1L6NA

Structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
288
Chain Sequence
b'GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag Polyprotein
publication title Structure of the N-terminal 283-residue fragment of the immature HIV-1 Gag polyprotein.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 73
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1l6nA01
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1l6nA02
4XFZA 4DGEC 2X83A 2WLVA 1L6NA 1G03A 4PH3A 5JPAA 1P7NA 4U0BA 2XGVA 5HGKA 4WYMA 3H47A 2K4HA 1M9DC 2GOLB 4XFXA 4ICAA 4QNBA 2PWOA 2LYBA 2JMGA 3BP9A 5HGNA 2XGYA 2KGFA 2XGUA 2GONA 4U0DA 2H3ZA 4E91A 1ECWA 4IC9A 4DGAC 2H3IA 2M8PA 5HGOA 1HIWA 1D1DA 4XFYA 4PH0A 4XROA 3NTEA 2WLVB 1M9CC 5HGLA 4HTWA 3P05A 2X82A 1QRJA 2PXRC 1AK4C 2LYAA 4PH2A 2M8LA 1AFVA 4JMUA 4U0EA 2EIAA 1M9XC 2X2DD 2Y4ZA 4U0FA 2PWMA 1U7KA 2HMXA 2K4EA 2H3QA 2V4XA 4J93A 4U0AA 1TAMA 2H3VA 4NX4C 2NV3A 4U0CA 5HGMA 2GOLA 2XDEA 3MGEA 1ED1A 2N1RA 1M9YC 4LQWC 2JPRA 2LF4A 1EM9A 1E6JP 3H4EA 4INBA 1EIAA 1M9EC 2M8NA 1GWPA 4XRQA 1A6SA 2K4IA 4B4NA 2H3FA 1HEKA 1UPHA 4E92A 1M9FC
chains in the Genus database with same CATH superfamily
3GV5B 1TFRA 2KJ8A 3RBDA 4ECSA 2AGPA 2W9AA 1J2MA 4XFZA 3IHQB 4F5NA 1H38A 1N63A 1S0VA 2NRXA 3T79A 4C4SA 4QWCA 3NS1A 3HILA 3RB3A 4RQ8A 1FEZA 5ALJA 4QNBA 2JGAA 1KFTA 5DDYA 3D2NA 1N60A 4DEZA 3BJYA 9ICUA 2D3DA 1SB3C 4FBTA 3H7IA 4EENA 5AI4A 2DQNB 1RYUA 5L1KA 1ZXIA 4Y2SA 3KHRA 1ZYQA 3GFKB 5DQGA 2C2EA 1VJ5A 5ALQA 4I2GA 3ISBA 2BR0A 4J9MA 2JH7A 1TK5A 8ICBA 2CN1A 3QEBZ 2QB0A 5KFIA 1SXEA 3K1RB 3PW5A 4AYBC 3UXOA 5J2FA 8ICKA 3M9OB 2XICA 5AK6A 4QZHA 4U0EA 5J2JA 2KZMA 1COOA 8ICOA 1ZOLA 4FFDA 1A0PA 3BQTA 1V97A 3VCBA 3DV9A 1U9LA 4F5PA 1ZQKA 3SV3A 3BQ7A 3HX0A 2OEHA 3OGUA 2N1RA 2GWSA 3QYPA 3V72A 2L5YA 5KFUA 5F3XB 8ICTA 3H4EA 4YMOA 4QWEA 2WAQF 3Q8PB 5H2FU 1XO1A 7ICOA 4ZOHC 2FLNA 2JEJA 2V4QA 3H4BA 1RPLA 2C2RA 1C7YA 2IOHA 2C28A 9ICEA 4R8UB 9ICKA 2YQEA 3GIIA 5HMMA 3FDSA 2W9CA 1S0NA 4U6PA 5ALZA 2R18A 1SWVA 2LM4A 3PV8A 5IIJA 4WYMA 2NO5A 3H47A 2B6GA 4HAIA 4JB3A 3WKEA 1M9DC 4ICAA 1RXWA 2QB0B 4R66A 2PMZC 5KFNA 4XRHA 2ZUDA 5ALEA 4MFAA 7ICHA 5IINA 4BDPA 5AKYA 3THVA 3ORYA 1BPDA 2KICA 3HP6A 8ICHA 1KQQA 2Q0ZX 3KHHA 4BJQA 5DB7A 1WWUA 2NRWA 4KN4A 1L7OA 4DFKA 1NJYA 2FPLA 2Q4TA 4F91B 4RQ2A 4OJ6A 2BQ3A 2UVVA 4EX6A 5IIOA 4DQQA 1BPZA 5ALUA 3RJKA 4LVSA 2FI1A 2XVTA 4JWMA 3RRGA 2KK0A 5DGAA 4M0AA 4A8EA 1X42A 5AM1A 4O5CA 1JN3A 2PFPA 4DSKA 2PFOA 2EAPA 2Y0SF 3NTUA 1YZ7A 2W3SA 4Q45A 4OCZA 3C2LA 2I5HA 1T94A 2XY6A 4UB1A 2FLLA 5J2HA 4XQ8A 2V4XA 1ZQBA 2OXOA 2ZIVB 5EE0A 5AKHA 2BCVA 3OJUA 3N28A 2Z7JA 2K4PA 4QNLA 2GOLA 2XDEA 3M9MB 1JI7A 4NV0A 4RPYA 4K4IA 4KX5A 2ASJA 4B6JA 3PY8A 4MF2A 4PHEA 5J0WA 2JHDA 2P6UA 3NGDA 1M9EC 1BPBA 4CCHA 2ZTCA 3IN5A 3Q8LA 4TQRA 3WKBA 1QQ6A 2YB1A 1QSSA 1Z3EB 8ICUA 5J0QA 1QLNA 7ICTA 1RG6A 4GXKA 3MGIA 3KZXA 8ICMA 4ED8A 3M7DA 4DL4A 4B9UA 1P7NA 3LK9A 4DQPA 2DGZA 1WG8A 3RB4A 2FPKA 5AM3A 1DRGA 4P2HA 3IP4B 5E79U 3UMGA 1ZQDA 1FIQA 5B5EU 3H0RB 5KFVA 4F2RA 3C5GA 5AKJA 1DGJA 3WKDA 3AU6A 1X9WA 4LJXA 3EW9A 4NL9C 3BZCA 2HHSA 2F1HA 1PZNA 3G6XA 4ED2A 4O3RA 5KFXA 2ASDA 2IBKA 1SV0A 1NZPA 3TFRA 1JXLA 4BX9C 5KFMA 2PWMA 4O0IA 4RQ7A 4KLEA 5ALYA 4BGDA 2C2DA 1U48A 2FMPA 3UMCA 3V7JA 3L3FX 4U7CA 1F5SA 7ICIA 4JV1A 4EELA 3NRWA 4PH5A 1K1SA 2HOQA 2FMQA 5KFQA 3DEEA 3OHBA 2AHOB 3SI8A 3T5LA 2KTQA 4E0DA 2ZUBA 1XC9A 2K89A 1V38A 3K1ZA 1TKDA 4DWIA 2IA6A 5AKKA 8ICZA 1BGXT 3M8RA 4HYKA 3QZ7A 2QARB 4X5VA 7ICJA 3AMZA 5J2IA 3JPQA 3QU5A 3V7LA 5J2DA 4ACOA 4Y2RA 3SEIA 4I2AA 3MR6A 5KFRA 3PX0A 2PFQA 3KKAA 2DFLA 1SIJA 1NJZA 2I9GA 1IG6A 1X6JA 1ZD5A 4JK1A 1OW5A 2Y1IA 4QZIA 4O3PA 2KSOB 1FFUA 3OSNA 2WAQC 1RQLA 3PMLA 2YTUA 5G5GA 3H8JA 1XSPA 2KN7A 4RNOA 5J2GA 4NLGA 4QZDA 1N62A 5HMLA 4P0PB 2D8CA 4DFPA 4F4YA 3ED5A 1NK7A 3PX6A 3L4PA 5KFDA 4PHAA 1D9FA 4O3QA 2DL0A 4Q8EA 4KLHA 4MFFA 2BPCA 3RRHA 4ZH4A 2ISPA 5EE3A 5L9XA 1ED1A 1SXDA 2HHWA 1ZQWA 1J2NA 2E5SA 2JPRA 3WU2U 2HDOA 3NVYA 5KG4A 4QZBA 4I28A 9ICRA 1EM9A 2W04A 5C5JA 3ZDEA 1UQVA 4EBCA 4INBA 2LPEA 1EIAA 5ALKA 3EYZA 3OHAA 