1L6NA

Structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
288
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag Polyprotein
publication title Structure of the N-terminal 283-residue fragment of the immature HIV-1 Gag polyprotein.
pubmed rcsb
source organism Human immunodeficiency virus 1
total genus 73
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1l6nA01
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1l6nA02
1HIWA 2K4EA 2PXRC 2H3IA 1L6NA 2HMXA 2JMGA 3MGEA 4U0DA 4WYMA 2PWMA 2XDEA 4U0BA 4U0EA 1UPHA 4XRQA 2XGYA 1EM9A 2H3QA 4QNBA 4NX4C 1D1DA 2NV3A 4ICAA 4PH2A 2LF4A 1M9DC 2X83A 4PH3A 2H3VA 2H3ZA 2WLVB 2KGFA 2Y4ZA 1M9EC 2EIAA 5HGNA 1AFVA 3BP9A 4U0FA 4E91A 1G03A 2M8LA 5JPAA 2WLVA 3NTEA 4PH0A 2V4XA 4LQWC 2LYAA 1AK4C 4XFXA 1TAMA 1M9YC 4J93A 2X82A 4XFYA 3H47A 4B4NA 1M9FC 3H4EA 2GOLB 1HEKA 1QRJA 4XFZA 5HGOA 1ED1A 4U0AA 1P7NA 2PWOA 4U0CA 2M8NA 2M8PA 1U7KA 4JMUA 2GOLA 2H3FA 2XGVA 1E6JP 1A6SA 1M9XC 2N1RA 3P05A 2K4HA 4XROA 2XGUA 2JPRA 1EIAA 4DGAC 5HGMA 4E92A 4HTWA 4IC9A 2GONA 5HGLA 1GWPA 2K4IA 5HGKA 1ECWA 4DGEC 4INBA 2LYBA 2X2DD 1M9CC
chains in the Genus database with same CATH superfamily
1TFRA 4BX9C 2YB4A 1X42A 5HP4A 4DQRA 3K75D 2GWSA 2PXRC 1NJWA 2W7PA 3MGEA 2GO7A 3Q8QB 2KP7A 1XO1A 5CJ7A 2M0NA 5DBAA 4U0EA 5KFHA 1SKSA 4DQIA 3RB3A 2FI1A 5CA7A 5KFDA 4F5PA 2D3DA 3F5EA 1F5SA 4IQWA 4AP9A 5KAIU 2MUTA 3HKZF 3OSPA 1Z3EB 2WAQC 4UB1A 3PW0A 5KG4A 2ZIWA 2Y9UA 4NLGA 8ICKA 3TQ1A 1S0VA 3AEVA 4PL1A 3LK9A 3OGUA 2MA1A 4UASA 1KSPA 4KLTA 3MGHA 2BGWA 4KLSA 3ETRA 4Y2JA 5J2GA 3ZDBA 1KFTA 4PH0A 4IQVA 4F4YA 4RNOA 4DL6A 5ALDA 4UATA 3Q8KA 5EE3A 2PFPA 1UCVA 2PKEA 3A0BU 4JB3A 1PVPA 4NLKA 4QIWF 1L3SA 2BCQA 3G6XA 4M0AA 3LWLA 1NK6A 2P6RA 4YXMA 2ODGA 5KT6A 3O0FA 1X6JA 1DK2A 4E0DA 1EXNA 2F1IA 4Z6EA 5J2IA 2ASLA 1T3NA 3SYZA 1D9DA 3KFUF 4FBUA 1DGJA 4CF4A 1M6YA 8ICPA 2XC9A 1ZQZA 2KHVA 5J2FA 2A3VA 2H5XA 3JPPA 4DEZA 4KLFA 5J0UA 3Q8MA 4BXOA 4G9BA 1TE2A 1OUQA 4CRXA 3NASA 4DFDA 5D49A 3AQFA 2BCRA 4INBA 4OJPA 2LYBA 3KHLA 4G3IA 4CF3A 4DF4A 3WK6A 3WK7A 4RQ6A 3TADC 4F50A 1ZD3A 3DEEA 5DB6A 4DSIA 4XUSA 4IRKA 1B0XA 1WCNA 4QWEA 1L8OA 2MRLA 2OH2A 3QU4A 2JEJA 1FFVA 1RM6C 4Z6FA 3B9JA 4EBCA 4ED1A 3ONNA 3AQEA 1L3UA 2CRXA 3NGDA 4XA5A 7ICHA 1X2IA 5DG9A 1JXEA 5C0YA 3QEAZ 3BP9A 4P4PA 5AM5A 5KFZA 3GILA 1Q8KA 3C5GA 2HHTA 1N62A 3ZDAA 4C80A 3F5AA 8ICQA 3WKBA 4P2HA 1UHUA 3L4PA 1WYGA 2KZ3A 4F5OA 3M9MB 2E1EA 5EE9A 1MSWD 3C28A 3NRWA 3RJKA 2WB1F 5IIMA 1KDHA 2YMLA 2RQ5A 9ICPA 3IG8A 2W55A 5J0RA 4C8OA 2EAOA 2RDIA 3ORYA 5AK6A 2BDPA 4O9MA 4RQ0A 2W3RA 3MBYA 1UT8A 3E58A 1WCLA 5AI9A 5CRXA 1WWUA 4YG2A 4Y2VA 3EW9A 2HCFA 2Z7JA 3ZD8A 3M9NB 1ECWA 3RJIA 3T5HA 2E8PA 1N60A 2G5IB 2F3NA 3RAQA 4YD2A 2F1JA 2BR0A 8ICCA 1F44A 3PY8A 4BGDA 4UBBA 2HOQA 4NL9A 4MEYA 4Q8FA 2A1AA 1LKYB 2PWMA 4QZIA 1QCKA 4DL7A 3F2CA 4KLUA 2LBOA 2ZIUB 4GXKA 4OJ6A 8ICHA 1JIHA 4YR3A 5KFAA 1TK0A 2JEIA 3KZIU 2HBLA 3G6VA 4QWDA 5FP0A 5IINA 4Y2RA 1XSLA 3BQ7A 4DFMA 4PHAA 2WF5A 4PGQA 2VA3A 1JROA 1UT5A 2OXOA 4K4HA 4DQPA 3RB6A 2VA8A 3NS1A 3PMNA 2A1JB 3ISBA 2W9MA 4GFJA 1Z1VA 1QTMA 5T14A 2G07A 2V4XA 1SGGA 4LQWC 5KG2A 3SAHA 4YCXA 3H47A 1KN5A 1M9FC 3FDSA 2J6UA 2IHMA 2GOLB 3NVYA 1ZD2P 4R64A 5HGOA 2F2AB 3CW2C 4IL6U 1GO3F 2V9WA 4DSJA 3V7JA 3JPNA 5KG7A 2F8LA 4KMOB 5DB7A 2ZXHA 3AU6A 1M9XC 1FFUA 4NJ8A 5KFLA 2BCVA 5ALVA 5KFKA 1WUDA 4QZBA 2ZUCA 3H4BA 5ALTA 2R8HA 3PW2A 4RZRA 4XQ8A 3D6JA 5HR6A 3BQ1A 4RNMA 4KLEA 3RR7A 2EZZA 4O0IA 3PMLA 9ICWA 5AI5A 3UXPA 1LV5A 1TAQA 1FO4A 2R8JA 5KFCA 5J0XA 3SZ2A 2HMXA 1KLNA 3H0MB 1JI7A 1BVSA 4MF2A 3GIIA 4O3MA 5EE0A 3MFHA 2ZIXB 2HVHA 5J2JA 1B4FA 8ICSA 4MFCA 5AKGA 3ZDEA 2YMMA 2PMZF 2ALZA 1S10A 4UAVA 2XIDA 5HHIA 3QU9A 4YQWA 2K60A 2X83A 3DV9A 2HBKA 3C23A 8ICFA 3QX7A 2OCEA 7ICMA 1ZQVA 1X6IA 1ZQEA 4DSEA 4U0FA 1ZXIA 3IHQB 8ICJA 5AKJA 4ECYA 3RB0A 1BPZA 5JU5A 4F72A 1JUDA 1U4BA 1ZQ1C 4O5CA 4XRHA 5JPAA 5J0TA 5DQGA 2W43A 3SV4A 3ALRA 4C4RA 1IM4A 3C1YA 5HMLA 2UVUA 1M9YC 2PXIA 1N48A 3FM9A 2C22A 3H4EA 5AKLA 2F77X 1QQ5A 1SV0A 8ICTA 2R8GA 3BZCA 4DL2A 5DKWA 2AGPA 3F2DA 4EYIB 2FMSA 4NL9C 1TK8A 5KFQA 2JEFA 1JN3A 2ZTCA 4FZMA 4O3OA 4ED8A 4NY8A 2WFAA 1A6SA 3N7SC 2KJ8A 5KAFU 4C8MA 5GTIU 2K4PA 1S9FA 1X9WA 4M9JA 3RR8A 4J9PA 1ZD4A 2FPLA 4EYHB 1U47A 2EZYA 1ZJMA 3KD3A 4RQ1A 5J2AA 3RJGA 4IQUA 4TQSA 4NV0A 4F4ZA 4QZDA 3TAPA 3NVZA 4QWBA 1YT3A 4YFKA 4I2AA 3HKZC 1B43A 5AI4A 2DKZA 2RHFA 3T79A 2XDEA 4U0BA 4QZ8A 1NZPA 3RH5A 4UARA 3ZDDA 2W9BA 5ALIA 4QZAA 5KL8B 3OJUA 4KTQA 2XGQA 3QUCA 3UM9A 2LI6A 3FC4A 3Q8PB 4DL3A 1X9MA 4PGYA 1ZQIA 2OEHA 5EOZA 2BPCA 3WKDA 4ECZA 3C2LA 3CP8A 3MR2A 4NWIA 2M8LA 1MA7A 2E3TA 4PZOA 2OWOA 4B9NA 2G5HB 3AU2A 4RU9A 4QIWC 3KOOA 3RH6A 2LYAA 4KLJA 4I29A 3MGIA 1LKYA 1ZQMA 1N63A 1RYUA 2GH1A 4M04A 