BOMA 3BJYA 2PXRC 5AHXA 5AKKA 1J2MA 4UAYA 1PK1A 4O0IA 9ICUA 2H3VA 2HW3A 4O5EA 4EX7A 2DGZA 1KTQA 1ZQUA 3UM9A 2W9MA 4Q43A 4GXJA 8ICOA 1N61A 4LZDA 3V7LA 3RH4A 3VCBA 4EZ9A 5AM4A 3GV5B 4Z6FA 2UVWA 5ALQA 7ICEA 4Y2RA 2BQ3A 4UAVA 3T5KA 4PHPA 2KSOB 5H2FU 1NK9A 1KFDA 2R8HA 1BPZA 5AKLA 2FLNA 1M9FC 4YVZA 2RHFA 3N4MB 3TAPA 1D9DA 4DL4A 2OXOA 4DOBA 1JMSA 4FO6A 1ZQRA 3M8SA 4ECSA 1PK3A 3RH5A 3MABA 3A0BU 1SKRA 3RR7A 5L1MA 1NKCA 3QU2A 2XGUA 1EIAA 4HYKA 4GXIA 1B4FA 2G5HB 3KD3A 2HHTA 1AROP 3OGUA 4F4WA 4B9VA 2KJ5A 2R8KA 1B43A 4KTQA 2WAQF 2P6RA 1SKSA 2H3QA 4XFXA 3TANA 3WK7A 2XCAA 1IXRA 4NV0A 1OW5A 1XO1A 2XY7A 1S0VA 2IOFA 1NJWA 1S76D 4IS7A 2B0CA 2AGQA 4YN4A 1NK6A 3QU4A 5C0YA 5L1LA 1X6IA 4R8UA 2C28A 2ZUCA 1L3SA 4DLGA 1RXWA 2NRZA 4QZAA 4KLOA 4XRHA 1T7PA 5EE1A 4E92A 1ZQVA 5HNKA 4ECYA 3O0FA 5DKWA 5DGBA 1SV4A 3N7PD 2LHTA 2AHOB 9ICQA 5D4BA 3TKAA 4U0EA 1L8LA 3AEVA 1S77D 2NRTA 4LVSA 3IHQB 3NASA 3GILA 3GQCA 2CPRA 4M6WB 3I1YA 4Y2UA 2ASDA 3HJEA 3BS7A 5DBAA 2FI1A 1KSPA 1ZQTA 3V7KA 4I2BA 2NO5A 1FEZA 1SZHA 4RUCA 3EW9A 3M9NB 2KGFA 2V4XA 4B9UA 2AH5A 5J0YA 7ICVA 4I2IA 2QARA 4O9MA 3K1RB 8ICHA 1UHUA 3ZI4A 2G09A 1F0MA 1TV9A 4DCCA 1ZJMA 2WLVB 1DGSA 3EZ5A 3TQ1A 2XGVA 2M8PA 2I5HA 5DB9A 4JV0A 3KZIU 4ED7A 1X9WA 3F2BA 9ICMA 4M9NA 8ICBA 2MA1A 4FS1A 4QNBA 4ECRA 2LYHA 1ZQEA 5KFKA 5ALOA 2F44A 3IG8A 5HGNA 4RQ6A 1TKDA 2QKQA 4O3NA 2VA8A 4MFCA 1X9SA 2OEHA 2ATLA 5DB6A 1ZQZA 3AU2A 2H5XA 5JTIA 3C2LA 4IR1A 2GONA 3JPQA 3RJFA 1NK8A 4DGEC 1ZQIA 3LWLA 4B6JA 1OUQA 1N5XA 5ALJA 3FM9A 2CXYA 4B9MA 2ZXHA 4F4ZA 3SZ2A 3KHHA 9ICCA 9ICKA 2MSNA 2IA6A 2GOLB 3GU3A 1LV5A 5ALEA 2A3VA 8ICFA 4B4NA 3Q8SB 5J0QA 3QEBZ 9ICLA 2AJQA 8ICAA 5AIAA 2E8OA 1MN8A 2I9GA 4MF2A 5L1JA 2MUTA 5KFGA 5DDYA 3RJHA 3PSTA 4E0DA 5KG7A 1Q46A 4O5CA 2XGQA 4R65A 9ICOA 3WK8A 2V9WA 2DF4B 2DWQA 2OM6A 4R66A 4BUGA 3K75D 2ZIWA 1YZ6A 5KG2A 5KFNA 4ZOHC 4Y2XA 1Y88A 2YQEA 3PSFA 4OJ6A 4RNMA 4M0AA 2ES6A 4DS5A 3FDSA 4F5QA 3FC4A 1K5OA 1XWLA 3NVWA 7ICSA 1JI7A 1QQ5A 4IRKA 2CRXA 2YMLA 2W8LA 2JEGA 9ICSA 1NKBA 3MFIA 3NUQA 3M6KA 5ALWA 4DGAC 4I29A 5A0LA 2WF5A 5CHGA 3V6HA 1NI3A 4U7CA 3A0HU 1M9XC 3F5EA 4C4SA 4J9SA 3M9MB 1SWWA 4U6PA 5IIMA 1Q3UA 3QEAZ 2M9NA 4G9BA 2HHQA 4O3SA 3JPSA 1AK4C 2DKXA 2YMPA 4LJXA 1NK7A 2VA3A 2P35A 2ISPA 1P7NA 2BCQA 1N48A 2F3NA 8ICQA 3KHRA 8ICUA 1EXNA 5DBCA 3AQFA 3QNMA 3QUTA 1T3NA 4UAUA 7ICIA 3H0LB 3G6YA 3QUCA 2E8NA 2KD1A 3N97B 2FPMA 4IQTA 8ICWA 4KLIA 2M0NA 1LKYB 3HRDD 3RAQA 3AN1A 4F4YA 5DQIA 2DPJA 1D8BA 3K1ZA 2E1EA 7ICOA 2BCSA 1IV8A 5IIIA 3TADA 3SQIA 4I2AA 4M9JA 9ICJA 5J0RA 4ELTA 3QYPA 1UA1A 5B5EU 3S6JA 1CEZA 4IQVA 2XICA 5FP0A 7ICPA 4U0BA 1DRGA 5KFVA 2DFLA 2NRWA 4ECWA 4BX9C 5KT3A 2XCPA 4PL2A 5AI0A 3EPIA 1BPDA 4O5KA 2K4IA 3RJEA 4O3MA 3Q8LA 5ALZA 3HW8A 1NNLA 3T5LA 4O3QA 4I28A 4UBBA 1Z00A 5K4LA 2KMDA 4CCHA 1A76A 4GFJA 4JMUA 5J0SA 4RPXA 5ALGA 4BDPA 4RT3A 3D2QA 2E3TA 4FFDA 3R9KA 4GC7A 3L5KA 4DFKA 1URJA 4DOCA 4Y2TA 4GXKA 4RUAA 3M8RA 2VIXA 2RRDA 2EANA 2EIAA 4PH5A 5IINA 4YR2A 2ZTEA 3IRUA 5AK4A 1N62A 2JRZA 3NVVA 1S9FA 1AFVA 2V4RA 4I2EA 1RQNA 4RPZA 4PJ0U 3K4GA 1B0XA 4QWAA 3UMGA 5AKEA 3HPOA 3PW5A 3UMCA 1GWPA 3RAXA 2F1IA 4NJ8A 1S0NA 4EELA 1WYGA 2W7OA 5GTIU 4I2HA 2KK0A 4B9TA 5KFIA 4RZRA 2IBKA 4MEYA 5AI9A 2W04A 4F71A 5KFZA 2ZUBA 4C4TA 4DFJA 3PX4A 2Z7JA 2ASJA 3JPPA 2AQ4A 2HCFA 5ALRA 4C7YA 4P4MA 3KTQA 2C2EA 7ICJA 2C2RA 4TURA 4F2RA 1WCNA 3AUOA 5KNIA 5HR6A 5HGLA 2DPIA 2G0AA 3NTUA 3IG5A 2GH1A 3F53A 4KX5A 5J0OA 4XFYA 2BZFA 2W03A 5AM3A 8ICPA 4IL6U 4DL5A 4XQ8A 5AI4A 4NLKA 1BNPA 2PWOA 5J0WA 1HIWA 2PI4A 2D8CA 7ICFA 2JZBA 4QWEA 3BS5B 4ED8A 3IM1A 8ICRA 2RDIA 4OJPA 3H0RB 4O3PA 4KN4A 3T5JA 5KL1B 5DQHA 1PUZA 2IOHA 3H47A 1ZQHA 3F5AA 1SB3C 2KFNA 4ED3A 1F44A 4C7ZA 4MHVA 2ZG6A 3I76A 3SEIA 1OXJA 9ICVA 1FFUA 1QTMA 4Q8EA 3IDWA 2KG5A 3PSIA 3UXNA 1ZQQA 2JEIA 1L3UA 3EUB2 2LM1A 2KSOA 4J9NA 1G03A 4P0PB 1UT8A 5J2AA 4KLEA 2UVVA 5ALVA 