5KT2A 4R65A 4ECRA 4YXMA 5KG2A 3E2EA 3F2DA 5KFBA 4CF5A 4NLNA 2BGWA 4FZMA 5J0XA 3ISCA 3S6JA 4M47A 4RZRA 4TURA 3BQ2A 1KBUA 4WJ3B 4P4OA 2Y0SC 4Q44A 1SZHA 5L1JA 2XGPA 4GFJA 4PZOA 3OPXA 1LV5A 9ICFA 5HP4A 3MDAA 3QUQA 2XGVA 3V6JA 3I1YA 2DWQA 5KT3A 1ZQQA 5IIIA 2A1JA 4DLGA 8ICQA 2JEFA 4USAA 3SENA 4F4XA 5J2EA 9ICSA 1S8OA 2W3RA 3JPNA 5IIKA 2JEIA 2XGYA 4I2IA 1T8EA 1X9MA 4CNQA 4DQIA 4EZ9A 4EBEA 3Q8MA 1KDHA 1PK3A 4KX3A 4RQ3A 5AM4A 2W43A 9ICMA 5J0RA 4IQWA 2RDIA 2WLVB 5J2BA 4HTWA 2HSZA 4M6WA 4ED6A 3LVWA 4JMUA 3QUTA 3NRZA 4FS1A 1CEZA 2XC9A 3UMBA 2E8PA 4DF8A 4IRKA 4DOAA 4U0AA 4DQRA 1VDVA 7ICQA 2ZG6A 1TK8A 3V7KA 5ALGA 2BPFA 5ALXA 2HI0A 1UCVA 5DKWA 2NYVA 4MEXA 1KFSA 4F92B 1Q3UA 5JUMA 4RUAA 2EDUA 2F3NA 4C4RA 2MUTB 3NVVA 2IOFK 2M0NA 1T3NA 1JMSA 3LDAA 2DPIA 3JPTA 1M9FC 4Y2VA 2B21A 5KFYA 2FMSA 5HNKA 4YMNA 7ICFA 2KE7A 3SQIA 8ICJA 3TANA 1U45A 7ICSA 3WK9A 3M8SA 5HGKA 1ZQ1C 3GV7B 5ALSA 4FZLA 4NWIA 4P0QA 4CGZA 2HHQA 3E58A 2VIXA 2ZXHA 5CRXA 2KOBA 4PJ0U 3KHGA 1BNPA 3MR5A 2XGUA 3RJEA 2ZIWB 2GONA 4UAUA 2R8KA 2M8PA 3TAPA 4KTQA 5KL8B 7ICPA 1MN8A 2JR5A 3WK8A 3MDCA 4DL6A 2G06A 4XUSA 4QZGA 1LB2B 1N48A 3UM9A 3UQ0A 1M9CC 1TVAA 4BXOB 9ICXA 9ICLA 4PH2A 2M8LA 2FLPA 3M9NB 4DL2A 4R8UA 2G09A 4ECUA 3KD3A 5K4LA 4M9JA 2JRZA 3QU7A 2G5HB 9ICBA 1J97A 1DOQA 3T3FA 1GO3F 8ICVA 2BCUA 5EWEA 4QWDA 4KLTA 4J9LA 1Z00A 3Q8KA 3FC4A 3RR7A 3QUBA 4RU9A 3PMNA 2YX8A 4Y2XA 4PHDA 4P0QB 2F8LA 1ZQCA 1Z1BA 1B0XA 2HHXA 2QB1A 4RNMA 3ZI4A 4NLKA 3U26A 4CF3A 1ZJNA 2V9WA 1A77A 1D8LA 9ICNA 3F2CA 4F50A 1KRPA 2WB1F 3TI0A 3BS5B 4ECXA 5AKLA 4F5QA 4Z6CA 8ICRA 1CUKA 1NNLA 2HBMA 4OD0A 2HBKA 3TADA 3MR2A 3M6ZA 2WTFA 3BP9A 5KT6A 5EOZA 2C22A 2ZIVA 8ICLA 3PSPA 2G0AA 4IC9A 4YR3A 2RDJA 4IRCA 4KLLA 1IXRA 4QZCA 1PK1B 1RDFA 3PSIA 4IS7A 5J0PA 4XFYA 1XNSA 2EZZA 2W8KA 1Z00B 4B9SA 1SKRA 3QZ8A 5GTIU 3TARA 5AM5A 4M9GA 1IM4A 4UQGA 3C28A 5L1LA 5AI6A 3RAQA 2YB4A 1SGGA 2HBLA 5DLGA 4J03A 4YVZA 5JRTA 1D8BA 3D2SA 3C23A 2IOFA 4PL1A 4RQNA 4B9LA 1CI4A 1TAMA 1SWWA 2NV3A 1PVPA 1WWVA 3B0YA 2Y9TA 4R63A 1ZQSA 8ICXA 1A6SA 1NKBA 2G5IB 9ICCA 3CRXA 1PUZA 1JXEA 3HWTA 1PVRA 4DFMA 9ICTA 2LM1A 4PZNA 1ZQIA 2XIDA 3PW0A 4LZDA 5DG8A 5KFEA 1ZQAA 1ZD4A 1U47A 3ETRA 1B43A 2F2AB 1G03A 3MGVA 4PH3A 2KFNA 1NK6A 5AM2A 2AU0A 1UA1A 1KEJA 1HUOA 5BPCA 1ZQYA 2BKEA 4XFXA 4KLMA 3BS7A 4C8NA 2XY7A 2XGQA 2W55A 1WYGA 2RHFA 5DGBA 3T5HA 1U4BA 4I29A 2HOIA 2ZJ5A 2HVHA 4M9LA 2BHNA 5DQHA 2A19A 3RB6A 1A76A 4Y2JA 2KIWA 3H0LB 4NM2A 1M6YA 2LBOA 4J9QA 1ZQFA 4FS2A 4QZFA 2NRVA 3JPOA 4O5KA 4F3OA 3QNMA 2W9MA 1KLNA 1JALA 4MF8A 1DK2A 2W11A 2OCEA 3BZKA 4XA5A 3M6KA 4R64A 3EUB2 4RUCA 1MSWD 2DUYA 3LWMA 3PX4A 5AI8A 1U7KA 9ICOA 2RLTA 2QARA 1Z19A 1NZBA 4J93A 4ED0A 2LHTA 1S10A 3GDXA 3G6VA 2ZXIA 4QW8A 2GO7A 4C0ZA 4J9OA 1X9SA 2OHFA 4QIWF 2V4RA 4KMUA 4RT2A 3CP8A 5KFLA 3PR4A 1N56A 2XCAA 2FDRA 5TISU 5AK4A 3E0FA 2YMLA 5ALIA 3I76A 2KSOA 3KBBA 3N7PD 1ZETA 4KLIA 1NOMA 1B4FA 1UT5A 2AJQA 1AQ6A 3GZFA 3SD7A 5ALDA 5CWRA 2R8IA 2YMQA 4E92A 2EZYA 1AROP 2M9NA 4YQWA 3C2MA 4Y2PA 1NK9A 1NJWA 3EPGA 3D2QA 1SL2A 4P0PA 1S76D 4F5OA 4KLQA 3PNCA 4UB8U 1NJXA 1LKYB 2ZIXB 4P4PA 1OXJA 2KFZA 4DL7A 2KMDA 1Q46A 2EAMA 4C7YA 4QZ8A 2W7PA 3KFUF 3RJHA 5KFWA 3CNHA 2XO7A 5EWFA 4ECZA 3SAHA 3H40A 5KG3A 4J9RA 4C8KA 8ICAA 1DXSA 2BCQA 5KG6A 1N5WA 4UASA 2RRDA 2EQYA 9ICHA 4EZ6A 2MAXA 3PO4A 1L7MA 2KEYA 5BOMA 2BCRA 5KG7A 2XY5A 5KFFA 2PXRC 1AK4C 4MFCA 2WB1C 5ALOA 4UARA 5CEHA 3WKCA 4RNNA 1L3TA 2Y4ZA 1QH9A 4F5RA 1L8LA 3BQ1A 5CB1A 4FBUA 3AU2A 4YFKA 3SYZA 4F8RA 2F44A 5BOLA 2PI4A 3H8WA 1D9DA 1S97A 5AICA 4M9NA 2LMRA 5IIMA 4C8LA 1DGSA 5ALTA 1NKEA 4DFDA 3GIKA 4B9TA 1SV4A 4C80A 5AKGA 3TQ1A 1TK0A 5ALNA 1U49A 3TKAA 4IQTA 3LWLA 1T7PA 2WLVA 4UB5A 5HHIA 4CRXA 2JV3A 4TUPA 5AI5A 3HT3A 4DSEA 5AIAA 3IDWA 3TADC 3AQEA 4QZAA 3LYSA 4RQ6A 1QCKA 2CXYA 4UB6U 4LZGA 2JMGA 2PI5A 4EYHB 2GH1A 3HKZF 5AKZA 1KKXA 5EWGA 3IRUA 4U0DA 2H3IA 3UPQA 4Y2UA 5KFKA 2A3VA 1X9XA 3D6JA 4DL5A 3DDHA 1HIWA 4P4MA 1RM6C 1KSPA 2ZUCA 5D4BA 5HR6A 4Q43A 5CA7A 1NK0A 3AQFA 5DB9A 3RTVA 2KG5A 2MUTA 1WUDA 4RQMA 3MFHA 3NVWA 7ICNA 3RH4A 2YMMA 1SKSA 1L3UA 1S5LU 2AXTU 