1ZJNA 3GIJA 1MC8A 3QYPA 3UXNA 1DRGA 1SL1A 2VKQA 3JPSA 4O3NA 1MQ2A 3KBBA 2W8LA 4Q8EA 1KRPA 2NRXA 5BOLA 2K8AA 2XVTA 2PWOA 2D6FC 2HHSA 3UMCA 4DFKA 4BWJA 9ICXA 1PK1B 3GU3A 4M6WB 5DGBA 3P05A 2D8CA 5AKIA 1SKRA 1U49A 4Y2UA 4RQ2A 4F5NA 1ZETA 3OHBA 4YD1A 5KFGA 4TUPA 4RQ7A 1N2XA 5ALLA 1SXDA 1LVHA 3RAXA 1X66A 4I2HA 2K8BB 4KLDA 1J2NA 2C28A 2KTQA 4ECWA 4JWNA 1L7OA 2A19A 3SR6A 4K4IA 3UXOA 4WJ3B 1RYSA 8ICZA 5AM3A 2VJ5A 8ICUA 3PZPA 4U0DA 5AKZA 5HHHA 2FJ6A 1XNSA 4ELVA 4ZOHC 4QZ9A 4ED2A 4QW8A 4LJXA 4UAUA 4C8LA 5JRTA 1PVQA 1J2MA 5KT7A 4P0PA 3H7IA 4US9A 9ICTA 4PH3A 2H3VA 7ICOA 3GDXA 2KGFA 2KG5A 5AKEA 3ISDA 2EZXA 3MR3A 4FO6A 2LPEA 4NM2A 3LWMA 4HYKA 2FDRA 1S97A 1KL9A 3U26A 4C8NA 8ICRA 2WB1C 4QZCA 4QWAA 5ALYA 4J93A 2ZIXA 4I2CA 4QZHA 5KG3A 1TAUA 5KT2A 8ICAA 1QSLA 5J0SA 4UB5A 3JPOA 1QRJA 2GLEA 2ZJ5A 3SAFA 1N56A 3PX6A 1RZTA 5ALUA 2WHEA 1KFDA 8ICYA 2XICA 4DSFA 7ICSA 1RQLA 1T4GA 8ICMA 8ICGA 2KKPA 4GC6A 1DK3A 1SKWA 9ICBA 2YB1A 1SWWA 2XGUA 4DGAC 1J97A 5TZVA 2JV3A 3RH4A 4I2FA 4B9UA 5DQHA 4RPXA 3TI0A 4OJ5A 2K4IA 1ZQCA 1AQ6A 1V38A 5KFWA 3RRGA 4F2RA 1A0PA 1YZ7A 1SL2A 2KIVA 4ECRA 4B9VA 3C21A 4J9QA 5L1KA 7ICRA 3SV3A 3MR6A 4CGZA 4FS1A 2HOFA 4DQQA 4P4OA 8ICEA 4ELUA 3H8SA 1IV8A 1UPHA 5KG0A 1ZQLA 4USAA 4YN4A 2VIXA 4PPXA 1ZQKA 3N97B 1Z19A 4PH2A 2PFQA 3BQTA 3PV8A 4CF5A 2I9GA 3T5LA 4OO1J 1L3VA 4QNLA 4R66A 1L7MA 4R63A 2VJ4A 5B5EU 2G09A 3I28A 5D46A 9ICKA 1TVAA 5HGNA 1AFVA 3BQ0A 1V85A 5AKKA 2KIWA 5J2HA 1S5LU 2EQYA 2IOHA 1VDVA 3GFKB 2I1QA 1X9XA 3TARA 4MHVA 1AK4C 2B0CA 5L1LA 2JHDA 3AN1A 4Q45A 2UVWA 2CXYA 4Y2QA 3OSNA 4J9KA 2W9CA 1TKDA 1VJ5A 4QZFA 5KFIA 1Z4NA 2O6KA 3FAHA 1S0OA 5J2KA 2WF7A 2ZUDA 4U0AA 1P7NA 5J0YA 1VLBA 3UMGA 2E5SA 3WKCA 5G5HA 1D8LA 4KLMA 1E6JP 5ALGA 3WKEA 4F4XA 4DOCA 4FZNA 5AKXA 2JPRA 2K89A 4HTWA 2AGQA 3PO5A 2WF8A 4KITB 2CN1A 1ZOLA 2YX8A 4F91B 4UB2A 3L5KA 2XCPA 5AIAA 2BDUA 3HWTA 1JXLA 4AYBF 2W9BB 2XGPA 2H3IA 2AJQA 4EX7A 1UA1A 2PMZC 2JEGA 1PK1A 2LHTA 2L5YA 4O3QA 2OM6A 2NRZA 4M6WA 4XRQA 1JX4A 3QZ7A 4B9TA 1QLNA 4NX4C 9ICHA 3MR5A 3KHGA 5F9NA 2LF4A 1M9DC 2FMQA 1ZQSA 3JPRA 3IG5A 5KFMA 2YQEA 1M9EC 1X9SA 1JRPA 2EIAA 3OPXA 5J0OA 4YR0A 3UQ2A 4ED3A 4E91A 5F9LA 3ETLA 2KFNA 2IHNA 2BPFA 3WKAA 3EPIA 4CDGA 4EX6A 4B9LA 2ESEA 3AL0B 5DLGA 1D8BA 1PK3A 3L3FX 3JPTA 2HHUA 3EZ5A 1U48A 5J2BA 5J0PA 2AHOB 1U9LA 4FBTA 3NRZA 5KFJA 3RBEA 8ICVA 4TUSA 1O03A 7ICNA 2HW3A 5JUMA 1PVRA 1ZD5A 3N7PD 2NRWA 1ZQTA 2JXJA 5KFSA 1Q3UA 4RQ3A 3PO4A 5ALFA 1V9PA 2BHNA 2RRDA 7ICTA 4Y2PA 9ICJA 3B0XA 5K4LA 7ICJA 1Z00A 1EIAA 2ZG6A 4J9MA 1OXJA 4GC7A 5ALJA 4C7YA 3MDAA 4CCHA 3JPQA 4PHPA 9ICUA 4P4MA 4DOAA 1OW5A 1SB3C 1ZQPA 3QEBZ 3Q8LA 2KEYA 4IQTA 4RT2A 1IG6A 3QXGA 2X2DD 3QU5A 4I2IA 3D2SA 3H40A 1KFSA 1BGXT 2QARB 1NKCA 1DOQA 2Y0SF 4JV0A 1L5UA 3M1YA 5KG1A 5AM0A 1JMSA 4P0PB 2W04A 3E2EA 3C5FA 2YY6A 2CPRA 2VANA 3HILA 2C2EA 2KD1A 3J81j 3KHHA 4NLBA 1KQQA 1AROP 4QWCA 3SAGA 4EZ9A 1Q3VA 2RP5A 2W3SA 4YVZA 2JGAA 2KJ9A 1COOA 4KMUA 2ISPA 2Y4ZA 5AK5A 2OHFA 2KSOA 2HHQA 5CR0A 3LYSA 3V6JA 1WWVA 2NRVA 5H2FU 2JH1A 3K1RB 3T5JA 1ZQNA 3SD7A 5J2EA 1TAMA 2X82A 2QLTA 3AUOA 2AXTU 4B4NA 4JK1A 4C4SA 3N28A 1ZQOA 1BPBA 3HX0A 1BPEA 4EBEA 1NNLA 4Z6CA 1XWLA 2ISOA 2WTFA 4UQGA 3M7DA 2H3FA 2C2DA 5ALRA 3WK4A 4X5VA 3V6HA 1ZQUA 4PL2A 3FYHA 4YXJA 5KFRA 2FMPA 4K4GA 2ZTEA 2G08A 3BJYA 5EWFA 3QE9Y 4J9LA 4E92A 4IS7A 3KZXA 2Q4TA 9ICRA 9ICFA 3RTVA 7ICVA 1NJZA 4R8UA 2ASDA 1Z1BA 1Q46A 3TKAA 2J6SA 4UBCA 3DDHA 3TANA 5HNKA 5DQIA 5EWEA 4F4WA 5B66U 3QUQA 4NLNA 2IMWP 2ZTDA 2NO4A 2JZBA 4I2DA 8ICLA 5IIIA 1ZQXA 5IILA 1QH9A 2HSZA 3RB4A 2KNJA 2LM1A 3C2MA 3B0YA 3EPGA 3GZFA 2PI5A 2XI9A 2MSNA 2ATLA 2MAXA 3SEIA 1BNOA 3PX0A 2AQ0A 4ACOA 5KTQA 2H3ZA 1O08A 2IOFA 1BNPA 1T94A 5KFEA 4EEKA 2EAMA 2PFOA 2DUYA 4J9OA 2RLTA 1HUOA 2W9CB 2M9NA 4DWIA 1HUZA 2YN4A 4ECVA 8ICXA 4XFYA 4UB6U 5CEHA 5J2CA 3M9OB 3PW5A 1KTQA 1ZRNA 2BCUA 4I2BA 1S77D 5AKHA 3ED5A 4FS2A 2XY7A 1U7KA 3AMZA 5AICA 3C1ZA 3IN5A 5ALHA 4GXIA 3N4MB 4ECQA 3QZ8A 2K4HA 4XROA 1MN8A 3WK9A 3T5KA 4F92B 4FZLA 3K4GA 4UB8U 5J0WA 3WU2U 4F93B 2KZZA 1Z4OA 3NVWA 5ALQA 1S0MA 7ICQA 2HHXA 4EBDA 5AIBA 2HOIA 3VCBA 3D2NA 4F4KA 2KV2A 2KVSA 4M9HA 3EWAA 4F8RA 2K4EA 4KN7A 4RQ8A 1RPLA 4Y2SA 4F71A 1BPDA 1NK7A 1CUKA 2W54A 2W7OA 2QKQA 2BKEA 2XO7A 5KNIA 1XS9D 4ECSA 5AI0A 1WG8A 3GIKA 7ICIA 1NK4A 3MC1A 2XGYA 4M47A 4RNNA 2MU2A 2ZJAA 1N61A 1QQ6A 1ZYQA 4DL4A 3ICXA 1ZQRA 1RQNA 3NUQA 3C2KA 2G06A 3V7LA 3BZKA 5L1IA 5DG8A 1QSYA 4C4TA 4PHDA 3ZDCA 2HBMA 4JV2A 2QARA 3QNMA 5EWGA 7ICUA 1IIPA 1ZQFA 3MFIA 1SV0C 3PW7A 4U6PA 4IRDA 4C8KA 4R65A 5KFTA 1V97A 4TURA 3N7RC 4NLZA 1S8OA 5KT3A 1RYRA 4C7ZA 1H38A 5DBCA 2EAPA 1K1SA 4J9RA 5ALPA 3RJEA 2M8PA 1ZQYA 5EE1A 9ICVA 2FLNA 1Z00B 2ZJ8A 2XGVA 4Z6DA 1SZPA 2N1RA 4ECXA 3TACB 5G5GA 4CE6A 3ZD9A 