4DSEA 2WF6A 3T79A 3KFUF 5DQGA 4FE3A 2W11A 4GIBA 5E79U 1ZQGA 2EZZA 1RZTA 3QUQA 4EYHB 1NJXA 2FMQA 5CP2A 2BGWA 4J93A 1D8YA 4U0DA 5AM1A 4ED6A 2JPRA 3GIKA 5HGOA 3ZD8A 2K8BB 1Z3EB 5AKJA 2K4EA 2O6KA 2KN7A 3C29A 1BNOA 3PY8A 4K4HA 4PGXA 4KX3A 3FYHA 3MR6A 4QIWC 3MR3A 5DB8A 4QW8A 4RQ0A 9ICHA 2HSZA 2WB1C 1U45A 2YTUA 2J6SA 5KT7A 4UAWA 4KLHA 3RJIA 1TVAA 4DS4A 2FJ6A 2MU2A 2KJ8A 5IIKA 2KP7A 5JPAA 2PFPA 1ZQWA 2OWOA 2VJ4A 1LVHA 4BWJA 3M6ZA 7ICNA 3DV9A 1FIQA 1X9MA 5KFPA 2W43A 5F9NA 3M1YA 2K4PA 2YB1A 2X83A 2J6TA 4EBCA 4Z6CA 2RP5A 2KJ9A 4KLDA 4XA5A 2DKZA 4USAA 4YXMA 4BGDA 4ECQA 2GO7A 2N1RA 3OHBA 3QE9Y 5J2IA 3WKBA 2W55A 4DQSA 2BCVA 1QCKA 9ICRA 1ZJNA 1PVPA 2KV2A 9ICNA 3H8JA 1XS9D 2EZXA 1LB2B 1ZRMA 2AGPA 4M9HA 1E6JP 5F9LA 4M6WA 4JWNA 4M2YA 4RQNA 5G5HA 1ZXIA 3Q8QB 3PSPA 2HMXA 4KMOB 2P66A 4NX4C 5HHIA 2W3SA 4ACOA 1L6NA 2HBJA 4CF5A 3MR5A 8ICEA 4QZFA 4DQQA 4GLXA 2XDEA 4NLBA 1SIJA 4J9LA 2LI6A 5CJ7A 4UARA 4PPXA 1M9YC 4RT2A 2XY5A 3PX6A 4J9QA 5AKIA 3ETRA 1KL9A 1T8EA 3H8SA 3UXPA 4R64A 3MGHA 1NK0A 3SD7A 5AI5A 5B66U 3V7JA 2LPEA 3LVVA 4KLSA 1COOA 1D8LA 1X40A 2Y9TA 2WLVA 2G06A 1Q3VA 1QSLA 5L9XA 5KFLA 1ZQAA 4I2CA 1L3TA 3HX0A 8ICJA 9ICTA 5J29A 5AICA 2K8AA 3IV6A 5HR7A 3BP9A 5HMMA 5DG8A 4QZIA 2K4HA 4F50A 3RB0A 5KFSA 3GV7B 5AM0A 4KLTA 5ALDA 4RQ5A 3QU9A 2ZXIA 1S8OA 1GO3F 2FPLA 4MFAA 4CF4A 2GOLA 4I27A 2IHMA 2ZIUA 3AL0B 4EX6A 3HKZC 2BPGA 3TAQA 1QQ6A 4A8EA 1ZQKA 5CR0A 3RJJA 2HI0A 2JXJA 5DBBA 2BQRA 5AKGA 1VDVA 2PWMA 3GIJA 3WKEA 4YXJA 5J2KA 2NRVA 3SAGA 2LKYA 2W9AA 2BPCA 3TFRA 3SV3A 8ICTA 1B22A 1U48A 3PW2A 3KZXA 4FZLA 2PKEA 4DFPA 2W54A 2OHFA 3I28A 3IN5A 4ECUA 3RH6A 1KQQA 5D49A 1Z4NA 3MGEA 3QXGA 4C0ZA 2JHDA 1V38A 3SI8A 1IM4A 1SWVA 4YMOA 1V85A 2BHNA 2YB4A 2LM4A 4UASA 1T4GA 2KZMA 3BQTA 3WK9A 1QH9A 3RF9A 4ICAA 2ZIUB 9ICBA 3E0FA 4KITB 4NXZA 5KL8B 1TAUA 1M9CC 4C8LA 1JRPA 4RNNA 4J9MA 3TACB 3H7IA 2XGYA 3QZ8A 1M9EC 3NRZA 3PNCA 1QQ7A 2BCUA 4CGZA 4BXOB 3OHAA 1O08A 3H4DA 3RFAA 4IRCA 4Y2YA 4KLFA 2ISOA 4PZNA 2W8KA 1ZQDA 2BDPA 4OJ5A 3ISDA 3TI0A 1ZQJA 2Y1IA 1BPXA 2PFQA 4J9RA 8ICIA 5KFAA 4BWMA 1XO0A 5ALHA 1V9PA 4O3RA 1DOQA 2KHQA 3ISBA 3H4BA 2KKVA 4XROA 2K60A 4QZGA 4QWBA 5CA7A 1K1SA 2F8KA 1LKYA 2KOBA 1COKA 3UPQA 1O03A 4RQ8A 3CW2C 4QZHA 1H38A 1V97A 3PVXA 2RLTA 2JR5A 5KAFU 4YMNA 1KEJA 1FFVA 3MC1A 2ZJAA 4ELVA 3LYSA 4TUPA 3NS1A
chains in the Genus database with same CATH topology
3VCBA 2PMZC 2W7OA 2G08A 1MA7A 2W04A 1KBUA 3MGVA 2K8CB 2Z7JA 2X82A 3SMVA 3SAHA 1M9FC 2RHFA 2XIDA 5HR6A 5HGLA 2G0AA 2OXOA 3IG5A 2GH1A 3F53A 4KX5A 4QIWF 4XFYA 2W03A 3N7SC 1ED1A 2YX8A 4PH0A 3CYMA 3F2CA 2OYYA 2ZIXA 1HIWA 2WB1F 1EIAA 2PWOA 2XGUA 3CRXA 2G5HB 1IIPA 3NRWA 3NTEA 1A6SA 4OJPA 3H0RB 2KJ5A 2KEYA 5KL1B 2WAQF 2F2AB 3D2SA 3L3FX 4BJQA 2H3QA 3H47A 4XFXA 3F5AA 3F2DA 3LVWA 1F44A 4NV0A 3DEEA 4U0FA 4CDGA 2ZG6A 4INBA 2BDUA 5C0YA 2CN1A 3PSIA 2F8LA 4NWIA 2KNJA 1WUDA 1CRXA 4E91A 1G03A 4P0PB 2Y0SF 4E92A 3SAFA 3O0FA 2ZIXB 3T79A 3KFUF 4FE3A 3N7PD 2LHTA 2HOQA 1P7DA 4U0EA 4P0QB 2LF4A 4J93A 4U0DA 2JPRA 2CPRA 5HGOA 4FZNA 2E5SA 2K8BB 1NZBA 4OO1J 2H3FA 2K4EA 4CRXA 2HBKA 4IC9A 1D1DA 2H3ZA 3C29A 4KX3A 1SZHA 2DQNB 2HBLA 2JMGA 4QIWC 2KGFA 2V4XA 3P05A 2VKQA 1ZQ1C 2WB1C 4NLCA 4HTWA 1Z19A 2G09A 2WAQC 1TAMA 2KJ8A 5JPAA 2WLVB 2VJ4A 2OH2A 3M6ZA 2ZIWB 2XGVA 2M8PA 3CP8A 4WYMA 2YB1A 1Z1BA 3F2BA 2X83A 4P0PA 4QNBA 2G07A 1UPHA 2MA1A 2VJ5A 2D6FC 2RP5A 4XRQA 2KJ9A 3IG8A 5HGNA 2N1RA 3HKZF 2NV3A 4P0QA 2MRLA 3H4EA 4PH3A 1PVPA 2GONA 2KV2A 2H3IA 2Y0SC 4DGEC 1A0PA 1OUQA 1E6JP 2R18A 2ZXHA 4OJLA 2HBMA 2GOLB 3PSPA 3GU3A 1EM9A 2HMXA 4KMOB 2Y4ZA 4NX4C 2A3VA 4B4NA 4ACOA 1L6NA 2HBJA 2XDEA 4NLBA 1YT3A 4QJFB 1M9YC 2F76X 5HGKA 2W7PA 3PSTA 4U0CA 1QRJA 2DF4B 4WJ3B 3LVVA 2OM6A 2WLVA 2G06A 4BUGA 1Q3VA 5HGMA 2ZIWA 1M9DC 2KVCA 3PSFA 4OJ6A 4LQWC 3OPXA 2LYAA 1PVRA 3C28A 5T14A 4XFZA 4AYBF 3IP4B 2M8NA 2KICA 2K8AA 2E1FA 5HR7A 2CRXA 2K89A 