2UVUA 3C1ZA 2OM6A 3GIMA 2KKPA 4UAVA 4NLZA 4G9BA 5DLFA 1TAQA 1XO0A 8ICYA 4J9PA 3KTQA 2H3QA 3V6HA 4B9MA 3MABA 4F72A 5CP2A 3JPPA 2KJ9A 1L7PA 1KW4A 2ZIUB 2JXJA 2ZJ8A 3RR8A 5J8YA 1RYRA 4US8A 3AUOA 3GQCA 1RQNA 2M8NA 1JUDA 2ZIWA 2AQ4A 2H5XA 2G07A 2KZ3A 5DG9A 2K4IA 2JH1A 1ZQGA 5C0YA 4PHPA 4RPZA 1UPHA 3V6KA 4RT3A 1XSLA 4C8OA 2K8AA 3A0HU 3GU3A 4QZEA 4F2SA 4I2JA 5ALVA 1TAUA 4PPXA 4BXOA 2JZBA 3TFSA 5DQIA 1L3SA 4I2CA 5JPAA 3SAGA 3HJEA 2ALZA 4F4WA 5ALWA 3LVVA 1ZQLA 1L8OA 4C7ZA 2F76X 5KG0A 2PWOA 2BQRA 4YMMA 3JPSA 2QLTA 9ICWA 4QIWC 7ICKA 4F71A 4K4HA 5KAFU 5DB6A 3Q8RB 4UB4A 4GIBA 5KT5A 1HUZA 2W54A 4Y2TA 3TAQA 2OWOA 5J0UA 2BZFA 3QU9A 4I2HA 1MQ3A 4EYIB 5AK5A 2ASLA 1L5UA 3K75D 3RJFA 4PGYA 1O08A 4XROA 2IMWP 4JV0A 3HPOA 4DO9A 1ZRNA 3RJIA 2VA8A 1VLBA 2UVWA 1ZQRA 4QJFB 5ALMA 3PZPA 4IR1A 3MFIA 4I2DA 1ZQVA 3SZ2A 3SMVA 5EE1A 3BS5A 4NM1A 4O3OA 5KL1B 5KG5A 2YY6A 1UA0A 2DPJA 4Y2QA 5HGMA 2OYYA 3O0FA 3RB0A 4JUZA 1Z1VA 4RQ4A 1M9YC 2E8NA 3K4GA 2JZBB 4M9HA 2F8KA 5AIBA 2LF4A 1SV0C 1Z4NA 5CR0A 4DL3A 4OO1J 2E8OA 1QQ5A 4ED3A 1TE2A 5AKEA 2AQ0A 5KFZA 4GXJA 8ICNA 4KLDA 1GWPA 4XRQA 3ZDCA 4F4KA 9ICIA 9ICVA 1L3VA 4RQ1A 3WKAA 2IHNA 1PK1A 4Y2YA 3JPRA 1CRXA 2P35A 5ALRA 5GTHU 2W7OA 4O3NA 2J6TA 2K8BB 2LKYA 1MC8A 3KOOA 2OH2A 5L1MA 1Q3VA 4ELUA 3RH5A 2KNJA 4NJ8A 4NXZA 4YCXA 3BDPA 1UT8A 5CHGA 2P6RA 2RP5A 2PXIA 2XCPA 1ZD2P 1KN5A 2CPRA 5ALHA 1BVSA 4UATA 4YR2A 3PO5A 2BDUA 2E1FA 4YD2A 3A0BU 4QZ9A 2D6FC 4EBDA 4GXIA 1RXVA 4KLOA 2P66A 4QWBA 2H3ZA 4ELVA 4CF4A 4DGAC 1KFDA 4UAYA 2FJ6A 2VANA 4UBCA 4RQ5A 5F9LA 2PKEA 3SAFA 3IV6A 9ICJA 4C8MA 2ATLA 4CE6A 9ICQA 4KLUA 3H0MB 1WCNA 4ECTA 2MSNA 1S77D 3KKAC 3P05A 4GC7A 1Q8KA 4NLBA 7ICMA 5KFTA 3GIJA 2ES6A 4ED7A 5KAIU 2Y9UA 1KTQA 4ECWA 2NRZA 5KFJA 2K4EA 5DBBA 3QEAZ 4OJPA 1NK5A 4KMOB 2WF6A 7ICEA 2WF8A 3HKZC 3MGEA 4UB2A 4F93B 3PW2A 5KTQA 5KT7A 4LQWC 3FYHA 2F1IA 3MGHA 3IM1A 4IL6U 4DOCA 5J2CA 4Z6DA 4DS5A 1N61A 5DG7A 2DBYA 2H3FA 1F0MA 3AL0B 2I6XA 2ODGA 3PSTA 1V85A 3WK4A 5J29A 3F5AA 2WF9A 2XI9A 5KFGA 4DGEC 1LVHA 2VA2A 1SL1A 4G3IA 4ED1A 3ZDBA 7ICRA 4YN4A 3PW4A 2K4HA 5D46A 4M04A 4ECVA 3M1YA 2KVSA 4DQSA 4JWNA 2VKQA 2ZJAA 2AGOA 3PW7A 1ZQHA 3RJGA 4I2FA 4KLFA 2HHTA 2WF5A 3C21A 4I2BA 4F4ZA 4DLEA 4Q8FA 3QUCA 4AP9A 4RPXA 4KLGA 3H4DA 3NUQA 2KKVA 5A0LA 3MBYA 1X6IA 7ICUA 4O5EA 5EE9A 3T5KA 2W9CB 3N97B 4US9A 3IG8A 2E1EA 3ICXA 3QXGA 1L7NA 4KITB 3AEVA 3RF9A 2WHEA 1M9XC 1EXNA 3BQ0A 5J0TA 2I1QA 5IILA 2LYHA 3RH6A 3ZDDA 1LKYA 2QKQA 2ZIXA 1IIPA 4DFJA 5J8YC 1D8YA 4OJOA 5KFAA 3RAXA 4EEKA 5DB8A 4DS4A 2W9BA 1K5OA 3J81j 2DKZA 2HW3A 4K4GA 1DK3A 3F2BA 2YMPA 4UAZA 1NK8A 3SV4A 1N2XA 3QU2A 2BQUA 1RZTA 2W8LA 2HCFA 5DBCA 3QX7A 4B4NA 4CDGA 2W03A 4GLXA 3ALRA 4IQVA 5TZVA 4ECYA 3WK5A 4B9VA 3HW8A 8ICSA 5AM0A 5ALFA 1MA7A 4YXJA 2X83A 3AM9A 1PVQA 4J9NA 2EAOA 4MEYA 4UW9A 1O03A 2K60A 3L5KA 1HJPA 1NKCA 1ZQJA 2HHUA 2GOLB 4M2YA 3RBEA 2DKXA 3MC1A 3UXPA 3I28A 3EWAA 1V9PA 3QE9Y 1URJA 2BCSA 3FM9A 1TV9A 8ICFA 2DF4B 1MQ2A 4IQUA 1P7DA 3ETLA 3WK7A 1ECWA 3QU4A 1ZJMA 1K1QA 9ICAA 5JTIA 4BWMA 1RYSA 4TUSA 2Y1JA 2B0CA 1ZQMA 4YR0A 4QW9A 2ZTEA 4FZNA 1Y88A 1YZ6A 2W9BB 5KFOA 4J9SA 2NO4A 1AFVA 1ZQEA 2EIAA 4U0FA 4J9KA 2AH5A 5AKIA 4RQ0A 1JX4A 8ICGA 5AK3A 2VJ5A 1BPXA 1QTMA 2F1JA 4I2EA 4BUGA 4YP3A 2ZTDA 3UXNA 4TQSA 4EX7A 2EZXA 4KN7A 1T3QA 3ONNA 3PSFA 5DDMA 4DSIA 2CRXA 1F44A 3Q8SB 3MR3A 5J0OA 5F9NA 4FE3A 4EEYA 1UHUA 3N7SC 1ZQUA 5KFHA 3CYMA 2BPGA 2PFNA 1ZQPA 3TACB 1X40A 3RFAA 2ISOA 2KP7A 5DBAA 1QSLA 3RJJA 4AYBF 2YN4A 3NASA 1ZRMA 5JU5A 3KZIU 4ECQA 1IV8A 3T5JA 5HHHA 5J2AA 3IG5A 5KFCA 5HGNA 1N5XA 2RQ5A 1QQ7A 2F77X 3N7RC 2KGFA 2G08A 2ZIUA 1FO4A 4JV2A 4E91A 1JRPA 5ALPA 3N4MB 1XS9D 2GLEA 2E3TA 5G5HA 4MHVA 3OSPA 4PH0A 3AN1A 3OTQA 4BWJA 3UQ2A 4NLCA 3C5FA 5HGLA 4I27A 1OUQA 3WK6A 2IHMA 4C4TA 2LYAA 2HBJA 8ICCA 3B0XA 3GILA 1JROA 3F53A 2O6KA 2HOFA 4IRDA 5CJ7A 1ZQTA 3B9JA 2ESEA 1NI3A 2UVRA 3CW2C 1T4GA 5KFSA 4FO6A 2HMXA 2KHVA 5T14A 1S9FA 1Z4OA 2KVCA 1XWLA 4U0CA 2PMZF 2KHQA 3ZDAA 5AI9A 4PL2A 3NVZA 1WCLA 2E8MA 1B22A 1E6JP 2LI6A 5J2KA 2KIVA 4O3MA 1X2IA 3ISDA 4KLSA 3HRDD 4UB3A 2MRLA 2VJ4A 5KT4A 1X66A 