3UMBA 2JR5A 3IV6A 2GONA 2UVVA 1SXEA 1S76D 2RDJA 1C20A 4AYBC 2HVIA 2LKYA 2W03A 1K5OA 3HJEA 5KT5A 4Y2TA 2KKVA 4M2YA 3HPOA 4QZEA 2KICA 5ALNA 3BDPA 3PR5B 1QSSA 2LM4A 2DKXA 3VC8A 4DF8A 4F5RA 3S6JA 5DGAA 1ZQWA 4J9SA 5KFBA 1ZQAA 4DFPA 3GV5B 5L1MA 4DLGA 4I28A 4GXJA 1D1DA 2NV3A 5CP2A 2VA2A 4B9MA 5KFOA 2KSOB 2Y1IA 1NK5A 2I6XA 1XSPA 2HHWA 2ES6A 4DO9A 3BS5B 4UB3A 5KFVA 1A77A 2DPIA 2BQ3A 4P0QB 1N5XA 4HAIA 4RQ5A 4DSKA 4C0ZA 5F3XB 1TV9A 2WLVA 1RDFA 1SZHA 4NLCA 3R9KA 2KHQA 4ZH4A 2EH9A 3GQCA 2K8CB 4CNQA 5CB1A 3THVA 2BCSA 4NM1A 3MGVA 2KVCA 4EENA 2KFZA 3ZI4A 2KE7A 2DL0A 4RUCA 4EELA 4U0CA 4UAZA 4PJ0U 5J29A 1BPYA 4KN4A 4BWMA 4DOBA 3PSPA 4MFAA 2QB0B 3BQ2A 2E8NA 1ZQDA 2HI0A 2KZMA 2QB1A 2WF9A 3UPQA 3A0HU 2DWQA 4F3OA 1B22A 4R8UB 5D4BA 7ICPA 4RPZA 2R8KA 1CEZA 2Y0SC 3LDAA 4O3SA 4Y2XA 4RPYA 3C29A 1QQ7A 3CYMA 2JZBB 5ALEA 5ALSA 4YMOA 2W9AA 9ICGA 4ELTA 8ICNA 2EDUA 3H0LB 5IIKA 1NK0A 5AI6A 9ICSA 1KEJA 4DCCA 2Y1JA 1KKXA 4KLHA 4KLIA 1EM9A 2W11A 1NK9A 1FEZA 1SIJA 2HBJA 3RFAA 3I76A 3RJHA 1CI4A 2ZUBA 3V6KA 4MF8A 4ICAA 4NXZA 4B9SA 4DQSA 4ECUA 4FE3A 1RG6A 4JV1A 1IXRA 2BQRA 5DBBA 3E0FA 4YMMA 3F53A 3IP4B 2BPGA 1D9FA 5C5JA 3Q8RB 3OJSA 3F2BA 4US8A 7ICFA 2F76X 2DFLA 5ALWA 2WAQF 4PHEA 2AGOA 2PI4A 3OHAA 3NTEA 5KT4A 5IIOA 1N5WA 2FPMA 1L7NA 4DS5A 4KX3A 1LB2B 5CWRA 2AQ4A 3M6KA 2C2RA 1U45A 4DLEA 4KLOA 5KFYA 1HEKA 4YMNA 5J8YA 3IDWA 3EUB2 4RQ4A 4JMUA 3IRUA 2PFNA 1K1QA 2V4QA 1F0MA 4ED7A 5ALZA 3H8JA 1C7YA 4IC9A 1RXWA 3KHRA 3AM9A 8ICWA 5HGLA 5KL1B 2AH5A 2FPKA 2ZIVA 2IA6A 1SWVA 2FE9A 5A0LA 2HDOA 1M9CC 4PH5A 1URJA 4UAWA 1ZQJA 4I27A 2R8IA 5DDMA 4M9GA 3SI8A 1ZQHA 3PW4A 3GV8B 1ZRMA 1HJPA 8ICOA 4F5QA 9ICQA 3G6YA 1SV4A 3SQIA 1TK5A 2EANA 5DB8A 2UVRA 5KG5A 4IRCA 3D2QA 3PSTA 5KG6A 2XY6A 7ICEA 1UA0A 9ICMA 9ICIA 4FFDA 1ZQQA 2BZFA 4OCZA 3HW8A 1T8EA 1A76A 3Q8SB 3UQ0A 3M6ZA 4O3PA 1T3QA 4QZGA 2JRZA 3PR4A 3SMVA 4I2JA 3CNHA 5BPCA 3OTQA 2LMRA 3QU7A 1Y88A 3RJJA 1PUZA 2DPJA 2B6GA 3PNCA 3WK5A 4PZNA 4MEXA 4OJLA 1ED1A 1NJYA 2R18A 3PVXA 3TFRA 2P66A 1XO0A 2YMPA 3MABA 4M9NA 4YP3A 3BS5A 2IOFK 4QJFB 4O5EA 2I5HA 4KLLA 2V4RA 3GIMA 4P0QA 4B6JA 5E79U 5HGMA 3MDCA 5J2DA 2E8MA 3RF9A 2MUTB 1RXVA 1NOMA 1GWPA 2ZIWB 3V7KA 5HGKA 1JALA 1XC9A 4DGEC 2FLPA 9ICOA 2DF4B 1XSNA 3M8RA 2DQNB 1YZ6A 3H0RB 5AM1A 4JUZA 3WK8A 4MFFA 5ALMA 5DLFA 1L8LA 1KBUA 1L6NA 4EZ6A 3I1YA 2JMGA 5KFUA 1ZQGA 4KX5A 2QB0A 1NK8A 4OD0A 4LVSA 1NKBA 4I2GA 5J8YC 3KKAA 3GV7B 4QNBA 3HT3A 4BDPA 1CRXA 5KFFA 4ED0A 3TFSA 4YR2A 3EYZA 5L9XA 9ICEA 2F8KA 1T7PA 3HRDD 2KMDA 4ED6A 2WLVB 2BQUA 3SENA 1G03A 1D8YA 5HR7A 7ICKA 2XY5A 4DFJA 3V72A 2IBKA 4Q44A 9ICNA 3M8SA 5JTIA 4QW9A 4BXOB 1L7PA 4F2SA 2NRTA 4M9LA 3LVVA 4UAYA 3RRHA 3H4DA 5AKYA 3PSIA 1S0NA 3QUBA 5TISU 2Y9TA 4BJQA 4RUAA 3H8WA 4Q43A 8ICBA 1PZNA 1L3TA 2J6TA 2M8NA 5IIJA 4RQMA 4A8EA 8ICIA 1DGSA 5ALXA 2P6UA 5ALOA 4KLQA 5L1JA 2F1HA 3H8MA 4TUQA 2DBYA 2DGZA 4UB4A 1MQ3A 4GIBA 2OYYA 1KW4A 2HHVA 2XCAA 9ICCA 3LVWA 2E8OA 2P35A 3NTUA 4Y2YA 1HIWA 4RT3A 2W8KA 5ALKA 4IR9A 2WF6A 2NO5A 4RQNA 5DG7A 4DS4A 5DB9A 4WYMA 4OJOA 3PSFA 5AK4A 5AI8A 1NZBA 4JWMA 5KFPA 3KTQA 2YTUA 2B21A 3CRXA 4BUGA 3IM1A 3K1ZA 2H3QA 3BS7A 3NVVA 2ZIUA 9ICAA 4PGXA 1NKEA 3RJFA 4IR1A 1XU4A 2KK0A 7ICLA 5DDYA 5CHGA 3TADA 4UW9A 3HP6A 9ICLA 2F44A 2KJ5A 4KLGA 5AK3A 4XFXA 2JH7A 2A1JA 7ICGA 1SL0A 1COKA 4U7CA 1P7DA 3ISCA 4LZDA 5AHXA 4XFZA 2ZXIA 4O5KA 1BPXA 3QUTA 1NI3A 5GTHU 5AM4A 3RBDA 4GLXA 2GOLA 5KFXA 5KFNA 2ASJA 4O3RA 4DSLA 2NYVA 2AU0A 1UQVA 1ZQBA 3QU2A 1X40A 4I2EA 2ZIVB 2Q0ZX 2FLLA 3PX4A 2E1FA 4DL5A 4J03A 2YMQA 3KKAC 4EEYA 5AM2A 1DXSA 5HMMA 3T3FA 4J9NA 4TQRA 1NJXA 4LZGA 2G0AA 4ECTA 5J0QA 5BOMA 2KN7A 1FIQA 2LYHA 3TAQA 2KOBA
chains in the Genus database with same CATH topology
4NV0A 4BX9C 2YB4A 3H0LB 2PXRC 1YT3A 2Y0SF 3HKZC 2W7PA 3MGEA 2RHFA 3T79A 2XDEA 4U0BA 4P0PB 2W04A 2M0NA 4U0EA 2CPRA 1EM9A 2KD1A 5KL8B 3F5EA 2HBJA 4NLBA 3RFAA 3HKZF 3SAGA 4ICAA 2WAQC 1Q3VA 2RP5A 2ZIWA 4FE3A 3E0FA 2JGAA 2KJ9A 4PL1A 2Y4ZA 3F53A 3IP4B 3CP8A 2MA1A 3F2BA 4NWIA 2F76X 2M8LA 3LYSA 1MA7A 2WAQF 2JH1A 2G5HB 4QIWC 3NTEA 4PH0A 2LYAA 4KX3A 1TAMA 2X82A 3M6KA 2GH1A 4B4NA 1DRGA 1PVPA 2VKQA 4QIWF 1HEKA 2K8AA 2XVTA 2PWOA 2D6FC 4JMUA 3M7DA 2H3FA 3O0FA 4PL2A 3GU3A 3KFUF 3P05A 2G08A 2KHVA 2A3VA 4E92A 4IC9A 3KZXA 2Q4TA 5HGLA 5KL1B 1OUQA 4CRXA 2ZIVA 3AQFA 2K8BB 4INBA 4OJPA 5A0LA 2LYBA 1M9CC 1URJA 1Z1BA 4WJ3B 3DEEA 3SQIA 2VJ5A 3PZPA 4U0DA 1XNSA 2MRLA 3D2QA 2OH2A 3PSTA 2KNJA 3GZFA 2XI9A 1PVQA 3ONNA 3AQEA 2CRXA 4P0PA 4ACOA 4PH3A 2H3VA 2H3ZA 2KGFA 5C0YA 1T94A 3BP9A 3M6ZA 3F5AA 3SMVA 2WB1C 4J93A 4XFYA 2ZIXA 2E1EA 3C28A 1QRJA 4OJLA 1ED1A 3SAFA 3NRWA 2R18A 2WB1F 1XO0A 1U7KA 3IG8A 2XICA 4QJFB 3IN5A 2KKPA 4P0QA 2K4HA 4XROA 2XGUA 2YB1A 4DGAC 5CRXA 5HGMA 4FZLA 3RF9A 4OJ5A 2K4IA 