3BP9A 2JH7A 3NUQA 3M6KA 3H0MB 4DGAC 2K4HA 5A0LA 3ICXA 4U7CA 1M9XC 3F5EA 2ZXIA 4U6PA 3M7DA 1Q3UA 1GO3F 2GOLA 2ZIUA 3GZFA 3AL0B 2X2DD 1AK4C 1XNSA 3HKZC 2JGAA 4A8EA 2KHVA 1P7NA 4PH2A 4OJOA 2KIWA 2PWMA 3AQFA 3SAGA 2LKYA 3H0LB 3KZXA 2HOIA 3AQEA 2KD1A 2XVTA 4FZLA 3ONNA 3IN5A 2M0NA 3N7RC 5CRXA 1D8BA 3MGEA 3K1ZA 4C0ZA 2E1EA 2JHDA 2M8LA 2PMZF 3SQIA 2YB4A 4U0AA 2ZIVA 2XICA 3RF9A 4U0BA 2Q4TA 4ICAA 2ZIUB 3D2NA 3E0FA 1DRGA 2F77X 4BX9C 4PL2A 3VC8A 5KL8B 1M9CC 3PZPA 2K4IA 2XGYA 4O3MA 2XI9A 1M9EC 2JH1A 3ALRA 4CGZA 4AYBC 3RFAA 2LBOA 4GFJA 4FZMA 4OJ5A 4JMUA 3D2QA 1XO0A 2HOFA 4PL1A 1URJA 1PVQA 1U7KA 2KHQA 2G5IB 2VIXA 2KKPA 2RRDA 1HEKA 2EIAA 2ZIVB 2LYBA 2KKVA 4XROA 1AFVA 1ECWA 2KOBA 2PXRC 1T94A 2H3VA 1GWPA 3LYSA 4QNLA 2DGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOL B;  1EM9 A;  2HMX A;  2Y4Z A;  4NX4 C;  4B4N A;  1L6N A;  3MGE A;  4U0E A;  2XDE A;  2M8L A;  2LF4 A;  4J93 A;  4U0D A;  2JPR A;  1M9Y C;  5HGK A;  5HGO A;  4U0A A;  2H3F A;  2X82 A;  4U0B A;  2K4E A;  4ICA A;  4IC9 A;  1D1D A;  2H3Z A;  1M9F C;  4U0C A;  1M9C C;  1QRJ A;  2WLV A;  2K4I A;  2XGY A;  5HGL A;  2JMG A;  1M9E C;  2KGF A;  5HGM A;  1M9D C;  2V4X A;  3P05 A;  4LQW C;  2LYA A;  4XFY A;  1ED1 A;  4PH0 A;  4HTW A;  4XFZ A;  2PWO A;  4JMU A;  1HIW A;  1EIA A;  2XGU A;  2M8N A;  1TAM A;  3NTE A;  5JPA A;  1A6S A;  2WLV B;  3BP9 A;  4DGA C;  2K4H A;  2XGV A;  1U7K A;  2M8P A;  2H3Q A;  1M9X C;  3H47 A;  4XFX A;  4WYM A;  1HEK A;  2X83 A;  4QNB A;  2EIA A;  1UPH A;  2GOL A;  2LYB A;  2X2D D;  4XRO A;  4XRQ A;  1AK4 C;  4U0F A;  5HGN A;  1AFV A;  1ECW A;  4INB A;  2N1R A;  1P7N A;  4PH2 A;  2NV3 A;  2PXR C;  3H4E A;  2PWM A;  4PH3 A;  2GON A;  2H3I A;  4DGE C;  2H3V A;  1GWP A;  1E6J P;  4E91 A;  1G03 A;  4E92 A; 
#chains in the Genus database with same CATH topology
 3C5F A;  4M47 A;  4KN7 A;  3JPO A;  1ZD4 A;  4PZO A;  7ICQ A;  1NJY A;  2BR0 A;  1ZQL A;  3T3F A;  1MA7 A;  2KZ3 A;  5AI6 A;  1KBU A;  3T5H A;  4CF3 A;  1X66 A;  4ECX A;  7ICG A;  4ELU A;  3HP6 A;  2X82 A;  3RBD A;  4DF4 A;  5ALU A;  2ZJ8 A;  5DDM A;  1TK0 A;  2YMM A;  5JUM A;  2XID A;  1QSY A;  4RQ1 A;  1ZQS A;  4US9 A;  2IMW P;  9ICP A;  5ALT A;  1JN3 A;  4QW9 A;  3B9J A;  1JXL A;  3Q8R B;  4QZB A;  5BPC A;  4QIW F;  1RYS A;  2JV3 A;  3N7S C;  3GFK B;  4YD2 A;  3BQ0 A;  2OYY A;  2ZIX A;  4G3I A;  2WB1 F;  3KKA C;  1IIP A;  1SZP A;  4UB8 U;  5KAI U;  5F3X B;  5J2B A;  3HWT A;  2GWS A;  1A6S A;  3V6K A;  2KEY A;  4J9P A;  3L3F X;  4BJQ A;  5G5G A;  1QLN A;  3RB4 A;  4R63 A;  5KFH A;  5IIO A;  3F2D A;  3LVW A;  3C23 A;  2ZTD A;  4RNO A;  4UB2 A;  4U0F A;  4CDG A;  2FE9 A;  1NK5 A;  2Y1J A;  3ETL A;  8ICC A;  1UQV A;  1KW4 A;  4DL7 A;  2AQ0 A;  1JAL A;  4DQR A;  1BGX T;  1BPY A;  1UCV A;  2ODG A;  3C1Y A;  5DGA A;  2F8L A;  4NWI A;  1ZQB A;  1YZ7 A;  2WTF A;  1WUD A;  3H8W A;  1TE2 A;  1CRX A;  5IIL A;  2R8J A;  3L4P A;  2RQ5 A;  4Q45 A;  2QLT A;  8ICN A;  2DBY A;  2QB0 B;  2C22 A;  2ZIX B;  4FBU A;  2E8P A;  7ICR A;  2HOQ A;  3U26 A;  3G6V A;  4P0Q B;  4UQG A;  2WHE A;  1S5L U;  5KG5 A;  2GLE A;  4FZN A;  3RBE A;  5ALX A;  1ZQN A;  4OO1 J;  5IIJ A;  1S0O A;  1UT5 A;  2B6G A;  4CRX A;  5CB1 A;  5KFX A;  5J2G A;  2H3Z A;  3PR4 A;  3BS5 A;  4NLZ A;  5KFF A;  3SR6 A;  3C1Z A;  1NK4 A;  2YY6 A;  3ED5 A;  2HBL A;  2JMG A;  4PGQ A;  2VKQ A;  5TIS U;  3ISC A;  4KLJ A;  4ED1 A;  4HTW A;  1Z19 A;  4ED0 A;  2D3D A;  1FO4 A;  4YR0 A;  3Q8K A;  2QB1 A;  2ALZ A;  4DL3 A;  4UB3 A;  1N63 A;  1WG8 A;  3ZDA A;  5EE3 A;  9ICA A;  2EH9 A;  9ICG A;  4J9K A;  5AK5 A;  1Z1B A;  5J0U A;  1L3V A;  4C8O A;  4P0P A;  2A19 A;  2G07 A;  9ICE A;  2EZY A;  2D6F C;  4RQM A;  3BQ1 A;  1A77 A;  5ALK A;  7ICM A;  5DLF A;  3HKZ F;  3PMN A;  1L7P A;  1DXS A;  1ZD2 P;  2MRL A;  3H4E A;  2XGP A;  1J2N