1ZD3A 5B66U 9ICPA 1YT3A 7ICVA 3ZD8A 4OJLA 3G6YA 2AGQA 8ICWA 4TUQA 1L6NA 1XSNA 2FE9A 3C1YA 2EANA 5D49A 4U0BA 3EPIA 3R9KA 4YG2A 1BNOA 1ZQZA 4QWAA 4O3SA 2KJ5A 2LYBA 1S0OA 1ZQNA 3FAHA 3C29A 2MA1A 4ELTA 4DF4A 3H8MA 3PR5B 2A1AA 2R8HA 4DSFA 5AHXA 2R8GA 4Z6EA 2JEGA 4O9MA 2EH9A 1S0MA 3ZD9A 3H8SA 5HGOA 1JIHA 2KD1A 1BPYA 1D1DA 1QSYA 2J6UA 1ZQOA 1BPEA 4DOBA 4B9NA 1XU4A 5FP0A 4DCCA 2R8JA 5KNIA 1COKA 3NTEA 4DSLA 8ICPA 1ZQXA 3Q8QB 4IR9A 8ICEA 1C20A 4NL9A 2HVIA 2KZZA 2X82A 1QRJA 2HHVA 5KG1A 5L1IA 9ICGA 3SR6A 2J6SA 2VA3A 2BDPA 2X2DD 3OJSA 7ICGA 3EZ5A 2A1JB 4KLJA 4NY8A 4PGXA 5ALLA 2FPMA 4PGQA 2H3VA 5HR7A 4NX4C 3GV8B 3PVXA 4UBBA 1SL0A 1SKWA 2NRTA 2MU2A 1KL9A 1FFVA 4Z6FA 2WF7A 5J0YA 4YD1A 1NK4A 5J0SA 4UAWA 5AKXA 1SZPA 4GC6A 7ICLA 8ICIA 3F5EA 5AI0A 4OJ5A 4M6WB 2KV2A 3VC8A 3KHLA 1HEKA 5KFPA 4DSJA 2K8CB 2WFAA 3C2KA
chains in the Genus database with same CATH topology
2XI9A 2KJ8A 1KBUA 4WJ3B 4XFZA 4DGEC 2Y0SC 3D2QA 1SZHA 4P0PA 3T79A 4GFJA 3OPXA 2XGVA 2ZIXB 2K4HA 4QNBA 2JGAA 3D2NA 2W7PA 2VKQA 3KFUF 2XGYA 2DQNB 3SAHA 4KX3A 3NUQA 2RRDA 2KKVA 5A0LA 2JH7A 2KEYA 2WLVB 4HTWA 2CN1A 2PXRC 1AK4C 3LVWA 2WB1C 3IG8A 2E1EA 4AYBC 4JMUA 3ICXA 2XICA 4U0EA 3RF9A 1M9XC 2Y4ZA 1A0PA 3VCBA 4U0AA 2ZG6A 2ZIXA 1IIPA 2N1RA 4OJOA 1Q3UA 3F2BA 3H4EA 2WAQF 4B4NA 2M0NA 4CDGA 2W03A 3ALRA 1M9FC 1MA7A 2X83A 2WLVA 1PVQA 3SQIA 4CRXA 4U6PA 2R18A 5HGKA 1ZQ1C 4WYMA 3H47A 3AQEA 4FZLA 1M9DC 4NWIA 4P0QA 4CGZA 2GOLB 3LYSA 4ICAA 2VIXA 2PMZC 2ZXHA 2JMGA 5CRXA 2KOBA 2GH1A 3HKZF 1URJA 2DF4B 2KICA 2XGUA 2GONA 2ZIWB 1P7DA 4U0DA 1ECWA 4BJQA 2H3IA 2A3VA 2M8PA 2Q4TA 1HIWA 5KL8B 4OJ6A 5HR6A 2G06A 3AQFA 2XVTA 1M9CC 1WUDA 4FZNA 4PH2A 2M8LA 4A8EA 1AFVA 2Y0SF 2EIAA 2OM6A 2G09A 4U0FA 2KKPA 1T94A 1XO0A 2H3QA 2V4XA 2VJ5A 2OXOA 2ZIVB 2G5HB 2Z7JA 2KJ9A 4QNLA 1GO3F 2ZIUB 4BUGA 2GOLA 2XDEA 4NV0A 3ONNA 3PSFA 4KX5A 2CRXA 1F44A 2YX8A 4P0QB 2F8LA 2JHDA 1Z1BA 1M9EC 2M8NA 2ZIWA 2G07A 4FE3A 2K4IA 2JH1A 5C0YA 3IN5A 3N7SC 1UPHA 3CYMA 2YB1A 2K8AA 3F2CA 3GU3A 3RFAA 2WB1F 3KZXA 4AYBF 5JPAA 3M7DA 3SAGA 1P7NA 2HBMA 2DGZA 2HBKA 3LVVA 2F76X 1DRGA 2PWOA 3M6ZA 3BP9A 3IP4B 3IG5A 4QIWC 5HGNA 2ZIVA 2F77X 3PSPA 3N7RC 2KGFA 2G08A 2ZIUA 2G0AA 3H0RB 4E91A 4IC9A 3PSIA 4XFYA 1XNSA 4PH0A 4XROA 4NLCA 5HGLA 1OUQA 3C28A 2LYAA 2HBJA 4QJFB 2YB4A 3PZPA 3F53A 2HBLA 2HOFA 4BX9C 2PWMA 3SMVA 2HMXA 1D8BA 3D2SA 2KHVA 5T14A 4PL1A 3L3FX 1TAMA 5KL1B 2KVCA 4U7CA 2NV3A 1PVPA 4U0CA 5HGMA 2OYYA 2PMZF 3O0FA 2KHQA 1M9YC 3NRWA 4PL2A 2LF4A 2HOQA 4OO1J 1E6JP 3DEEA 1GWPA 4XRQA 1A6SA 4O3MA 2G5IB 3CRXA 1CRXA 2K89A 3K1ZA 1PVRA 2MRLA 2VJ4A 2W7OA 1YT3A 2K8BB 2LKYA 2XIDA 4OJLA 2OH2A 1Q3VA 2KNJA 1L6NA 2F2AB 1G03A 3MGVA 4PH3A 4U0BA 2RP5A 4ACOA 4XFXA 2CPRA 2KJ5A 2LYBA 3C29A 2MA1A 2BDUA 2E1FA 2RHFA 2D6FC 2HOIA 2H3ZA 4DGAC 2WAQC 5HGOA 2KD1A 2KIWA 1D1DA 3H0LB 3SAFA 2LBOA 3NTEA 3H0MB 4P0PB 3P05A 4NLBA 2X82A 1QRJA 3M6KA 2X2DD 1U7KA 2K4EA 1Z19A 1NZBA 4OJPA 4J93A 4KMOB 2LHTA 2H3VA 2ZXIA 5HR7A 3HKZC 4NX4C 4C0ZA 1ED1A 3MGEA 4QIWF 2E5SA 4LQWC 2JPRA 3CP8A 1EM9A 2W04A 4INBA 3E0FA 1EIAA 3F5EA 4OJ5A 3N7PD 2H3FA 2KV2A 3AL0B 3VC8A 1HEKA 3F2DA 3GZFA 3PSTA 2K8CB 4E92A 4FZMA 3F5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFZ A;  4DGE C;  2X83 A;  2WLV A;  1L6N A;  1G03 A;  4PH3 A;  5JPA A;  1P7N A;  4U0B A;  2XGV A;  5HGK A;  4WYM A;  3H47 A;  2K4H A;  1M9D C;  2GOL B;  4XFX A;  4ICA A;  4QNB A;  2PWO A;  2LYB A;  2JMG A;  3BP9 A;  5HGN A;  2XGY A;  2KGF A;  2XGU A;  2GON A;  4U0D A;  2H3Z A;  4E91 A;  1ECW A;  4IC9 A;  4DGA C;  2H3I A;  2M8P A;  5HGO A;  1HIW A;  1D1D A;  4XFY A;  4PH0 A;  4XRO A;  3NTE A;  2WLV B;  1M9C C;  5HGL A;  4HTW A;  3P05 A;  2X82 A;  1QRJ A;  2PXR C;  1AK4 C;  2LYA A;  4PH2 A;  2M8L A;  1AFV A;  4JMU A;  4U0E A;  2EIA A;  1M9X C;  2X2D D;  2Y4Z A;  4U0F A;  2PWM A;  1U7K A;  2HMX A;  2K4E A;  2H3Q A;  2V4X A;  4J93 A;  4U0A A;  1TAM A;  2H3V A;  4NX4 C;  2NV3 A;  4U0C A;  5HGM A;  2GOL A;  2XDE A;  3MGE A;  1ED1 A;  2N1R A;  1M9Y C;  4LQW C;  2JPR A;  2LF4 A;  1EM9 A;  1E6J P;  3H4E A;  4INB A;  1EIA A;  1M9E C;  2M8N A;  1GWP A;  4XRQ A;  1A6S A;  2K4I A;  4B4N A;  2H3F A;  1HEK A;  1UPH A;  4E92 A;  1M9F C; 