2Z7JA 1GWPA 2ZIWB 1A0PA 5HGKA 1ECWA 4DGEC 2HOIA 3VCBA 3D2NA 2DF4B 2G5IB 2KV2A 2DQNB 1F44A 3H0RB 2K4EA 2HOQA 1KBUA 4CGZA 1L6NA 2JMGA 2W7OA 2HOFA 4KX5A 2PWMA 3F2CA 2LBOA 2ZIUB 1UPHA 4OJ6A 2XGYA 2VIXA 2HBLA 4QNBA 1Z19A 1CRXA 3ICXA 4PH2A 3NUQA 2G06A 4OO1J 4QNLA 2VJ4A 2WLVB 2G09A 2OXOA 5HGNA 1AFVA 2HBMA 1G03A 5HR7A 4GFJA 1IIPA 2KIWA 5T14A 2G07A 2V4XA 4LQWC 1AK4C 4U6PA 2JHDA 3LVVA 3SAHA 3PSIA 3H47A 1M9FC 3N7RC 2GOLB 4BJQA 5HGOA 4U0AA 2F2AB 1P7NA 2M8NA 2M8PA 1GO3F 2E5SA 4A8EA 2XGVA 2F8LA 4KMOB 1E6JP 2ZXHA 1M9XC 2N1RA 4FZNA 2JPRA 2K89A 4HTWA 1WUDA 2GONA 2DGZA 4AYBC 2CN1A 2LKYA 2W03A 5HR6A 2OYYA 2KKVA 2YX8A 3LVWA 2BDUA 1HIWA 2KICA 4AYBF 2H3IA 2HMXA 2PMZC 3H0MB 3VC8A 2LHTA 4WYMA 4OJOA 3PSFA 4O3MA 1NZBA 2OM6A 2ZIXB 4XRQA 3CRXA 4BUGA 3K1ZA 2H3QA 4NX4C 1D1DA 2PMZF 2NV3A 2LF4A 1M9DC 2ZIUA 2XIDA 2X83A 2HBKA 3IG5A 1M9EC 2EIAA 3OPXA 4U0FA 4E91A 4P0QB 1ZQ1C 4C0ZA 5JPAA 2WLVA 1SZHA 3ALRA 4CDGA 4NLCA 2KHQA 3AL0B 2KJ5A 4XFXA 1D8BA 1M9YC 2JH7A 3L3FX 2K8CB 3H4EA 4U7CA 1P7DA 2F77X 3MGVA 2KVCA 4XFZA 2ZXIA 3F2DA 4U0CA 1PVRA 3N7PD 2GOLA 3PSPA 1Q3UA 4FZMA 1A6SA 2ZIVB 3N7SC 2KJ8A 2RRDA 2E1FA 1EIAA 2ZG6A 2Y0SC 2KEYA 2G0AA 3C29A 2X2DD 3CYMA 2KOBA 3D2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HIW A;  2K4E A;  2PXR C;  2H3I A;  1L6N A;  2HMX A;  2JMG A;  3MGE A;  4U0D A;  4WYM A;  2PWM A;  2XDE A;  4U0B A;  4U0E A;  1UPH A;  4XRQ A;  2XGY A;  1EM9 A;  2H3Q A;  4QNB A;  4NX4 C;  1D1D A;  2NV3 A;  4ICA A;  4PH2 A;  2LF4 A;  1M9D C;  2X83 A;  4PH3 A;  2H3V A;  2H3Z A;  2WLV B;  2KGF A;  2Y4Z A;  1M9E C;  2EIA A;  5HGN A;  1AFV A;  3BP9 A;  4U0F A;  4E91 A;  1G03 A;  2M8L A;  5JPA A;  2WLV A;  3NTE A;  4PH0 A;  2V4X A;  4LQW C;  2LYA A;  1AK4 C;  4XFX A;  1TAM A;  1M9Y C;  4J93 A;  2X82 A;  4XFY A;  3H47 A;  4B4N A;  1M9F C;  3H4E A;  2GOL B;  1HEK A;  1QRJ A;  4XFZ A;  5HGO A;  1ED1 A;  4U0A A;  1P7N A;  2PWO A;  4U0C A;  2M8N A;  2M8P A;  1U7K A;  4JMU A;  2GOL A;  2H3F A;  2XGV A;  1E6J P;  1A6S A;  1M9X C;  2N1R A;  3P05 A;  2K4H A;  4XRO A;  2XGU A;  2JPR A;  1EIA A;  4DGA C;  5HGM A;  4E92 A;  4HTW A;  4IC9 A;  2GON A;  5HGL A;  1GWP A;  2K4I A;  5HGK A;  1ECW A;  4DGE C;  4INB A;  2LYB A;  2X2D D;  1M9C C; 
#chains in the Genus database with same CATH topology
 1TFR A;  4BX9 C;  2YB4 A;  1X42 A;  5HP4 A;  4DQR A;  3K75 D;  2GWS A;  2PXR C;  1NJW A;  2W7P A;  3MGE A;  2GO7 A;  3Q8Q B;  2KP7 A;  1XO1 A;  5CJ7 A;  2M0N A;  5DBA A;  4U0E A;  5KFH A;  1SKS A;  4DQI A;  3RB3 A;  2FI1 A;  5CA7 A;  5KFD A;  4F5P A;  2D3D A;  3F5E A;  1F5S A;  4IQW A;  4AP9 A;  5KAI U;  2MUT A;  3HKZ F;  3OSP A;  1Z3E B;  2WAQ C;  4UB1 A;  3PW0 A;  5KG4 A;  2ZIW A;  2Y9U A;  4NLG A;  8ICK A;  3TQ1 A;  1S0V A;  3AEV A;  4PL1 A;  3LK9 A;  3OGU A;  2MA1 A;  4UAS A;  1KSP A;  4KLT A;  3MGH A;  2BGW A;  4KLS A;  3ETR A;  4Y2J A;  5J2G A;  3ZDB A;  1KFT A;  4PH0 A;  4IQV A;  4F4Y A;  4RNO A;  4DL6 A;  5ALD A;  4UAT A;  3Q8K A;  5EE3 A;  2PFP A;  1UCV A;  2PKE A;  3A0B U;  4JB3 A;  1PVP A;  4NLK A;  4QIW F;  1L3S A;  2BCQ A;  3G6X A;  4M0A A;  3LWL A;  1NK6 A;  2P6R A;  4YXM A;  2ODG A;  5KT6 A;  3O0F A;  1X6J A;  1DK2 A;  4E0D A;  1EXN A;  2F1I A;  4Z6E A;  5J2I A;  2ASL A;  1T3N A;  3SYZ A;  1D9D A;  3KFU F;  4FBU A;  1DGJ A;  4CF4 A;  1M6Y A;  8ICP A;  2XC9 A;  1ZQZ A;  2KHV A;  5J2F A;  2A3V A;  2H5X A;  3JPP A;  4DEZ A;  4KLF A;  5J0U A;  3Q8M A;  4BXO A;  4G9B A;  1TE2 A;  1OUQ A;  4CRX A;  3NAS A;  4DFD A;  5D49 A;  3AQF A;  2BCR A;  4INB A;  4OJP A;  2LYB A;  3KHL A;  4G3I A;  4CF3 A;  4DF4 A;  3WK6 A;  3WK7 A;  4RQ6 A;  3TAD C;  4F50 A;  1ZD3 A;  3DEE A;  5DB6 A;  4DSI A;  4XUS A;  4IRK A;  1B0X A;  1WCN A;  4QWE A;  1L8O A;  2MRL A;  2OH2 A;  3QU4 A;  2JEJ A;  1FFV A;  1RM6 C;  4Z6F A;  3B9J A;  4EBC A;  4ED1 A;  3ONN A;  3AQE A;  1L3U A;  2CRX A;  3NGD A;  4XA5 A;  7ICH A;  1X2I A;  5DG9 A;  1JXE A;  5C0Y A;  3QEA Z;  3BP9 A;  4P4P A;  5AM5 A;  5KFZ A;  3GIL A;  1Q8K A;  3C5G A;  2HHT A;  1N62 A;  3ZDA A;  4C80 A;  3F5A A;  8ICQ A;  3WKB A;  4P2H A;  1UHU A;  3L4P A;  1WYG A;  2KZ3 A;  4F5O A;  3M9M B;  2E1E A;  5EE9 A;  1MSW D;  3C28 A;  3NRW A;  3RJK A;  2WB1 F;  5IIM A;  1KDH A;  2YML A;  2RQ5 A;  9ICP A;  3IG8 A;  2W55 A;  5J0R A;  4C8O A;  2EAO A;  2RDI A;  3ORY A;  5AK6 A;  2BDP A;  4O9M A;  4RQ0 A;  2W3R A;  3MBY A;  1UT8 A;  3E58 A;  1WCL A;  5AI9 A;  5CRX A;  1WWU A;  4YG2 A;  4Y2V A;  3EW9 A;  2HCF A;  2Z7J A;  3ZD8 A;  3M9N B;  1ECW A;  3RJI A;  3T5H A;  2E8P A;  1N60 A;  2G5I B;  2F3N A;  3RAQ A;  4YD2 A;  2F1J A;  2BR0 A;  8ICC A;  1F44 A;  3PY8 A;  4BGD A;  4UBB A;  2HOQ A;  4NL9 A;  4MEY A;  4Q8F A;  2A1A