A;  2Y0S C;  1A0P A;  4DFM A;  5KFO A;  2R18 A;  2BCR A;  1F5S A;  1KLN A;  5KFM A;  1WWV A;  1SKW A;  3BZK A;  5AM5 A;  5KT5 A;  2WF9 A;  3NVZ A;  1BPE A;  1EM9 A;  1N60 A;  5C5J A;  2Y4Z A;  5KFQ A;  4CE6 A;  1D9F A;  3G6X A;  3BQ2 A;  4DSF A;  5AIB A;  1QSS A;  4Q8F A;  3UMB A;  3KHL A;  5AKH A;  4PGY A;  1YT3 A;  4C8M A;  1IG6 A;  3UXO A;  5AKX A;  1C20 A;  1Q8K A;  2F76 X;  5HGK A;  4NM1 A;  4QZD A;  2YN4 A;  5KG4 A;  2W9C B;  1RM6 C;  4F3O A;  2WF8 A;  2W7P A;  4YMM A;  4F5N A;  4U0C A;  2ASL A;  2EAP A;  3MDC A;  1QRJ A;  2A1A A;  5CEH A;  4WJ3 B;  3B0Y A;  4UAT A;  2IOF K;  1JIH A;  2VA2 A;  1M9D C;  3E58 A;  3Q8M A;  1RYR A;  2UVR A;  2KVC A;  4LQW C;  1SV0 A;  3OPX A;  1U4B A;  4F72 A;  1XSN A;  4F4X A;  1L7N A;  2RDJ A;  1RXV A;  5T14 A;  4XFZ A;  4I2D A;  4ECV A;  1JX4 A;  3PW4 A;  2KIC A;  1ZOL A;  4DEZ A;  2EAO A;  4C80 A;  5KT6 A;  4P4O A;  2K89 A;  4NL9 A;  3GIM A;  5J8Y A;  2JH7 A;  1SXD A;  2XY6 A;  3OTQ A;  3ICX A;  1TFR A;  5KFR A;  3GV8 B;  1KRP A;  7ICU A;  1RPL A;  3C2K A;  1X6J A;  4K4I A;  4ED2 A;  3M7D A;  2A1J B;  4RU9 A;  1ZD3 A;  3GZF A;  2X2D D;  1NZP A;  3BQ7 A;  1CUK A;  1L7M A;  2KHV A;  5AK3 A;  1ZYQ A;  5DB7 A;  3C5G A;  4OJO A;  2HDO A;  3UQ2 A;  9ICF A;  3SYZ A;  2HHS A;  3MDA A;  4C8N A;  5ALF A;  4YFK A;  4FS2 A;  2HOI A;  2XVT A;  3BZC A;  3ONN A;  4Q44 A;  2NRX A;  4CNQ A;  3N7R C;  5ALI A;  4P4P A;  5AK6 A;  4ZH4 A;  3Q8P B;  4TQS A;  4AP9 A;  5ALP A;  1TAQ A;  4KMU A;  3GDX A;  1PK1 B;  5L1K A;  3SEN A;  3LDA A;  4DQP A;  4FBT A;  3QX7 A;  4YQW A;  2ZIV A;  4F92 B;  3PX0 A;  4KLM A;  5J2H A;  3JPT A;  2F77 X;  1RQL A;  3VC8 A;  3RRG A;  9ICX A;  3KHG A;  3PZP A;  4MF8 A;  1ZD5 A;  1XSL A;  1S97 A;  3NGD A;  4M9G A;  4QZE A;  4AYB C;  1ZET A;  3MBY A;  4F93 B;  2Y9U A;  2NYV A;  3H8M A;  3CNH A;  1VLB A;  4J9O A;  8ICY A;  1Z1V A;  1N2X A;  4YCX A;  3RB3 A;  5EWE A;  5AM2 A;  5D46 A;  1ZQX A;  4PHD A;  4EBE A;  2Q0Z X;  5J2E A;  5ALM A;  4US8 A;  3PW7 A;  1PVQ A;  4XUS A;  3LK9 A;  2KTQ A;  2UVU A;  3LWM A;  4UAZ A;  4M04 A;  1ZQP A;  2ZIV B;  2LYB A;  1DK3 A;  5DLG A;  2KVS A;  2AXT U;  4EEY A;  1RYU A;  5EE9 A;  5J0X A;  4JV2 A;  4DO9 A;  1SL1 A;  4YR3 A;  3DDH A;  3PML A;  4I2G A;  4F91 B;  3RJK A;  1T94 A;  1NJZ A;  4IQW A;  4QNL A;  3OJS A;  4IQU A;  1SXE A;  3WK4 A;  2BQU A;  4HAI A;  4Z6E A;  2PMZ C;  3KKA A;  2FMP A;  5L1I A;  5KFD A;  1SGG A;  4R8U B;  1SV0 C;  2HHU A;  1DGJ A;  5KFE A;  2G08 A;  4BXO A;  5ALY A;  3MGV A;  2K8C B;  4RQ7 A;  3SMV A;  3V6J A;  5EWG A;  2BKE A;  5KFW A;  3TFS A;  3SAH A;  4NL9 C;  4J03 A;  2PI5 A;  5J8Y C;  1N5W A;  4KLG A;  2JEJ A;  4K4G A;  1HUO A;  4LZG A;  4JUZ A;  1XSP A;  1X9X A;  1BVS A;  2WFA A;  1MSW D;  2NO4 A;  5GTH U;  1ED1 A;  2AGO A;  2YX8 A;  1KDH A;  4PH0 A;  2J6U A;  3CYM A;  3F2C A;  4DSL A;  5KFJ A;  4RPY A;  4QZ8 A;  4UB1 A;  3CRX A;  1K1Q A;  8ICS A;  3NRW A;  1JRO A;  3NTE A;  4JWM A;  4C4R A;  2FMS A;  4JK1 A;  2F2A B;  5CWR A;  3D2S A;  1PZN A;  4UB6 U;  5AI8 A;  4EBD A;  2EAM A;  5DG9 A;  4DSJ A;  3QU5 A;  2C2D A;  5ALS A;  2QAR B;  3DEE A;  5BOL A;  4B9S A;  4F2S A;  3PO5 A;  4INB A;  2BDU A;  5J0T A;  3AM9 A;  4QWD A;  4QWC A;  3TAR A;  2ESE A;  2CN1 A;  2V4Q A;  2PXI A;  1ZQF A;  4O3O A;  2FPK A;  4Y2Q A;  2KE7 A;  5KFC A;  4EYI B;  2KNJ A;  1ZRN A;  4YG2 A;  4F5O A;  4F5P A;  4E91 A;  3SV4 A;  7ICH A;  2Y0S F;  4TUS A;  2FLL A;  4DSK A;  8ICX A;  1T3Q A;  3SAF A;  4DLE A;  1KFS A;  2KZZ A;  4I2J A;  3RTV A;  4DFD A;  1P7D A;  5AKZ A;  4PHE A;  1HJP A;  2LF4 A;  1L8O A;  3EWA A;  4DF8 A;  4B9N A;  2E5S A;  1CI4 A;  1U49 A;  9ICW A;  1NZB A;  2H3F A;  4DOA A;  4JV1 A;  4F5R A;  1UA0 A;  2R8G A;  1N56 A;  2HBK A;  4IR9 A;  5KT2 A;  7ICT A;  3QU7 A;  1X2I A;  4IC9 A;  1D1D