#chains in the Genus database with same CATH topology
 3GV5 B;  1TFR A;  2KJ8 A;  3RBD A;  4ECS A;  2AGP A;  2W9A A;  1J2M A;  4XFZ A;  3IHQ B;  4F5N A;  1H38 A;  1N63 A;  1S0V A;  2NRX A;  3T79 A;  4C4S A;  4QWC A;  3NS1 A;  3HIL A;  3RB3 A;  4RQ8 A;  1FEZ A;  5ALJ A;  4QNB A;  2JGA A;  1KFT A;  5DDY A;  3D2N A;  1N60 A;  4DEZ A;  3BJY A;  9ICU A;  2D3D A;  1SB3 C;  4FBT A;  3H7I A;  4EEN A;  5AI4 A;  2DQN B;  1RYU A;  5L1K A;  1ZXI A;  4Y2S A;  3KHR A;  1ZYQ A;  3GFK B;  5DQG A;  2C2E A;  1VJ5 A;  5ALQ A;  4I2G A;  3ISB A;  2BR0 A;  4J9M A;  2JH7 A;  1TK5 A;  8ICB A;  2CN1 A;  3QEB Z;  2QB0 A;  5KFI A;  1SXE A;  3K1R B;  3PW5 A;  4AYB C;  3UXO A;  5J2F A;  8ICK A;  3M9O B;  2XIC A;  5AK6 A;  4QZH A;  4U0E A;  5J2J A;  2KZM A;  1COO A;  8ICO A;  1ZOL A;  4FFD A;  1A0P A;  3BQT A;  1V97 A;  3VCB A;  3DV9 A;  1U9L A;  4F5P A;  1ZQK A;  3SV3 A;  3BQ7 A;  3HX0 A;  2OEH A;  3OGU A;  2N1R A;  2GWS A;  3QYP A;  3V72 A;  2L5Y A;  5KFU A;  5F3X B;  8ICT A;  3H4E A;  4YMO A;  4QWE A;  2WAQ F;  3Q8P B;  5H2F U;  1XO1 A;  7ICO A;  4ZOH C;  2FLN A;  2JEJ A;  2V4Q A;  3H4B A;  1RPL A;  2C2R A;  1C7Y A;  2IOH A;  2C28 A;  9ICE A;  4R8U B;  9ICK A;  2YQE A;  3GII A;  5HMM A;  3FDS A;  2W9C A;  1S0N A;  4U6P A;  5ALZ A;  2R18 A;  1SWV A;  2LM4 A;  3PV8 A;  5IIJ A;  4WYM A;  2NO5 A;  3H47 A;  2B6G A;  4HAI A;  4JB3 A;  3WKE A;  1M9D C;  4ICA A;  1RXW A;  2QB0 B;  4R66 A;  2PMZ C;  5KFN A;  4XRH A;  2ZUD A;  5ALE A;  4MFA A;  7ICH A;  5IIN A;  4BDP A;  5AKY A;  3THV A;  3ORY A;  1BPD A;  2KIC A;  3HP6 A;  8ICH A;  1KQQ A;  2Q0Z X;  3KHH A;  4BJQ A;  5DB7 A;  1WWU A;  2NRW A;  4KN4 A;  1L7O A;  4DFK A;  1NJY A;  2FPL A;  2Q4T A;  4F91 B;  4RQ2 A;  4OJ6 A;  2BQ3 A;  2UVV A;  4EX6 A;  5IIO A;  4DQQ A;  1BPZ A;  5ALU A;  3RJK A;  4LVS A;  2FI1 A;  2XVT A;  4JWM A;  3RRG A;  2KK0 A;  5DGA A;  4M0A A;  4A8E A;  1X42 A;  5AM1 A;  4O5C A;  1JN3 A;  2PFP A;  4DSK A;  2PFO A;  2EAP A;  2Y0S F;  3NTU A;  1YZ7 A;  2W3S A;  4Q45 A;  4OCZ A;  3C2L A;  2I5H A;  1T94 A;  2XY6 A;  4UB1 A;  2FLL A;  5J2H A;  4XQ8 A;  2V4X A;  1ZQB A;  2OXO A;  2ZIV B;  5EE0 A;  5AKH A;  2BCV A;  3OJU A;  3N28 A;  2Z7J A;  2K4P A;  4QNL A;  2GOL A;  2XDE A;  3M9M B;  1JI7 A;  4NV0 A;  4RPY A;  4K4I A;  4KX5 A;  2ASJ A;  4B6J A;  3PY8 A;  4MF2 A;  4PHE A;  5J0W A;  2JHD A;  2P6U A;  3NGD A;  1M9E C;  1BPB A;  4CCH A;  2ZTC A;  3IN5 A;  3Q8L A;  4TQR A;  3WKB A;  1QQ6 A;  2YB1 A;  1QSS A;  1Z3E B;  8ICU A;  5J0Q A;  1QLN A;  7ICT A;  1RG6 A;  4GXK A;  3MGI A;  3KZX A;  8ICM A;  4ED8 A;  3M7D A;  4DL4 A;  4B9U A;  1P7N A;  3LK9 A;  4DQP A;  2DGZ A;  1WG8 A;  3RB4 A;  2FPK A;  5AM3 A;  1DRG A;  4P2H A;  3IP4 B;  5E79 U;  3UMG A;  1ZQD A;  1FIQ A;  5B5E U;  3H0R B;  5KFV A;  4F2R A;  3C5G A;  5AKJ A;  1DGJ A;  3WKD A;  3AU6 A;  1X9W A;  4LJX A;  3EW9 A;  4NL9 C;  3BZC A;  2HHS A;  2F1H A;  1PZN A;  3G6X A;  4ED2 A;  4O3R A;  5KFX A;  2ASD A;  2IBK A;  1SV0 A;  1NZP A;  3TFR A;  1JXL A;  4BX9 C;  5KFM A;  2PWM A;  4O0I A;  4RQ7 A;  4KLE A;  5ALY A;  4BGD A;  2C2D A;  1U48 A;  2FMP A;  3UMC A;  3V7J A;  3L3F X;  4U7C A;  1F5S A;  7ICI A;  4JV1 A;  4EEL A;  3NRW A;  4PH5 A;  1K1S A;  2HOQ A;  2FMQ A;  5KFQ A;  3DEE A;  3OHB A;  2AHO B;  3SI8 A;  3T5L A;  2KTQ A;  4E0D A;  2ZUB A;  1XC9 A;  2K89 A;  1V38 A;  3K1Z A;  1TKD A;  4DWI A;  2IA6 A;  5AKK A;  8ICZ A;  1BGX T;  3M8R A;  4HYK A;  3QZ7 A;  2QAR B;  4X5V A;  7ICJ A;  3AMZ A;  5J2I A;  3JPQ A;  3QU5 A;  3V7L A;  5J2D A;  4ACO A;  4Y2R A;  3SEI A;  4I2A A;  3MR6 A;  5KFR A;  3PX0 A;  2PFQ A;  3KKA A;  2DFL A;  1SIJ A;  1NJZ A;  2I9G A;  1IG6 A;  1X6J A;  1ZD5 A;  4JK1 A;  1OW5 A;  2Y1I A;  4QZI A;  4O3P A;  2KSO B;  1FFU A;  3OSN A;  2WAQ C;  1RQL A;  3PML A;  2YTU A;  5G5G A;  3H8J A;  1XSP A;  2KN7 A;  4RNO A;  5J2G A;  4NLG A;  4QZD A;  1N62 A;  5HML A;  4P0P B;  2D8C A;  4DFP A;  4F4Y