A;  1LKY B;  2PWM A;  4QZI A;  1QCK A;  4DL7 A;  3F2C A;  4KLU A;  2LBO A;  2ZIU B;  4GXK A;  4OJ6 A;  8ICH A;  1JIH A;  4YR3 A;  5KFA A;  1TK0 A;  2JEI A;  3KZI U;  2HBL A;  3G6V A;  4QWD A;  5FP0 A;  5IIN A;  4Y2R A;  1XSL A;  3BQ7 A;  4DFM A;  4PHA A;  2WF5 A;  4PGQ A;  2VA3 A;  1JRO A;  1UT5 A;  2OXO A;  4K4H A;  4DQP A;  3RB6 A;  2VA8 A;  3NS1 A;  3PMN A;  2A1J B;  3ISB A;  2W9M A;  4GFJ A;  1Z1V A;  1QTM A;  5T14 A;  2G07 A;  2V4X A;  1SGG A;  4LQW C;  5KG2 A;  3SAH A;  4YCX A;  3H47 A;  1KN5 A;  1M9F C;  3FDS A;  2J6U A;  2IHM A;  2GOL B;  3NVY A;  1ZD2 P;  4R64 A;  5HGO A;  2F2A B;  3CW2 C;  4IL6 U;  1GO3 F;  2V9W A;  4DSJ A;  3V7J A;  3JPN A;  5KG7 A;  2F8L A;  4KMO B;  5DB7 A;  2ZXH A;  3AU6 A;  1M9X C;  1FFU A;  4NJ8 A;  5KFL A;  2BCV A;  5ALV A;  5KFK A;  1WUD A;  4QZB A;  2ZUC A;  3H4B A;  5ALT A;  2R8H A;  3PW2 A;  4RZR A;  4XQ8 A;  3D6J A;  5HR6 A;  3BQ1 A;  4RNM A;  4KLE A;  3RR7 A;  2EZZ A;  4O0I A;  3PML A;  9ICW A;  5AI5 A;  3UXP A;  1LV5 A;  1TAQ A;  1FO4 A;  2R8J A;  5KFC A;  5J0X A;  3SZ2 A;  2HMX A;  1KLN A;  3H0M B;  1JI7 A;  1BVS A;  4MF2 A;  3GII A;  4O3M A;  5EE0 A;  3MFH A;  2ZIX B;  2HVH A;  5J2J A;  1B4F A;  8ICS A;  4MFC A;  5AKG A;  3ZDE A;  2YMM A;  2PMZ F;  2ALZ A;  1S10 A;  4UAV A;  2XID A;  5HHI A;  3QU9 A;  4YQW A;  2K60 A;  2X83 A;  3DV9 A;  2HBK A;  3C23 A;  8ICF A;  3QX7 A;  2OCE A;  7ICM A;  1ZQV A;  1X6I A;  1ZQE A;  4DSE A;  4U0F A;  1ZXI A;  3IHQ B;  8ICJ A;  5AKJ A;  4ECY A;  3RB0 A;  1BPZ A;  5JU5 A;  4F72 A;  1JUD A;  1U4B A;  1ZQ1 C;  4O5C A;  4XRH A;  5JPA A;  5J0T A;  5DQG A;  2W43 A;  3SV4 A;  3ALR A;  4C4R A;  1IM4 A;  3C1Y A;  5HML A;  2UVU A;  1M9Y C;  2PXI A;  1N48 A;  3FM9 A;  2C22 A;  3H4E A;  5AKL A;  2F77 X;  1QQ5 A;  1SV0 A;  8ICT A;  2R8G A;  3BZC A;  4DL2 A;  5DKW A;  2AGP A;  3F2D A;  4EYI B;  2FMS A;  4NL9 C;  1TK8 A;  5KFQ A;  2JEF A;  1JN3 A;  2ZTC A;  4FZM A;  4O3O A;  4ED8 A;  4NY8 A;  2WFA A;  1A6S A;  3N7S C;  2KJ8 A;  5KAF U;  4C8M A;  5GTI U;  2K4P A;  1S9F A;  1X9W A;  4M9J A;  3RR8 A;  4J9P A;  1ZD4 A;  2FPL A;  4EYH B;  1U47 A;  2EZY A;  1ZJM A;  3KD3 A;  4RQ1 A;  5J2A A;  3RJG A;  4IQU A;  4TQS A;  4NV0 A;  4F4Z A;  4QZD A;  3TAP A;  3NVZ A;  4QWB A;  1YT3 A;  4YFK A;  4I2A A;  3HKZ C;  1B43 A;  5AI4 A;  2DKZ A;  2RHF A;  3T79 A;  2XDE A;  4U0B A;  4QZ8 A;  1NZP A;  3RH5 A;  4UAR A;  3ZDD A;  2W9B A;  5ALI A;  4QZA A;  5KL8 B;  3OJU A;  4KTQ A;  2XGQ A;  3QUC A;  3UM9 A;  2LI6 A;  3FC4 A;  3Q8P B;  4DL3 A;  1X9M A;  4PGY A;  1ZQI A;  2OEH A;  5EOZ A;  2BPC A;  3WKD A;  4ECZ A;  3C2L A;  3CP8 A;  3MR2 A;  4NWI A;  2M8L A;  1MA7 A;  2E3T A;  4PZO A;  2OWO A;  4B9N A;  2G5H B;  3AU2 A;  4RU9 A;  4QIW C;  3KOO A;  3RH6 A;  2LYA A;  4KLJ A;  4I29 A;  3MGI A;  1LKY A;  1ZQM A;  1N63 A;  1RYU A;  2GH1 A;  4M04 A;  1ZJN A;  3GIJ A;  1MC8 A;  3QYP A;  3UXN A;  1DRG A;  1SL1 A;  2VKQ A;  3JPS A;  4O3N A;  1MQ2 A;  3KBB A;  2W8L A;  4Q8E A;  1KRP A;  2NRX A;  5BOL A;  2K8A A;  2XVT A;  2PWO A;  2D6F C;  2HHS A;  3UMC A;  4DFK A;  4BWJ A;  9ICX A;  1PK1 B;  3GU3 A;  4M6W B;  5DGB A;  3P05 A;  2D8C A;  5AKI A;  1SKR A;  1U49 A;  4Y2U A;  4RQ2 A;  4F5N A;  1ZET A;  3OHB A;  4YD1 A;  5KFG A;  4TUP A;  4RQ7 A;  1N2X A;  5ALL A;  1SXD A;  1LVH A;  3RAX A;  1X66 A;  4I2H A;  2K8B B;  4KLD A;  1J2N A;  2C28 A;  2KTQ A;  4ECW A;  4JWN A;  1L7O A;  2A19 A;  3SR6 A;  4K4I A;  3UXO A;  4WJ3 B;  1RYS A;  8ICZ A;  5AM3 A;  2VJ5 A;  8ICU A;  3PZP A;  4U0D A;  5AKZ A;  5HHH A;  2FJ6 A;  1XNS A;  4ELV A;  4ZOH C;  4QZ9 A;  4ED2 A;  4QW8 A;  4LJX A;  4UAU A;  4C8L A;  5JRT A;  1PVQ A;  1J2M A;  5KT7 A;  4P0P A;  3H7I A;  4US9 A;  9ICT A;  4PH3 A;  2H3V A;  7ICO A;  3GDX A;  2KGF A;  2KG5 A;  5AKE A;  3ISD A;  2EZX A;  3MR3 A;  4FO6 A;  2LPE A;  4NM2 A;  3LWM A;  4HYK A;  2FDR A;  1S97 A;  1KL9 A;  3U26 A;  4C8N A;  8ICR A;  2WB1 C;  4QZC A;  4QWA A;  5ALY A;  4J93 A;  2ZIX A;  4I2C A;  4QZH A;  5KG3 A;  1TAU A;  5KT2 A;  8ICA A;  1QSL A;  5J0S A;  4UB5 A;  3JPO A;  1QRJ A;  2GLE A;  2ZJ5 A;  3SAF A;  1N56 A;  3PX6 A;  1RZT A;  5ALU A;  2WHE A;  1KFD A;  8ICY A;  2XIC A;  4DSF A;  7ICS A;  1RQL A;  1T4G A;  8ICM A;  8ICG A;  2KKP A;  4GC6 A;  1DK3 A;  1SKW A;  9ICB A;  2YB1 A;  1SWW A;  2XGU A;  4DGA C;  1J97 A;  5TZV A;  2JV3 A;  3RH4 A;  4I2F A;  4B9U A;  5DQH A;  4RPX A;  3TI0 A;  4OJ5 A;  2K4I A;  1ZQC A;  1AQ6 A;  1V38 A;  5KFW A;  3RRG A;  4F2R A;  1A0P A;  1YZ7 A;  1SL2 A;  2KIV A;  4ECR A;  4B9V A;  3C21 A;  4J9Q A;  5L1K A;  7ICR A;  3SV3 A;  3MR6 A;  4CGZ A;  4FS1 A;  2HOF A;  4DQQ A;  4P4O A;  8ICE A;  4ELU A;  3H8S A;  1IV8 