A;  4X5V A;  3C2M A;  4KLQ A;  5KG6 A;  1WWU A;  3V72 A;  3HIL A;  5KTQ A;  3UQ0 A;  4Y2V A;  2DL0 A;  4P2H A;  2DQN B;  4OD0 A;  2ZJ5 A;  3EPG A;  5KFU A;  8ICL A;  3P05 A;  1ZQ1 C;  5HHH A;  1NKE A;  3C21 A;  3QZ7 A;  3JPN A;  1MQ3 A;  1XC9 A;  4NLC A;  1S0M A;  2JEF A;  2MUT B;  5KG3 A;  3MR2 A;  2EQY A;  1MQ2 A;  2WAQ C;  1TAM A;  2W3R A;  4NY8 A;  1L7O A;  3ZD9 A;  2I6X A;  3HT3 A;  2KFZ A;  2OH2 A;  4NM2 A;  3RRH A;  8ICK A;  3WKA A;  2ZIW B;  3CP8 A;  3KOO A;  3PV8 A;  4M9L A;  4WYM A;  1VJ5 A;  2L5Y A;  5KG1 A;  1UPH A;  4DSI A;  2VJ5 A;  4EZ6 A;  4RQ3 A;  3PR5 B;  2QB0 A;  4XRQ A;  4Y2S A;  5TZV A;  9ICI A;  5KG0 A;  1U47 A;  1ZQO A;  2HVI A;  8ICM A;  2FLP A;  1HUZ A;  2NV3 A;  3EYZ A;  8ICG A;  4YP3 A;  4P0Q A;  5J0P A;  3JPR A;  4PH3 A;  7ICL A;  4DL6 A;  2XC9 A;  5KFB A;  2H3I A;  3N28 A;  4QZ9 A;  2WF7 A;  4DWI A;  5DG7 A;  4OJL A;  2VAN A;  3OSN A;  2HBM A;  4QZC A;  3ZDE A;  1JUD A;  4MFF A;  4RQ4 A;  3D6J A;  3WK6 A;  3WKD A;  4ECT A;  3WU2 U;  2ZTC A;  4QJF B;  4TQR A;  2BPF A;  2MAX A;  5KFY A;  3OSP A;  5AKY A;  4Y2P A;  4UB5 A;  4EEK A;  2HHV A;  8ICV A;  4TUQ A;  4C8K A;  5EOZ A;  2E8M A;  5ALL A;  3PO4 A;  2EDU A;  3ORY A;  2DUY A;  3OJU A;  3B0X A;  3ZDB A;  1SL0 A;  1Z4O A;  1KKX A;  5HGM A;  1DK2 A;  4DL2 A;  4MEX A;  1ZQC A;  2LYA A;  1PVR A;  3C28 A;  2HHX A;  5KFT A;  2I1Q A;  4UBC A;  5ALN A;  4AYB F;  2HHW A;  4GC6 A;  3IP4 B;  3PW0 A;  2M8N A;  3J81 j;  8ICZ A;  1MC8 A;  5EWF A;  2E1F A;  5HP4 A;  2F1H A;  4PHA A;  2W9B A;  3H0M B;  1J97 A;  4Y2J A;  4EEN A;  1XU4 A;  1Z00 B;  1X42 A;  1XNS A;  2JGA A;  3MGI A;  1C7Y A;  2KIV A;  5J2J A;  7ICK A;  4PH2 A;  1S10 A;  3WK5 A;  4YD1 A;  3H40 A;  2KIW A;  1M6Y A;  3E2E A;  3THV A;  1L5U A;  2LMR A;  1BPB A;  2OCE A;  4NLN A;  2W9C A;  3AQE A;  1RDF A;  3ZDC A;  3ZDD A;  3AU6 A;  1TK5 A;  2HVH A;  2P6U A;  1WCL A;  5CRX A;  2M8L A;  2W9B B;  2PMZ F;  2F1J A;  4F8R A;  3RB6 A;  3GII A;  4U0A A;  1NOM A;  3WKC A;  5J2D A;  1RG6 A;  5JU5 A;  3QUB A;  2Q4T A;  3D2N A;  4JB3 A;  3M9O B;  1ZQY A;  2XI9 A;  3FAH A;  2XO7 A;  3RJG A;  2JH1 A;  3ALR A;  2R8I A;  5J2C A;  4RQ2 A;  2A1J A;  2LBO A;  1AQ6 A;  1SL2 A;  1KFT A;  4FZM A;  3MFH A;  5EE0 A;  4UW9 A;  3NVY A;  2ZUD A;  5KT4 A;  3RR8 A;  1JXE A;  2HOF A;  4PL1 A;  2PFN A;  4NLG A;  2YMQ A;  4KLL A;  1KN5 A;  3TAD C;  2FDR A;  3AMZ A;  4B9L A;  4ECZ A;  1TK8 A;  1U7K A;  2PFO A;  2IHN A;  2AU0 A;  2G5I B;  4DQI A;  4OCZ A;  4F4K A;  2KKP A;  1ZQM A;  4KLU A;  1HEK A;  5HML A;  4UB4 A;  1U9L A;  5JRT A;  2B21 A;  4Z6D A;  4I2F A;  2JZB B;  1ECW A;  4IRD A;  5J2F A;  3KBB A;  3BDP A;  5BOM A;  3BJY A;  2PXR C;  5AHX A;  5AKK A;  1J2M A;  4UAY A;  1PK1 A;  4O0I A;  9ICU A;  2H3V A;  2HW3 A;  4O5E A;  4EX7 A;  2DGZ A;  1KTQ A;  1ZQU A;  3UM9 A;  2W9M A;  4Q43 A;  4GXJ A;  8ICO A;  1N61 A;  4LZD A;  3V7L A;  3RH4 A;  3VCB A;  4EZ9 A;  5AM4 A;  3GV5 B;  4Z6F A;  2UVW A;  5ALQ A;  7ICE A;  4Y2R A;  2BQ3 A;  4UAV A;  3T5K A;  4PHP A;  2KSO B;  5H2F U;  1NK9 A;  1KFD A;  2R8H A;  1BPZ A;  5AKL A;  2FLN A;  1M9F C;  4YVZ A;  2RHF A;  3N4M B;  3TAP A;  1D9D A;  4DL4 A;  2OXO A;  4DOB A;  1JMS A;  4FO6 A;  1ZQR A;  3M8S A;  4ECS A;  1PK3 A;  3RH5 A;  3MAB A;  3A0B U;  1SKR A;  3RR7 A;  5L1M A;  1NKC A;  3QU2 A;  2XGU A;  1EIA A;  4HYK A;  4GXI A;  1B4F A;  2G5H B;  3KD3 A;  2HHT A;  1ARO P;  3OGU A;  4F4W A;  4B9V A;  2KJ5 A;  2R8K A;  1B43 A;  4KTQ A;  2WAQ F;  2P6R A;  1SKS A;  2H3Q A;  4XFX A;  3TAN A;  3WK7 A;  2XCA A;  1IXR A;  4NV0 A;  1OW5 A;  1XO1 A;  2XY7 A;  1S0V A;  2IOF A;  1NJW A;  1S76 D;  4IS7 A;  2B0C A;  2AGQ A;  4YN4 A;  1NK6 A;  3QU4 A;  5C0Y A;  5L1L A;  1X6I A;  4R8U A;  2C28 A;  2ZUC A;  1L3S A;  4DLG A;  1RXW A;  2NRZ A;  4QZA A;  4KLO A;  4XRH A;  