A;  3ED5 A;  1NK7 A;  3PX6 A;  3L4P A;  5KFD A;  4PHA A;  1D9F A;  4O3Q A;  2DL0 A;  4Q8E A;  4KLH A;  4MFF A;  2BPC A;  3RRH A;  4ZH4 A;  2ISP A;  5EE3 A;  5L9X A;  1ED1 A;  1SXD A;  2HHW A;  1ZQW A;  1J2N A;  2E5S A;  2JPR A;  3WU2 U;  2HDO A;  3NVY A;  5KG4 A;  4QZB A;  4I28 A;  9ICR A;  1EM9 A;  2W04 A;  5C5J A;  3ZDE A;  1UQV A;  4EBC A;  4INB A;  2LPE A;  1EIA A;  5ALK A;  3EYZ A;  3OHA A;  5KT2 A;  4R65 A;  4ECR A;  4YXM A;  5KG2 A;  3E2E A;  3F2D A;  5KFB A;  4CF5 A;  4NLN A;  2BGW A;  4FZM A;  5J0X A;  3ISC A;  3S6J A;  4M47 A;  4RZR A;  4TUR A;  3BQ2 A;  1KBU A;  4WJ3 B;  4P4O A;  2Y0S C;  4Q44 A;  1SZH A;  5L1J A;  2XGP A;  4GFJ A;  4PZO A;  3OPX A;  1LV5 A;  9ICF A;  5HP4 A;  3MDA A;  3QUQ A;  2XGV A;  3V6J A;  3I1Y A;  2DWQ A;  5KT3 A;  1ZQQ A;  5III A;  2A1J A;  4DLG A;  8ICQ A;  2JEF A;  4USA A;  3SEN A;  4F4X A;  5J2E A;  9ICS A;  1S8O A;  2W3R A;  3JPN A;  5IIK A;  2JEI A;  2XGY A;  4I2I A;  1T8E A;  1X9M A;  4CNQ A;  4DQI A;  4EZ9 A;  4EBE A;  3Q8M A;  1KDH A;  1PK3 A;  4KX3 A;  4RQ3 A;  5AM4 A;  2W43 A;  9ICM A;  5J0R A;  4IQW A;  2RDI A;  2WLV B;  5J2B A;  4HTW A;  2HSZ A;  4M6W A;  4ED6 A;  3LVW A;  4JMU A;  3QUT A;  3NRZ A;  4FS1 A;  1CEZ A;  2XC9 A;  3UMB A;  2E8P A;  4DF8 A;  4IRK A;  4DOA A;  4U0A A;  4DQR A;  1VDV A;  7ICQ A;  2ZG6 A;  1TK8 A;  3V7K A;  5ALG A;  2BPF A;  5ALX A;  2HI0 A;  1UCV A;  5DKW A;  2NYV A;  4MEX A;  1KFS A;  4F92 B;  1Q3U A;  5JUM A;  4RUA A;  2EDU A;  2F3N A;  4C4R A;  2MUT B;  3NVV A;  2IOF K;  2M0N A;  1T3N A;  1JMS A;  3LDA A;  2DPI A;  3JPT A;  1M9F C;  4Y2V A;  2B21 A;  5KFY A;  2FMS A;  5HNK A;  4YMN A;  7ICF A;  2KE7 A;  3SQI A;  8ICJ A;  3TAN A;  1U45 A;  7ICS A;  3WK9 A;  3M8S A;  5HGK A;  1ZQ1 C;  3GV7 B;  5ALS A;  4FZL A;  4NWI A;  4P0Q A;  4CGZ A;  2HHQ A;  3E58 A;  2VIX A;  2ZXH A;  5CRX A;  2KOB A;  4PJ0 U;  3KHG A;  1BNP A;  3MR5 A;  2XGU A;  3RJE A;  2ZIW B;  2GON A;  4UAU A;  2R8K A;  2M8P A;  3TAP A;  4KTQ A;  5KL8 B;  7ICP A;  1MN8 A;  2JR5 A;  3WK8 A;  3MDC A;  4DL6 A;  2G06 A;  4XUS A;  4QZG A;  1LB2 B;  1N48 A;  3UM9 A;  3UQ0 A;  1M9C C;  1TVA A;  4BXO B;  9ICX A;  9ICL A;  4PH2 A;  2M8L A;  2FLP A;  3M9N B;  4DL2 A;  4R8U A;  2G09 A;  4ECU A;  3KD3 A;  5K4L A;  4M9J A;  2JRZ A;  3QU7 A;  2G5H B;  9ICB A;  1J97 A;  1DOQ A;  3T3F A;  1GO3 F;  8ICV A;  2BCU A;  5EWE A;  4QWD A;  4KLT A;  4J9L A;  1Z00 A;  3Q8K A;  3FC4 A;  3RR7 A;  3QUB A;  4RU9 A;  3PMN A;  2YX8 A;  4Y2X A;  4PHD A;  4P0Q B;  2F8L A;  1ZQC A;  1Z1B A;  1B0X A;  2HHX A;  2QB1 A;  4RNM A;  3ZI4 A;  4NLK A;  3U26 A;  4CF3 A;  1ZJN A;  2V9W A;  1A77 A;  1D8L A;  9ICN A;  3F2C A;  4F50 A;  1KRP A;  2WB1 F;  3TI0 A;  3BS5 B;  4ECX A;  5AKL A;  4F5Q A;  4Z6C A;  8ICR A;  1CUK A;  1NNL A;  2HBM A;  4OD0 A;  2HBK A;  3TAD A;  3MR2 A;  3M6Z A;  2WTF A;  3BP9 A;  5KT6 A;  5EOZ A;  2C22 A;  2ZIV A;  8ICL A;  3PSP A;  2G0A A;  4IC9 A;  4YR3 A;  2RDJ A;  4IRC A;  4KLL A;  1IXR A;  4QZC A;  1PK1 B;  1RDF A;  3PSI A;  4IS7 A;  5J0P A;  4XFY A;  1XNS A;  2EZZ A;  2W8K A;  1Z00 B;  4B9S A;  1SKR A;  3QZ8 A;  5GTI U;  3TAR A;  5AM5 A;  4M9G A;  1IM4 A;  4UQG A;  3C28 A;  5L1L A;  5AI6 A;  3RAQ A;  2YB4 A;  1SGG A;  2HBL A;  5DLG A;  4J03 A;  4YVZ A;  5JRT A;  1D8B A;  3D2S A;  3C23 A;  2IOF A;  4PL1 A;  4RQN A;  4B9L A;  1CI4 A;  1TAM A;  1SWW A;  2NV3 A;  1PVP A;  1WWV A;  3B0Y A;  2Y9T A;  4R63 A;  1ZQS A;  8ICX A;  1A6S A;  1NKB A;  2G5I B;  9ICC A;  3CRX A;  1PUZ A;  1JXE A;  3HWT A;  1PVR A;  4DFM A;  9ICT A;  2LM1 A;  4PZN A;  1ZQI A;  2XID A;  3PW0 A;  4LZD A;  5DG8 A;  5KFE A;  1ZQA A;  1ZD4 A;  1U47 A;  3ETR A;  1B43 A;  2F2A B;  1G03 A;  3MGV A;  4PH3 A;  2KFN A;  1NK6 A;  5AM2 A;  2AU0 A;  1UA1 A;  1KEJ A;  1HUO A;  5BPC A;  1ZQY A;  2BKE A;  4XFX A;  4KLM A;  3BS7 A;  4C8N A;  2XY7 A;  2XGQ A;  2W55 A;  1WYG A;  2RHF A;  5DGB A;  3T5H A;  1U4B A;  4I29 A;  2HOI A;  2ZJ5 A;  2HVH A;  4M9L A;  2BHN A;  5DQH A;  2A19 A;  3RB6 A;  1A76 A;  4Y2J A;  2KIW