A;  1UPH A;  5KG0 A;  1ZQL A;  4USA A;  4YN4 A;  2VIX A;  4PPX A;  1ZQK A;  3N97 B;  1Z19 A;  4PH2 A;  2PFQ A;  3BQT A;  3PV8 A;  4CF5 A;  2I9G A;  3T5L A;  4OO1 J;  1L3V A;  4QNL A;  4R66 A;  1L7M A;  4R63 A;  2VJ4 A;  5B5E U;  2G09 A;  3I28 A;  5D46 A;  9ICK A;  1TVA A;  5HGN A;  1AFV A;  3BQ0 A;  1V85 A;  5AKK A;  2KIW A;  5J2H A;  1S5L U;  2EQY A;  2IOH A;  1VDV A;  3GFK B;  2I1Q A;  1X9X A;  3TAR A;  4MHV A;  1AK4 C;  2B0C A;  5L1L A;  2JHD A;  3AN1 A;  4Q45 A;  2UVW A;  2CXY A;  4Y2Q A;  3OSN A;  4J9K A;  2W9C A;  1TKD A;  1VJ5 A;  4QZF A;  5KFI A;  1Z4N A;  2O6K A;  3FAH A;  1S0O A;  5J2K A;  2WF7 A;  2ZUD A;  4U0A A;  1P7N A;  5J0Y A;  1VLB A;  3UMG A;  2E5S A;  3WKC A;  5G5H A;  1D8L A;  4KLM A;  1E6J P;  5ALG A;  3WKE A;  4F4X A;  4DOC A;  4FZN A;  5AKX A;  2JPR A;  2K89 A;  4HTW A;  2AGQ A;  3PO5 A;  2WF8 A;  4KIT B;  2CN1 A;  1ZOL A;  2YX8 A;  4F91 B;  4UB2 A;  3L5K A;  2XCP A;  5AIA A;  2BDU A;  3HWT A;  1JXL A;  4AYB F;  2W9B B;  2XGP A;  2H3I A;  2AJQ A;  4EX7 A;  1UA1 A;  2PMZ C;  2JEG A;  1PK1 A;  2LHT A;  2L5Y A;  4O3Q A;  2OM6 A;  2NRZ A;  4M6W A;  4XRQ A;  1JX4 A;  3QZ7 A;  4B9T A;  1QLN A;  4NX4 C;  9ICH A;  3MR5 A;  3KHG A;  5F9N A;  2LF4 A;  1M9D C;  2FMQ A;  1ZQS A;  3JPR A;  3IG5 A;  5KFM A;  2YQE A;  1M9E C;  1X9S A;  1JRP A;  2EIA A;  3OPX A;  5J0O A;  4YR0 A;  3UQ2 A;  4ED3 A;  4E91 A;  5F9L A;  3ETL A;  2KFN A;  2IHN A;  2BPF A;  3WKA A;  3EPI A;  4CDG A;  4EX6 A;  4B9L A;  2ESE A;  3AL0 B;  5DLG A;  1D8B A;  1PK3 A;  3L3F X;  3JPT A;  2HHU A;  3EZ5 A;  1U48 A;  5J2B A;  5J0P A;  2AHO B;  1U9L A;  4FBT A;  3NRZ A;  5KFJ A;  3RBE A;  8ICV A;  4TUS A;  1O03 A;  7ICN A;  2HW3 A;  5JUM A;  1PVR A;  1ZD5 A;  3N7P D;  2NRW A;  1ZQT A;  2JXJ A;  5KFS A;  1Q3U A;  4RQ3 A;  3PO4 A;  5ALF A;  1V9P A;  2BHN A;  2RRD A;  7ICT A;  4Y2P A;  9ICJ A;  3B0X A;  5K4L A;  7ICJ A;  1Z00 A;  1EIA A;  2ZG6 A;  4J9M A;  1OXJ A;  4GC7 A;  5ALJ A;  4C7Y A;  3MDA A;  4CCH A;  3JPQ A;  4PHP A;  9ICU A;  4P4M A;  4DOA A;  1OW5 A;  1SB3 C;  1ZQP A;  3QEB Z;  3Q8L A;  2KEY A;  4IQT A;  4RT2 A;  1IG6 A;  3QXG A;  2X2D D;  3QU5 A;  4I2I A;  3D2S A;  3H40 A;  1KFS A;  1BGX T;  2QAR B;  1NKC A;  1DOQ A;  2Y0S F;  4JV0 A;  1L5U A;  3M1Y A;  5KG1 A;  5AM0 A;  1JMS A;  4P0P B;  2W04 A;  3E2E A;  3C5F A;  2YY6 A;  2CPR A;  2VAN A;  3HIL A;  2C2E A;  2KD1 A;  3J81 j;  3KHH A;  4NLB A;  1KQQ A;  1ARO P;  4QWC A;  3SAG A;  4EZ9 A;  1Q3V A;  2RP5 A;  2W3S A;  4YVZ A;  2JGA A;  2KJ9 A;  1COO A;  4KMU A;  2ISP A;  2Y4Z A;  5AK5 A;  2OHF A;  2KSO A;  2HHQ A;  5CR0 A;  3LYS A;  3V6J A;  1WWV A;  2NRV A;  5H2F U;  2JH1 A;  3K1R B;  3T5J A;  1ZQN A;  3SD7 A;  5J2E A;  1TAM A;  2X82 A;  2QLT A;  3AUO A;  2AXT U;  4B4N A;  4JK1 A;  4C4S A;  3N28 A;  1ZQO A;  1BPB A;  3HX0 A;  1BPE A;  4EBE A;  1NNL A;  4Z6C A;  1XWL A;  2ISO A;  2WTF A;  4UQG A;  3M7D A;  2H3F A;  2C2D A;  5ALR A;  3WK4 A;  4X5V A;  3V6H A;  1ZQU A;  4PL2 A;  3FYH A;  4YXJ A;  5KFR A;  2FMP A;  4K4G A;  2ZTE A;  2G08 A;  3BJY A;  5EWF A;  3QE9 Y;  4J9L A;  4E92 A;  4IS7 A;  3KZX A;  2Q4T A;  9ICR A;  9ICF A;  3RTV A;  7ICV A;  1NJZ A;  4R8U A;  2ASD A;  1Z1B A;  1Q46 A;  3TKA A;  2J6S A;  4UBC A;  3DDH A;  3TAN A;  5HNK A;  5DQI A;  5EWE A;  4F4W A;  5B66 U;  3QUQ A;  4NLN A;  2IMW P;  2ZTD A;  2NO4 A;  2JZB A;  4I2D A;  8ICL A;  5III A;  1ZQX A;  5IIL A;  1QH9 A;  2HSZ A;  3RB4 A;  2KNJ A;  2LM1 A;  3C2M A;  3B0Y A;  3EPG A;  3GZF A;  2PI5 A;  2XI9 A;  2MSN A;  2ATL A;  2MAX A;  3SEI A;  1BNO A;  3PX0 A;  2AQ0 A;  4ACO A;  5KTQ A;  2H3Z A;  1O08 A;  2IOF A;  1BNP A;  1T94 A;  5KFE A;  4EEK A;  2EAM A;  2PFO A;  2DUY A;  4J9O A;  2RLT A;  1HUO A;  2W9C B;  2M9N A;  4DWI A;  1HUZ A;  2YN4 A;  4ECV A;  8ICX A;  4XFY A;  4UB6 U;  5CEH A;  5J2C A;  3M9O B;  3PW5 A;  1KTQ A;  1ZRN A;  2BCU A;  4I2B A;  1S77 D;  5AKH A;  3ED5 A;  4FS2 A;  2XY7 A;  1U7K A;  3AMZ A;  5AIC A;  3C1Z A;  3IN5 A;  5ALH A;  4GXI A;  3N4M B;  4ECQ A;  3QZ8 A;  2K4H A;  4XRO A;  1MN8 A;  3WK9 A;  3T5K A;  4F92 B;  4FZL A;  3K4G A;  4UB8 U;  5J0W A;  3WU2 U;  4F93 B;  2KZZ A;  1Z4O A;  3NVW A;  5ALQ A;  1S0M A;  7ICQ A;  2HHX A;  4EBD A;  5AIB A;  2HOI A;  3VCB A;  3D2N A;  4F4K A;  2KV2 A;  2KVS A;  4M9H A;  3EWA A;  4F8R A;  2K4E A;  4KN7 A;  4RQ8 A;  1RPL A;  4Y2S A;  4F71 A;  1BPD A;  1NK7 A;  1CUK A;  2W54 A;  2W7O A;  2QKQ A;  2BKE A;  2XO7 A;  5KNI A;  1XS9 D;  4ECS A;  5AI0 A;  1WG8 A;  3GIK A;  7ICI A;  1NK4 A;  3MC1 A;  2XGY A;  4M47 A;  4RNN A;  2MU2 A;  2ZJA A;  1N61 A;  1QQ6 A;  1ZYQ A;  4DL4 A;  3ICX A;  1ZQR A;  1RQN A;  3NUQ A;  3C2K A;  2G06 A;  