1T7P A;  5EE1 A;  4E92 A;  1ZQV A;  5HNK A;  4ECY A;  3O0F A;  5DKW A;  5DGB A;  1SV4 A;  3N7P D;  2LHT A;  2AHO B;  9ICQ A;  5D4B A;  3TKA A;  4U0E A;  1L8L A;  3AEV A;  1S77 D;  2NRT A;  4LVS A;  3IHQ B;  3NAS A;  3GIL A;  3GQC A;  2CPR A;  4M6W B;  3I1Y A;  4Y2U A;  2ASD A;  3HJE A;  3BS7 A;  5DBA A;  2FI1 A;  1KSP A;  1ZQT A;  3V7K A;  4I2B A;  2NO5 A;  1FEZ A;  1SZH A;  4RUC A;  3EW9 A;  3M9N B;  2KGF A;  2V4X A;  4B9U A;  2AH5 A;  5J0Y A;  7ICV A;  4I2I A;  2QAR A;  4O9M A;  3K1R B;  8ICH A;  1UHU A;  3ZI4 A;  2G09 A;  1F0M A;  1TV9 A;  4DCC A;  1ZJM A;  2WLV B;  1DGS A;  3EZ5 A;  3TQ1 A;  2XGV A;  2M8P A;  2I5H A;  5DB9 A;  4JV0 A;  3KZI U;  4ED7 A;  1X9W A;  3F2B A;  9ICM A;  4M9N A;  8ICB A;  2MA1 A;  4FS1 A;  4QNB A;  4ECR A;  2LYH A;  1ZQE A;  5KFK A;  5ALO A;  2F44 A;  3IG8 A;  5HGN A;  4RQ6 A;  1TKD A;  2QKQ A;  4O3N A;  2VA8 A;  4MFC A;  1X9S A;  2OEH A;  2ATL A;  5DB6 A;  1ZQZ A;  3AU2 A;  2H5X A;  5JTI A;  3C2L A;  4IR1 A;  2GON A;  3JPQ A;  3RJF A;  1NK8 A;  4DGE C;  1ZQI A;  3LWL A;  4B6J A;  1OUQ A;  1N5X A;  5ALJ A;  3FM9 A;  2CXY A;  4B9M A;  2ZXH A;  4F4Z A;  3SZ2 A;  3KHH A;  9ICC A;  9ICK A;  2MSN A;  2IA6 A;  2GOL B;  3GU3 A;  1LV5 A;  5ALE A;  2A3V A;  8ICF A;  4B4N A;  3Q8S B;  5J0Q A;  3QEB Z;  9ICL A;  2AJQ A;  8ICA A;  5AIA A;  2E8O A;  1MN8 A;  2I9G A;  4MF2 A;  5L1J A;  2MUT A;  5KFG A;  5DDY A;  3RJH A;  3PST A;  4E0D A;  5KG7 A;  1Q46 A;  4O5C A;  2XGQ A;  4R65 A;  9ICO A;  3WK8 A;  2V9W A;  2DF4 B;  2DWQ A;  2OM6 A;  4R66 A;  4BUG A;  3K75 D;  2ZIW A;  1YZ6 A;  5KG2 A;  5KFN A;  4ZOH C;  4Y2X A;  1Y88 A;  2YQE A;  3PSF A;  4OJ6 A;  4RNM A;  4M0A A;  2ES6 A;  4DS5 A;  3FDS A;  4F5Q A;  3FC4 A;  1K5O A;  1XWL A;  3NVW A;  7ICS A;  1JI7 A;  1QQ5 A;  4IRK A;  2CRX A;  2YML A;  2W8L A;  2JEG A;  9ICS A;  1NKB A;  3MFI A;  3NUQ A;  3M6K A;  5ALW A;  4DGA C;  4I29 A;  5A0L A;  2WF5 A;  5CHG A;  3V6H A;  1NI3 A;  4U7C A;  3A0H U;  1M9X C;  3F5E A;  4C4S A;  4J9S A;  3M9M B;  1SWW A;  4U6P A;  5IIM A;  1Q3U A;  3QEA Z;  2M9N A;  4G9B A;  2HHQ A;  4O3S A;  3JPS A;  1AK4 C;  2DKX A;  2YMP A;  4LJX A;  1NK7 A;  2VA3 A;  2P35 A;  2ISP A;  1P7N A;  2BCQ A;  1N48 A;  2F3N A;  8ICQ A;  3KHR A;  8ICU A;  1EXN A;  5DBC A;  3AQF A;  3QNM A;  3QUT A;  1T3N A;  4UAU A;  7ICI A;  3H0L B;  3G6Y A;  3QUC A;  2E8N A;  2KD1 A;  3N97 B;  2FPM A;  4IQT A;  8ICW A;  4KLI A;  2M0N A;  1LKY B;  3HRD D;  3RAQ A;  3AN1 A;  4F4Y A;  5DQI A;  2DPJ A;  1D8B A;  3K1Z A;  2E1E A;  7ICO A;  2BCS A;  1IV8 A;  5III A;  3TAD A;  3SQI A;  4I2A A;  4M9J A;  9ICJ A;  5J0R A;  4ELT A;  3QYP A;  1UA1 A;  5B5E U;  3S6J A;  1CEZ A;  4IQV A;  2XIC A;  5FP0 A;  7ICP A;  4U0B A;  1DRG A;  5KFV A;  2DFL A;  2NRW A;  4ECW A;  4BX9 C;  5KT3 A;  2XCP A;  4PL2 A;  5AI0 A;  3EPI A;  1BPD A;  4O5K A;  2K4I A;  3RJE A;  4O3M A;  3Q8L A;  5ALZ A;  3HW8 A;  1NNL A;  3T5L A;  4O3Q A;  4I28 A;  4UBB A;  1Z00 A;  5K4L A;  2KMD A;  4CCH A;  1A76 A;  4GFJ A;  4JMU A;  5J0S A;  4RPX A;  5ALG A;  4BDP A;  4RT3 A;  3D2Q A;  2E3T A;  4FFD A;  3R9K A;  4GC7 A;  3L5K A;  4DFK A;  1URJ A;  4DOC A;  4Y2T A;  4GXK A;  4RUA A;  3M8R A;  2VIX A;  2RRD A;  2EAN A;  2EIA A;  4PH5 A;  5IIN A;  4YR2 A;  2ZTE A;  3IRU A;  5AK4 A;  1N62 A;  2JRZ A;  3NVV A;  1S9F A;  1AFV A;  2V4R A;  4I2E A;  1RQN A;  4RPZ A;  4PJ0 U;  3K4G A;  1B0X A;  4QWA A;  3UMG A;  5AKE A;  3HPO A;  3PW5 A;  3UMC A;  1GWP A;  3RAX A;  2F1I A;  4NJ8 A;  1S0N A;  4EEL A;  1WYG A;  2W7O A;  5GTI U;  4I2H A;  2KK0 A;  4B9T A;  5KFI A;  4RZR A;  2IBK A;  4MEY A;  5AI9 A;  2W04 A;  4F71 A;  5KFZ A;  2ZUB A;  4C4T A;  4DFJ A;  3PX4 A;  2Z7J A;  2ASJ A;  3JPP A;  2AQ4 A;  2HCF A;  5ALR A;  4C7Y A;  4P4M A;  3KTQ A;  2C2E A;  7ICJ A;  2C2R A;  4TUR A;  4F2R A;  