A;  3H0L B;  4NM2 A;  1M6Y A;  2LBO A;  4J9Q A;  1ZQF A;  4FS2 A;  4QZF A;  2NRV A;  3JPO A;  4O5K A;  4F3O A;  3QNM A;  2W9M A;  1KLN A;  1JAL A;  4MF8 A;  1DK2 A;  2W11 A;  2OCE A;  3BZK A;  4XA5 A;  3M6K A;  4R64 A;  3EUB 2;  4RUC A;  1MSW D;  2DUY A;  3LWM A;  3PX4 A;  5AI8 A;  1U7K A;  9ICO A;  2RLT A;  2QAR A;  1Z19 A;  1NZB A;  4J93 A;  4ED0 A;  2LHT A;  1S10 A;  3GDX A;  3G6V A;  2ZXI A;  4QW8 A;  2GO7 A;  4C0Z A;  4J9O A;  1X9S A;  2OHF A;  4QIW F;  2V4R A;  4KMU A;  4RT2 A;  3CP8 A;  5KFL A;  3PR4 A;  1N56 A;  2XCA A;  2FDR A;  5TIS U;  5AK4 A;  3E0F A;  2YML A;  5ALI A;  3I76 A;  2KSO A;  3KBB A;  3N7P D;  1ZET A;  4KLI A;  1NOM A;  1B4F A;  1UT5 A;  2AJQ A;  1AQ6 A;  3GZF A;  3SD7 A;  5ALD A;  5CWR A;  2R8I A;  2YMQ A;  4E92 A;  2EZY A;  1ARO P;  2M9N A;  4YQW A;  3C2M A;  4Y2P A;  1NK9 A;  1NJW A;  3EPG A;  3D2Q A;  1SL2 A;  4P0P A;  1S76 D;  4F5O A;  4KLQ A;  3PNC A;  4UB8 U;  1NJX A;  1LKY B;  2ZIX B;  4P4P A;  1OXJ A;  2KFZ A;  4DL7 A;  2KMD A;  1Q46 A;  2EAM A;  4C7Y A;  4QZ8 A;  2W7P A;  3KFU F;  3RJH A;  5KFW A;  3CNH A;  2XO7 A;  5EWF A;  4ECZ A;  3SAH A;  3H40 A;  5KG3 A;  4J9R A;  4C8K A;  8ICA A;  1DXS A;  2BCQ A;  5KG6 A;  1N5W A;  4UAS A;  2RRD A;  2EQY A;  9ICH A;  4EZ6 A;  2MAX A;  3PO4 A;  1L7M A;  2KEY A;  5BOM A;  2BCR A;  5KG7 A;  2XY5 A;  5KFF A;  2PXR C;  1AK4 C;  4MFC A;  2WB1 C;  5ALO A;  4UAR A;  5CEH A;  3WKC A;  4RNN A;  1L3T A;  2Y4Z A;  1QH9 A;  4F5R A;  1L8L A;  3BQ1 A;  5CB1 A;  4FBU A;  3AU2 A;  4YFK A;  3SYZ A;  4F8R A;  2F44 A;  5BOL A;  2PI4 A;  3H8W A;  1D9D A;  1S97 A;  5AIC A;  4M9N A;  2LMR A;  5IIM A;  4C8L A;  1DGS A;  5ALT A;  1NKE A;  4DFD A;  3GIK A;  4B9T A;  1SV4 A;  4C80 A;  5AKG A;  3TQ1 A;  1TK0 A;  5ALN A;  1U49 A;  3TKA A;  4IQT A;  3LWL A;  1T7P A;  2WLV A;  4UB5 A;  5HHI A;  4CRX A;  2JV3 A;  4TUP A;  5AI5 A;  3HT3 A;  4DSE A;  5AIA A;  3IDW A;  3TAD C;  3AQE A;  4QZA A;  3LYS A;  4RQ6 A;  1QCK A;  2CXY A;  4UB6 U;  4LZG A;  2JMG A;  2PI5 A;  4EYH B;  2GH1 A;  3HKZ F;  5AKZ A;  1KKX A;  5EWG A;  3IRU A;  4U0D A;  2H3I A;  3UPQ A;  4Y2U A;  5KFK A;  2A3V A;  1X9X A;  3D6J A;  4DL5 A;  3DDH A;  1HIW A;  4P4M A;  1RM6 C;  1KSP A;  2ZUC A;  5D4B A;  5HR6 A;  4Q43 A;  5CA7 A;  1NK0 A;  3AQF A;  5DB9 A;  3RTV A;  2KG5 A;  2MUT A;  1WUD A;  4RQM A;  3MFH A;  3NVW A;  7ICN A;  3RH4 A;  2YMM A;  1SKS A;  1L3U A;  1S5L U;  2AXT U;  2UVU A;  3C1Z A;  2OM6 A;  3GIM A;  2KKP A;  4UAV A;  4NLZ A;  4G9B A;  5DLF A;  1TAQ A;  1XO0 A;  8ICY A;  4J9P A;  3KTQ A;  2H3Q A;  3V6H A;  4B9M A;  3MAB A;  4F72 A;  5CP2 A;  3JPP A;  2KJ9 A;  1L7P A;  1KW4 A;  2ZIU B;  2JXJ A;  2ZJ8 A;  3RR8 A;  5J8Y A;  1RYR A;  4US8 A;  3AUO A;  3GQC A;  1RQN A;  2M8N A;  1JUD A;  2ZIW A;  2AQ4 A;  2H5X A;  2G07 A;  2KZ3 A;  5DG9 A;  2K4I A;  2JH1 A;  1ZQG A;  5C0Y A;  4PHP A;  4RPZ A;  1UPH A;  3V6K A;  4RT3 A;  1XSL A;  4C8O A;  2K8A A;  3A0H U;  3GU3 A;  4QZE A;  4F2S A;  4I2J A;  5ALV A;  1TAU A;  4PPX A;  4BXO A;  2JZB A;  3TFS A;  5DQI A;  1L3S A;  4I2C A;  5JPA A;  3SAG A;  3HJE A;  2ALZ A;  4F4W A;  5ALW A;  3LVV A;  1ZQL A;  1L8O A;  4C7Z A;  2F76 X;  5KG0 A;  2PWO A;  2BQR A;  4YMM A;  3JPS A;  2QLT A;  9ICW A;  4QIW C;  7ICK A;  4F71 A;  4K4H A;  5KAF U;  5DB6 A;  3Q8R B;  4UB4 A;  4GIB A;  5KT5 A;  1HUZ A;  2W54 A;  4Y2T A;  3TAQ A;  2OWO A;  5J0U A;  2BZF A;  3QU9 A;  4I2H A;  1MQ3 A;  4EYI B;  5AK5 A;  2ASL A;  1L5U A;  3K75 D;  3RJF A;  4PGY A;  1O08 A;  4XRO A;  2IMW P;  4JV0 A;  3HPO A;  4DO9 A;  1ZRN A;  3RJI A;  2VA8 A;  1VLB A;  2UVW A;  1ZQR A;  4QJF B;  5ALM A;  3PZP A;  4IR1 A;  3MFI A;  4I2D A;  1ZQV A;  3SZ2 A;  3SMV A;  5EE1 A;  3BS5 A;  4NM1 A;  4O3O A;  5KL1 B;  5KG5 A;  2YY6 A;  1UA0 A;  2DPJ A;  4Y2Q A;  5HGM A;  2OYY A;  3O0F A;  3RB0 A;  4JUZ A;  1Z1V A;  4RQ4 A;  1M9Y C;  2E8N A;  3K4G A;  2JZB B;  4M9H A;  2F8K A;  5AIB A;  2LF4 A;  1SV0 C;  1Z4N A;  5CR0 A;  4DL3 A;  4OO1 J;  2E8O A;  1QQ5 A;  4ED3 A;  1TE2 A;  5AKE A;  2AQ0 