3V7L A;  3BZK A;  5L1I A;  5DG8 A;  1QSY A;  4C4T A;  4PHD A;  3ZDC A;  2HBM A;  4JV2 A;  2QAR A;  3QNM A;  5EWG A;  7ICU A;  1IIP A;  1ZQF A;  3MFI A;  1SV0 C;  3PW7 A;  4U6P A;  4IRD A;  4C8K A;  4R65 A;  5KFT A;  1V97 A;  4TUR A;  3N7R C;  4NLZ A;  1S8O A;  5KT3 A;  1RYR A;  4C7Z A;  1H38 A;  5DBC A;  2EAP A;  1K1S A;  4J9R A;  5ALP A;  3RJE A;  2M8P A;  1ZQY A;  5EE1 A;  9ICV A;  2FLN A;  1Z00 B;  2ZJ8 A;  2XGV A;  4Z6D A;  1SZP A;  2N1R A;  4ECX A;  3TAC B;  5G5G A;  4CE6 A;  3ZD9 A;  3UMB A;  2JR5 A;  3IV6 A;  2GON A;  2UVV A;  1SXE A;  1S76 D;  2RDJ A;  1C20 A;  4AYB C;  2HVI A;  2LKY A;  2W03 A;  1K5O A;  3HJE A;  5KT5 A;  4Y2T A;  2KKV A;  4M2Y A;  3HPO A;  4QZE A;  2KIC A;  5ALN A;  3BDP A;  3PR5 B;  1QSS A;  2LM4 A;  2DKX A;  3VC8 A;  4DF8 A;  4F5R A;  3S6J A;  5DGA A;  1ZQW A;  4J9S A;  5KFB A;  1ZQA A;  4DFP A;  3GV5 B;  5L1M A;  4DLG A;  4I28 A;  4GXJ A;  1D1D A;  2NV3 A;  5CP2 A;  2VA2 A;  4B9M A;  5KFO A;  2KSO B;  2Y1I A;  1NK5 A;  2I6X A;  1XSP A;  2HHW A;  2ES6 A;  4DO9 A;  3BS5 B;  4UB3 A;  5KFV A;  1A77 A;  2DPI A;  2BQ3 A;  4P0Q B;  1N5X A;  4HAI A;  4RQ5 A;  4DSK A;  4C0Z A;  5F3X B;  1TV9 A;  2WLV A;  1RDF A;  1SZH A;  4NLC A;  3R9K A;  2KHQ A;  4ZH4 A;  2EH9 A;  3GQC A;  2K8C B;  4CNQ A;  5CB1 A;  3THV A;  2BCS A;  4NM1 A;  3MGV A;  2KVC A;  4EEN A;  2KFZ A;  3ZI4 A;  2KE7 A;  2DL0 A;  4RUC A;  4EEL A;  4U0C A;  4UAZ A;  4PJ0 U;  5J29 A;  1BPY A;  4KN4 A;  4BWM A;  4DOB A;  3PSP A;  4MFA A;  2QB0 B;  3BQ2 A;  2E8N A;  1ZQD A;  2HI0 A;  2KZM A;  2QB1 A;  2WF9 A;  3UPQ A;  3A0H U;  2DWQ A;  4F3O A;  1B22 A;  4R8U B;  5D4B A;  7ICP A;  4RPZ A;  2R8K A;  1CEZ A;  2Y0S C;  3LDA A;  4O3S A;  4Y2X A;  4RPY A;  3C29 A;  1QQ7 A;  3CYM A;  2JZB B;  5ALE A;  5ALS A;  4YMO A;  2W9A A;  9ICG A;  4ELT A;  8ICN A;  2EDU A;  3H0L B;  5IIK A;  1NK0 A;  5AI6 A;  9ICS A;  1KEJ A;  4DCC A;  2Y1J A;  1KKX A;  4KLH A;  4KLI A;  1EM9 A;  2W11 A;  1NK9 A;  1FEZ A;  1SIJ A;  2HBJ A;  3RFA A;  3I76 A;  3RJH A;  1CI4 A;  2ZUB A;  3V6K A;  4MF8 A;  4ICA A;  4NXZ A;  4B9S A;  4DQS A;  4ECU A;  4FE3 A;  1RG6 A;  4JV1 A;  1IXR A;  2BQR A;  5DBB A;  3E0F A;  4YMM A;  3F53 A;  3IP4 B;  2BPG A;  1D9F A;  5C5J A;  3Q8R B;  3OJS A;  3F2B A;  4US8 A;  7ICF A;  2F76 X;  2DFL A;  5ALW A;  2WAQ F;  4PHE A;  2AGO A;  2PI4 A;  3OHA A;  3NTE A;  5KT4 A;  5IIO A;  1N5W A;  2FPM A;  1L7N A;  4DS5 A;  4KX3 A;  1LB2 B;  5CWR A;  2AQ4 A;  3M6K A;  2C2R A;  1U45 A;  4DLE A;  4KLO A;  5KFY A;  1HEK A;  4YMN A;  5J8Y A;  3IDW A;  3EUB 2;  4RQ4 A;  4JMU A;  3IRU A;  2PFN A;  1K1Q A;  2V4Q A;  1F0M A;  4ED7 A;  5ALZ A;  3H8J A;  1C7Y A;  4IC9 A;  1RXW A;  3KHR A;  3AM9 A;  8ICW A;  5HGL A;  5KL1 B;  2AH5 A;  2FPK A;  2ZIV A;  2IA6 A;  1SWV A;  2FE9 A;  5A0L A;  2HDO A;  1M9C C;  4PH5 A;  1URJ A;  4UAW A;  1ZQJ A;  4I27 A;  2R8I A;  5DDM A;  4M9G A;  3SI8 A;  1ZQH A;  3PW4 A;  3GV8 B;  1ZRM A;  1HJP A;  8ICO A;  4F5Q A;  9ICQ A;  3G6Y A;  1SV4 A;  3SQI A;  1TK5 A;  2EAN A;  5DB8 A;  2UVR A;  5KG5 A;  4IRC A;  3D2Q A;  3PST A;  5KG6 A;  2XY6 A;  7ICE A;  1UA0 A;  9ICM A;  9ICI A;  4FFD A;  1ZQQ A;  2BZF A;  4OCZ A;  3HW8 A;  1T8E A;  1A76 A;  3Q8S B;  3UQ0 A;  3M6Z A;  4O3P A;  1T3Q A;  4QZG A;  2JRZ A;  3PR4 A;  3SMV A;  4I2J A;  3CNH A;  5BPC A;  3OTQ A;  2LMR A;  3QU7 A;  1Y88 A;  3RJJ A;  1PUZ A;  2DPJ A;  2B6G A;  3PNC A;  3WK5 A;  4PZN A;  4MEX A;  4OJL A;  1ED1 A;  1NJY A;  2R18 A;  3PVX A;  3TFR A;  2P66 A;  1XO0 A;  2YMP A;  3MAB A;  4M9N A;  4YP3 A;  3BS5 A;  2IOF K;  4QJF B;  4O5E A;  2I5H A;  4KLL A;  2V4R A;  3GIM A;  4P0Q A;  4B6J A;  5E79 U;  5HGM A;  3MDC A;  5J2D A;  2E8M A;  3RF9 A;  2MUT B;  1RXV A;  1NOM A;  1GWP A;  2ZIW B;  3V7K A;  5HGK A;  1JAL A;  1XC9 A;  4DGE C;  2FLP A;  9ICO A;  2DF4 B;  1XSN A;  3M8R A;  2DQN B;  1YZ6 A;  3H0R B;  5AM1 A;  4JUZ A;  3WK8 A;  4MFF A;  5ALM A;  5DLF A;  1L8L A;  1KBU A;  1L6N A;  4EZ6 A;  3I1Y A;  2JMG A;  5KFU A;  1ZQG A;  4KX5 A;  2QB0 A;  1NK8 A;  4OD0 A;  4LVS A;  1NKB A;  4I2G A;  5J8Y C;  3KKA A;  3GV7 B;  4QNB A;  3HT3 A;  4BDP A;  1CRX A;  5KFF A;  4ED0 A;  3TFS A;  4YR2 A;  3EYZ A;  5L9X A;  9ICE A;  2F8K A;  1T7P A;  3HRD D;  2KMD A;  4ED6 A;  2WLV B;  2BQU A;  3SEN A;  1G03 A;  1D8Y A;  5HR7 A;  7ICK A;  2XY5 A;  4DFJ A;  3V72 A;  2IBK A;  4Q44 A;  9ICN A;  3M8S A;  5JTI A;  4QW9 A;  4BXO B;  1L7P A;  4F2S A;  2NRT A;  4M9L A;  3LVV A;  4UAY A;  3RRH A;  3H4D A;  5AKY A;  3PSI A;  1S0N A;  3QUB A;  5TIS U;  2Y9T A;  4BJQ A;  4RUA A;  3H8W A;  4Q43 A;  8ICB A;  1PZN A;  1L3T A;  2J6T A;  2M8N A;  5IIJ A;  4RQM A;  4A8E A;  8ICI A;  1DGS A;  