1WCN A;  3AUO A;  5KNI A;  5HR6 A;  5HGL A;  2DPI A;  2G0A A;  3NTU A;  3IG5 A;  2GH1 A;  3F53 A;  4KX5 A;  5J0O A;  4XFY A;  2BZF A;  2W03 A;  5AM3 A;  8ICP A;  4IL6 U;  4DL5 A;  4XQ8 A;  5AI4 A;  4NLK A;  1BNP A;  2PWO A;  5J0W A;  1HIW A;  2PI4 A;  2D8C A;  7ICF A;  2JZB A;  4QWE A;  3BS5 B;  4ED8 A;  3IM1 A;  8ICR A;  2RDI A;  4OJP A;  3H0R B;  4O3P A;  4KN4 A;  3T5J A;  5KL1 B;  5DQH A;  1PUZ A;  2IOH A;  3H47 A;  1ZQH A;  3F5A A;  1SB3 C;  2KFN A;  4ED3 A;  1F44 A;  4C7Z A;  4MHV A;  2ZG6 A;  3I76 A;  3SEI A;  1OXJ A;  9ICV A;  1FFU A;  1QTM A;  4Q8E A;  3IDW A;  2KG5 A;  3PSI A;  3UXN A;  1ZQQ A;  2JEI A;  1L3U A;  3EUB 2;  2LM1 A;  2KSO A;  4J9N A;  1G03 A;  4P0P B;  1UT8 A;  5J2A A;  4KLE A;  2UVV A;  5ALV A;  4DSE A;  2WF6 A;  3T79 A;  3KFU F;  5DQG A;  4FE3 A;  2W11 A;  4GIB A;  5E79 U;  1ZQG A;  2EZZ A;  1RZT A;  3QUQ A;  4EYH B;  1NJX A;  2FMQ A;  5CP2 A;  2BGW A;  4J93 A;  1D8Y A;  4U0D A;  5AM1 A;  4ED6 A;  2JPR A;  3GIK A;  5HGO A;  3ZD8 A;  2K8B B;  1Z3E B;  5AKJ A;  2K4E A;  2O6K A;  2KN7 A;  3C29 A;  1BNO A;  3PY8 A;  4K4H A;  4PGX A;  4KX3 A;  3FYH A;  3MR6 A;  4QIW C;  3MR3 A;  5DB8 A;  4QW8 A;  4RQ0 A;  9ICH A;  2HSZ A;  2WB1 C;  1U45 A;  2YTU A;  2J6S A;  5KT7 A;  4UAW A;  4KLH A;  3RJI A;  1TVA A;  4DS4 A;  2FJ6 A;  2MU2 A;  2KJ8 A;  5IIK A;  2KP7 A;  5JPA A;  2PFP A;  1ZQW A;  2OWO A;  2VJ4 A;  1LVH A;  4BWJ A;  3M6Z A;  7ICN A;  3DV9 A;  1FIQ A;  1X9M A;  5KFP A;  2W43 A;  5F9N A;  3M1Y A;  2K4P A;  2YB1 A;  2X83 A;  2J6T A;  4EBC A;  4Z6C A;  2RP5 A;  2KJ9 A;  4KLD A;  4XA5 A;  2DKZ A;  4USA A;  4YXM A;  4BGD A;  4ECQ A;  2GO7 A;  2N1R A;  3OHB A;  3QE9 Y;  5J2I A;  3WKB A;  2W55 A;  4DQS A;  2BCV A;  1QCK A;  9ICR A;  1ZJN A;  1PVP A;  2KV2 A;  9ICN A;  3H8J A;  1XS9 D;  2EZX A;  1LB2 B;  1ZRM A;  2AGP A;  4M9H A;  1E6J P;  5F9L A;  4M6W A;  4JWN A;  4M2Y A;  4RQN A;  5G5H A;  1ZXI A;  3Q8Q B;  3PSP A;  2HMX A;  4KMO B;  2P66 A;  4NX4 C;  5HHI A;  2W3S A;  4ACO A;  1L6N A;  2HBJ A;  4CF5 A;  3MR5 A;  8ICE A;  4QZF A;  4DQQ A;  4GLX A;  2XDE A;  4NLB A;  1SIJ A;  4J9L A;  2LI6 A;  5CJ7 A;  4UAR A;  4PPX A;  1M9Y C;  4RT2 A;  2XY5 A;  3PX6 A;  4J9Q A;  5AKI A;  3ETR A;  1KL9 A;  1T8E A;  3H8S A;  3UXP A;  4R64 A;  3MGH A;  1NK0 A;  3SD7 A;  5AI5 A;  5B66 U;  3V7J A;  2LPE A;  3LVV A;  4KLS A;  1COO A;  1D8L A;  1X40 A;  2Y9T A;  2WLV A;  2G06 A;  1Q3V A;  1QSL A;  5L9X A;  5KFL A;  1ZQA A;  4I2C A;  1L3T A;  3HX0 A;  8ICJ A;  9ICT A;  5J29 A;  5AIC A;  2K8A A;  3IV6 A;  5HR7 A;  3BP9 A;  5HMM A;  5DG8 A;  4QZI A;  2K4H A;  4F50 A;  3RB0 A;  5KFS A;  3GV7 B;  5AM0 A;  4KLT A;  5ALD A;  4RQ5 A;  3QU9 A;  2ZXI A;  1S8O A;  1GO3 F;  2FPL A;  4MFA A;  4CF4 A;  2GOL A;  4I27 A;  2IHM A;  2ZIU A;  3AL0 B;  4EX6 A;  3HKZ C;  2BPG A;  3TAQ A;  1QQ6 A;  4A8E A;  1ZQK A;  5CR0 A;  3RJJ A;  2HI0 A;  2JXJ A;  5DBB A;  2BQR A;  5AKG A;  1VDV A;  2PWM A;  3GIJ A;  3WKE A;  4YXJ A;  5J2K A;  2NRV A;  3SAG A;  2LKY A;  2W9A A;  2BPC A;  3TFR A;  3SV3 A;  8ICT A;  1B22 A;  1U48 A;  3PW2 A;  3KZX A;  4FZL A;  2PKE A;  4DFP A;  2W54 A;  2OHF A;  3I28 A;  3IN5 A;  4ECU A;  3RH6 A;  1KQQ A;  5D49 A;  1Z4N A;  3MGE A;  3QXG A;  4C0Z A;  2JHD A;  1V38 A;  3SI8 A;  1IM4 A;  1SWV A;  4YMO A;  1V85 A;  2BHN A;  2YB4 A;  2LM4 A;  4UAS A;  1T4G A;  2KZM A;  3BQT A;  3WK9 A;  1QH9 A;  3RF9 A;  4ICA A;  2ZIU B;  9ICB A;  3E0F A;  4KIT B;  4NXZ A;  5KL8 B;  1TAU A;  1M9C C;  4C8L A;  1JRP A;  4RNN A;  4J9M A;  3TAC B;  3H7I A;  2XGY A;  3QZ8 A;  1M9E C;  3NRZ A;  3PNC A;  1QQ7 A;  2BCU A;  4CGZ A;  4BXO B;  3OHA A;  1O08 A;  3H4D A;  3RFA A;  4IRC A;  4Y2Y A;  4KLF A;  2ISO A;  4PZN A;  2W8K A;  1ZQD A;  2BDP A;  4OJ5 A;  3ISD A;  3TI0 A;  1ZQJ A;  2Y1I A;  1BPX A;  2PFQ A;  4J9R A;  8ICI A;  5KFA A;  4BWM A;  1XO0 A;  5ALH A;  1V9P A;  4O3R A;  1DOQ A;  2KHQ A;  3ISB A;  3H4B A;  2KKV A;  4XRO A;  2K60 A;  4QZG A;  4QWB A;  5CA7 A;  1K1S A;  2F8K A;  1LKY A;  2KOB A;  1COK A;  3UPQ A;  1O03 A;  4RQ8 A;  3CW2 C;  4QZH A;  1H38 A;  1V97 A;  3PVX A;  2RLT A;  2JR5 A;  5KAF U;  4YMN A;  1KEJ A;  1FFV A;  3MC1 A;  2ZJA A;  4ELV A;  3LYS A;  4TUP A;  3NS1 A; 
#chains in the Genus database with same CATH homology
 3VCB A;  2PMZ C;  2W7O A;  2G08 A;  1MA7 A;  2W04 A;  1KBU A;  3MGV A;  2K8C B;  2Z7J A;  2X82 A;  3SMV A;  3SAH A;  1M9F C;  2RHF A;  2XID A;  5HR6 A;  5HGL A;  2G0A A;  2OXO A;  3IG5 A;  2GH1 A;  3F53 A;  4KX5 A;  4QIW F;  4XFY A;  2W03 A;  3N7S C;  1ED1 A;  2YX8 A;  4PH0 A;  3CYM A;  3F2C A;  2OYY A;  2ZIX A;  1HIW A;  2WB1 F;  1EIA A;  2PWO A;  2XGU A;  3CRX A;  2G5H B;  1IIP A;  3NRW A;  3NTE A;  1A6S A;  4OJP A;  3H0R B;  2KJ5 A;  2KEY A;  5KL1 B;  2WAQ F;  2F2A B;  3D2S A;  3L3F X;  4BJQ A;  2H3Q A;  3H47 A;  4XFX A;  3F5A A;  3F2D A;  3LVW A;  1F44 A;  4NV0 A;  3DEE A;  4U0F A;  4CDG A;  2ZG6 A;  4INB A;  2BDU A;  5C0Y A;  2CN1 A;  3PSI A;  2F8L A;  4NWI A;  2KNJ A;  1WUD A;  1CRX A;  4E91 A;  1G03 A;  4P0P B;  2Y0S F;  4E92 A;  3SAF A;  3O0F A;  2ZIX B;  3T79 A;  3KFU F;  4FE3 A;  3N7P D;  2LHT A;  2HOQ A;  1P7D A;  4U0E A;  4P0Q B;  2LF4 A;  4J93 A;  4U0D A;  2JPR A;  2CPR A;  5HGO A;  4FZN A;  2E5S A;  2K8B B;  1NZB A;  4OO1 J;  2H3F A;  2K4E A;  4CRX A;  2HBK A;  4IC9 A;  1D1D A;  2H3Z A;  3C29 A;  4KX3 A;  1SZH A;  2DQN B;  2HBL A;  2JMG A;  4QIW C;  2KGF A;  2V4X A;  3P05 A;  2VKQ A;  1ZQ1 C;  2WB1 C;  4NLC A;  4HTW A;  1Z19 A;  2G09 A;  2WAQ C;  1TAM A;  2KJ8 A;  5JPA A;  2WLV B;  2VJ4 A;  2OH2 A;  3M6Z A;  2ZIW B;  2XGV A;  2M8P A;  3CP8 A;  4WYM A;  2YB1 A;  1Z1B A;  3F2B A;  2X83 A;  4P0P A;  4QNB A;  2G07 A;  1UPH A;  2MA1 A;  2VJ5 A;  2D6F C;  2RP5 A;  4XRQ A;  2KJ9 A;  3IG8 A;  5HGN A;  2N1R A;  3HKZ F;  2NV3 A;  4P0Q A;  2MRL A;  3H4E A;  4PH3 A;  1PVP A;  2GON A;  2KV2 A;  2H3I A;  2Y0S C;  4DGE C;  1A0P A;  1OUQ A;  1E6J P;  2R18 A;  2ZXH A;  4OJL A;  2HBM A;  2GOL B;  3PSP A;  3GU3 A;  1EM9 A;  2HMX A;  4KMO B;  2Y4Z A;  4NX4 C;  2A3V A;  4B4N A;  4ACO A;  1L6N A;  2HBJ A;  2XDE A;  4NLB A;  1YT3 A;  4QJF B;  1M9Y C;  2F76 X;  5HGK A;  2W7P A;  3PST A;  4U0C A;  1QRJ A;  2DF4 B;  4WJ3 B;  3LVV A;  2OM6 A;  2WLV A;  2G06 A;  4BUG A;  1Q3V A;  5HGM A;  2ZIW A;  1M9D C;  2KVC A;  3PSF A;  4OJ6 A;  4LQW C;  3OPX A;  2LYA A;  1PVR A;  3C28 A;  5T14 A;  4XFZ A;  4AYB F;  3IP4 B;  2M8N A;  2KIC A;  2K8A A;  2E1F A;  5HR7 A;  2CRX A;  2K89 A;  3BP9 A;  2JH7 A;  3NUQ A;  3M6K A;  3H0M B;  4DGA C;  2K4H A;  5A0L A;  3ICX A;  4U7C A;  1M9X C;  3F5E A;  2ZXI A;  4U6P A;  3M7D A;  1Q3U A;  1GO3 F;  2GOL A;  2ZIU A;  3GZF A;  3AL0 B;  2X2D D;  1AK4 C;  1XNS A;  3HKZ C;  2JGA A;  4A8E A;  2KHV A;  1P7N A;  4PH2 A;  4OJO A;  2KIW A;  2PWM A;  3AQF A;  3SAG A;  2LKY A;  3H0L B;  3KZX A;  2HOI A;  3AQE A;  2KD1 A;  2XVT A;  4FZL A;  3ONN A;  3IN5 A;  2M0N A;  3N7R C;  5CRX A;  1D8B A;  3MGE A;  3K1Z A;  4C0Z A;  2E1E A;  2JHD A;  2M8L A;  2PMZ F;  3SQI A;  2YB4 A;  4U0A A;  2ZIV A;  2XIC A;  3RF9 A;  4U0B A;  2Q4T A;  4ICA A;  2ZIU B;  3D2N A;  3E0F A;  1DRG A;  2F77 X;  4BX9 C;  4PL2 A;  3VC8 A;  5KL8 B;  1M9C C;  3PZP A;  2K4I A;  2XGY A;  4O3M A;  2XI9 A;  1M9E C;  2JH1 A;  3ALR A;  4CGZ A;  4AYB C;  3RFA A;  2LBO A;  4GFJ A;  4FZM A;  4OJ5 A;  4JMU A;  3D2Q A;  1XO0 A;  2HOF A;  4PL1 A;  1URJ A;  1PVQ A;  1U7K A;  2KHQ A;  2G5I B;  2VIX A;  2KKP A;  2RRD A;  1HEK A;  2EIA A;  2ZIV B;  2LYB A;  2KKV A;  4XRO A;  1AFV A;  1ECW A;  2KOB A;  2PXR C;  1T94 A;  2H3V A;  1GWP A;  3LYS A;  4QNL A;  2DGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...