5ALX A;  2P6U A;  5ALO A;  4KLQ A;  5L1J A;  2F1H A;  3H8M A;  4TUQ A;  2DBY A;  2DGZ A;  4UB4 A;  1MQ3 A;  4GIB A;  2OYY A;  1KW4 A;  2HHV A;  2XCA A;  9ICC A;  3LVW A;  2E8O A;  2P35 A;  3NTU A;  4Y2Y A;  1HIW A;  4RT3 A;  2W8K A;  5ALK A;  4IR9 A;  2WF6 A;  2NO5 A;  4RQN A;  5DG7 A;  4DS4 A;  5DB9 A;  4WYM A;  4OJO A;  3PSF A;  5AK4 A;  5AI8 A;  1NZB A;  4JWM A;  5KFP A;  3KTQ A;  2YTU A;  2B21 A;  3CRX A;  4BUG A;  3IM1 A;  3K1Z A;  2H3Q A;  3BS7 A;  3NVV A;  2ZIU A;  9ICA A;  4PGX A;  1NKE A;  3RJF A;  4IR1 A;  1XU4 A;  2KK0 A;  7ICL A;  5DDY A;  5CHG A;  3TAD A;  4UW9 A;  3HP6 A;  9ICL A;  2F44 A;  2KJ5 A;  4KLG A;  5AK3 A;  4XFX A;  2JH7 A;  2A1J A;  7ICG A;  1SL0 A;  1COK A;  4U7C A;  1P7D A;  3ISC A;  4LZD A;  5AHX A;  4XFZ A;  2ZXI A;  4O5K A;  1BPX A;  3QUT A;  1NI3 A;  5GTH U;  5AM4 A;  3RBD A;  4GLX A;  2GOL A;  5KFX A;  5KFN A;  2ASJ A;  4O3R A;  4DSL A;  2NYV A;  2AU0 A;  1UQV A;  1ZQB A;  3QU2 A;  1X40 A;  4I2E A;  2ZIV B;  2Q0Z X;  2FLL A;  3PX4 A;  2E1F A;  4DL5 A;  4J03 A;  2YMQ A;  3KKA C;  4EEY A;  5AM2 A;  1DXS A;  5HMM A;  3T3F A;  4J9N A;  4TQR A;  1NJX A;  4LZG A;  2G0A A;  4ECT A;  5J0Q A;  5BOM A;  2KN7 A;  1FIQ A;  2LYH A;  3TAQ A;  2KOB A; 
#chains in the Genus database with same CATH homology
 4NV0 A;  4BX9 C;  2YB4 A;  3H0L B;  2PXR C;  1YT3 A;  2Y0S F;  3HKZ C;  2W7P A;  3MGE A;  2RHF A;  3T79 A;  2XDE A;  4U0B A;  4P0P B;  2W04 A;  2M0N A;  4U0E A;  2CPR A;  1EM9 A;  2KD1 A;  5KL8 B;  3F5E A;  2HBJ A;  4NLB A;  3RFA A;  3HKZ F;  3SAG A;  4ICA A;  2WAQ C;  1Q3V A;  2RP5 A;  2ZIW A;  4FE3 A;  3E0F A;  2JGA A;  2KJ9 A;  4PL1 A;  2Y4Z A;  3F53 A;  3IP4 B;  3CP8 A;  2MA1 A;  3F2B A;  4NWI A;  2F76 X;  2M8L A;  3LYS A;  1MA7 A;  2WAQ F;  2JH1 A;  2G5H B;  4QIW C;  3NTE A;  4PH0 A;  2LYA A;  4KX3 A;  1TAM A;  2X82 A;  3M6K A;  2GH1 A;  4B4N A;  1DRG A;  1PVP A;  2VKQ A;  4QIW F;  1HEK A;  2K8A A;  2XVT A;  2PWO A;  2D6F C;  4JMU A;  3M7D A;  2H3F A;  3O0F A;  4PL2 A;  3GU3 A;  3KFU F;  3P05 A;  2G08 A;  2KHV A;  2A3V A;  4E92 A;  4IC9 A;  3KZX A;  2Q4T A;  5HGL A;  5KL1 B;  1OUQ A;  4CRX A;  2ZIV A;  3AQF A;  2K8B B;  4INB A;  4OJP A;  5A0L A;  2LYB A;  1M9C C;  1URJ A;  1Z1B A;  4WJ3 B;  3DEE A;  3SQI A;  2VJ5 A;  3PZP A;  4U0D A;  1XNS A;  2MRL A;  3D2Q A;  2OH2 A;  3PST A;  2KNJ A;  3GZF A;  2XI9 A;  1PVQ A;  3ONN A;  3AQE A;  2CRX A;  4P0P A;  4ACO A;  4PH3 A;  2H3V A;  2H3Z A;  2KGF A;  5C0Y A;  1T94 A;  3BP9 A;  3M6Z A;  3F5A A;  3SMV A;  2WB1 C;  4J93 A;  4XFY A;  2ZIX A;  2E1E A;  3C28 A;  1QRJ A;  4OJL A;  1ED1 A;  3SAF A;  3NRW A;  2R18 A;  2WB1 F;  1XO0 A;  1U7K A;  3IG8 A;  2XIC A;  4QJF B;  3IN5 A;  2KKP A;  4P0Q A;  2K4H A;  4XRO A;  2XGU A;  2YB1 A;  4DGA C;  5CRX A;  5HGM A;  4FZL A;  3RF9 A;  4OJ5 A;  2K4I A;  2Z7J A;  1GWP A;  2ZIW B;  1A0P A;  5HGK A;  1ECW A;  4DGE C;  2HOI A;  3VCB A;  3D2N A;  2DF4 B;  2G5I B;  2KV2 A;  2DQN B;  1F44 A;  3H0R B;  2K4E A;  2HOQ A;  1KBU A;  4CGZ A;  1L6N A;  2JMG A;  2W7O A;  2HOF A;  4KX5 A;  2PWM A;  3F2C A;  2LBO A;  2ZIU B;  1UPH A;  4OJ6 A;  2XGY A;  2VIX A;  2HBL A;  4QNB A;  1Z19 A;  1CRX A;  3ICX A;  4PH2 A;  3NUQ A;  2G06 A;  4OO1 J;  4QNL A;  2VJ4 A;  2WLV B;  2G09 A;  2OXO A;  5HGN A;  1AFV A;  2HBM A;  1G03 A;  5HR7 A;  4GFJ A;  1IIP A;  2KIW A;  5T14 A;  2G07 A;  2V4X A;  4LQW C;  1AK4 C;  4U6P A;  2JHD A;  3LVV A;  3SAH A;  3PSI A;  3H47 A;  1M9F C;  3N7R C;  2GOL B;  4BJQ A;  5HGO A;  4U0A A;  2F2A B;  1P7N A;  2M8N A;  2M8P A;  1GO3 F;  2E5S A;  4A8E A;  2XGV A;  2F8L A;  4KMO B;  1E6J P;  2ZXH A;  1M9X C;  2N1R A;  4FZN A;  2JPR A;  2K89 A;  4HTW A;  1WUD A;  2GON A;  2DGZ A;  4AYB C;  2CN1 A;  2LKY A;  2W03 A;  5HR6 A;  2OYY A;  2KKV A;  2YX8 A;  3LVW A;  2BDU A;  1HIW A;  2KIC A;  4AYB F;  2H3I A;  2HMX A;  2PMZ C;  3H0M B;  3VC8 A;  2LHT A;  4WYM A;  4OJO A;  3PSF A;  4O3M A;  1NZB A;  2OM6 A;  2ZIX B;  4XRQ A;  3CRX A;  4BUG A;  3K1Z A;  2H3Q A;  4NX4 C;  1D1D A;  2PMZ F;  2NV3 A;  2LF4 A;  1M9D C;  2ZIU A;  2XID A;  2X83 A;  2HBK A;  3IG5 A;  1M9E C;  2EIA A;  3OPX A;  4U0F A;  4E91 A;  4P0Q B;  1ZQ1 C;  4C0Z A;  5JPA A;  2WLV A;  1SZH A;  3ALR A;  4CDG A;  4NLC A;  2KHQ A;  3AL0 B;  2KJ5 A;  4XFX A;  1D8B A;  1M9Y C;  2JH7 A;  3L3F X;  2K8C B;  3H4E A;  4U7C A;  1P7D A;  2F77 X;  3MGV A;  2KVC A;  4XFZ A;  2ZXI A;  3F2D A;  4U0C A;  1PVR A;  3N7P D;  2GOL A;  3PSP A;  1Q3U A;  4FZM A;  1A6S A;  2ZIV B;  3N7S C;  2KJ8 A;  2RRD A;  2E1F A;  1EIA A;  2ZG6 A;  2Y0S C;  2KEY A;  2G0A A;  3C29 A;  2X2D D;  3CYM A;  2KOB A;  3D2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...