A;  5KFZ A;  4GXJ A;  8ICN A;  4KLD A;  1GWP A;  4XRQ A;  3ZDC A;  4F4K A;  9ICI A;  9ICV A;  1L3V A;  4RQ1 A;  3WKA A;  2IHN A;  1PK1 A;  4Y2Y A;  3JPR A;  1CRX A;  2P35 A;  5ALR A;  5GTH U;  2W7O A;  4O3N A;  2J6T A;  2K8B B;  2LKY A;  1MC8 A;  3KOO A;  2OH2 A;  5L1M A;  1Q3V A;  4ELU A;  3RH5 A;  2KNJ A;  4NJ8 A;  4NXZ A;  4YCX A;  3BDP A;  1UT8 A;  5CHG A;  2P6R A;  2RP5 A;  2PXI A;  2XCP A;  1ZD2 P;  1KN5 A;  2CPR A;  5ALH A;  1BVS A;  4UAT A;  4YR2 A;  3PO5 A;  2BDU A;  2E1F A;  4YD2 A;  3A0B U;  4QZ9 A;  2D6F C;  4EBD A;  4GXI A;  1RXV A;  4KLO A;  2P66 A;  4QWB A;  2H3Z A;  4ELV A;  4CF4 A;  4DGA C;  1KFD A;  4UAY A;  2FJ6 A;  2VAN A;  4UBC A;  4RQ5 A;  5F9L A;  2PKE A;  3SAF A;  3IV6 A;  9ICJ A;  4C8M A;  2ATL A;  4CE6 A;  9ICQ A;  4KLU A;  3H0M B;  1WCN A;  4ECT A;  2MSN A;  1S77 D;  3KKA C;  3P05 A;  4GC7 A;  1Q8K A;  4NLB A;  7ICM A;  5KFT A;  3GIJ A;  2ES6 A;  4ED7 A;  5KAI U;  2Y9U A;  1KTQ A;  4ECW A;  2NRZ A;  5KFJ A;  2K4E A;  5DBB A;  3QEA Z;  4OJP A;  1NK5 A;  4KMO B;  2WF6 A;  7ICE A;  2WF8 A;  3HKZ C;  3MGE A;  4UB2 A;  4F93 B;  3PW2 A;  5KTQ A;  5KT7 A;  4LQW C;  3FYH A;  2F1I A;  3MGH A;  3IM1 A;  4IL6 U;  4DOC A;  5J2C A;  4Z6D A;  4DS5 A;  1N61 A;  5DG7 A;  2DBY A;  2H3F A;  1F0M A;  3AL0 B;  2I6X A;  2ODG A;  3PST A;  1V85 A;  3WK4 A;  5J29 A;  3F5A A;  2WF9 A;  2XI9 A;  5KFG A;  4DGE C;  1LVH A;  2VA2 A;  1SL1 A;  4G3I A;  4ED1 A;  3ZDB A;  7ICR A;  4YN4 A;  3PW4 A;  2K4H A;  5D46 A;  4M04 A;  4ECV A;  3M1Y A;  2KVS A;  4DQS A;  4JWN A;  2VKQ A;  2ZJA A;  2AGO A;  3PW7 A;  1ZQH A;  3RJG A;  4I2F A;  4KLF A;  2HHT A;  2WF5 A;  3C21 A;  4I2B A;  4F4Z A;  4DLE A;  4Q8F A;  3QUC A;  4AP9 A;  4RPX A;  4KLG A;  3H4D A;  3NUQ A;  2KKV A;  5A0L A;  3MBY A;  1X6I A;  7ICU A;  4O5E A;  5EE9 A;  3T5K A;  2W9C B;  3N97 B;  4US9 A;  3IG8 A;  2E1E A;  3ICX A;  3QXG A;  1L7N A;  4KIT B;  3AEV A;  3RF9 A;  2WHE A;  1M9X C;  1EXN A;  3BQ0 A;  5J0T A;  2I1Q A;  5IIL A;  2LYH A;  3RH6 A;  3ZDD A;  1LKY A;  2QKQ A;  2ZIX A;  1IIP A;  4DFJ A;  5J8Y C;  1D8Y A;  4OJO A;  5KFA A;  3RAX A;  4EEK A;  5DB8 A;  4DS4 A;  2W9B A;  1K5O A;  3J81 j;  2DKZ A;  2HW3 A;  4K4G A;  1DK3 A;  3F2B A;  2YMP A;  4UAZ A;  1NK8 A;  3SV4 A;  1N2X A;  3QU2 A;  2BQU A;  1RZT A;  2W8L A;  2HCF A;  5DBC A;  3QX7 A;  4B4N A;  4CDG A;  2W03 A;  4GLX A;  3ALR A;  4IQV A;  5TZV A;  4ECY A;  3WK5 A;  4B9V A;  3HW8 A;  8ICS A;  5AM0 A;  5ALF A;  1MA7 A;  4YXJ A;  2X83 A;  3AM9 A;  1PVQ A;  4J9N A;  2EAO A;  4MEY A;  4UW9 A;  1O03 A;  2K60 A;  3L5K A;  1HJP A;  1NKC A;  1ZQJ A;  2HHU A;  2GOL B;  4M2Y A;  3RBE A;  2DKX A;  3MC1 A;  3UXP A;  3I28 A;  3EWA A;  1V9P A;  3QE9 Y;  1URJ A;  2BCS A;  3FM9 A;  1TV9 A;  8ICF A;  2DF4 B;  1MQ2 A;  4IQU A;  1P7D A;  3ETL A;  3WK7 A;  1ECW A;  3QU4 A;  1ZJM A;  1K1Q A;  9ICA A;  5JTI A;  4BWM A;  1RYS A;  4TUS A;  2Y1J A;  2B0C A;  1ZQM A;  4YR0 A;  4QW9 A;  2ZTE A;  4FZN A;  1Y88 A;  1YZ6 A;  2W9B B;  5KFO A;  4J9S A;  2NO4 A;  1AFV A;  1ZQE A;  2EIA A;  4U0F A;  4J9K A;  2AH5 A;  5AKI A;  4RQ0 A;  1JX4 A;  8ICG A;  5AK3 A;  2VJ5 A;  1BPX A;  1QTM A;  2F1J A;  4I2E A;  4BUG A;  4YP3 A;  2ZTD A;  3UXN A;  4TQS A;  4EX7 A;  2EZX A;  4KN7 A;  1T3Q A;  3ONN A;  3PSF A;  5DDM A;  4DSI A;  2CRX A;  1F44 A;  3Q8S B;  3MR3 A;  5J0O A;  5F9N A;  4FE3 A;  4EEY A;  1UHU A;  3N7S C;  1ZQU A;  5KFH A;  3CYM A;  2BPG A;  2PFN A;  1ZQP A;  3TAC B;  1X40 A;  3RFA A;  2ISO A;  2KP7 A;  5DBA A;  1QSL A;  3RJJ A;  4AYB F;  2YN4 A;  3NAS A;  1ZRM A;  5JU5 A;  3KZI U;  4ECQ A;  1IV8 A;  3T5J A;  5HHH A;  5J2A A;  3IG5 A;  5KFC A;  5HGN A;  1N5X A;  2RQ5 A;  1QQ7 A;  2F77 X;  3N7R C;  2KGF A;  2G08 A;  2ZIU A;  1FO4 A;  4JV2 A;  4E91 A;  1JRP A;  5ALP A;  3N4M B;  1XS9 D;  2GLE A;  2E3T A;  5G5H A;  4MHV A;  3OSP A;  4PH0 A;  3AN1 A;  3OTQ A;  4BWJ A;  3UQ2 A;  4NLC A;  3C5F A;  5HGL A;  4I27 A;  1OUQ A;  3WK6 A;  2IHM A;  4C4T A;  2LYA A;  2HBJ A;  8ICC A;  3B0X A;  3GIL A;  1JRO A;  3F53 A;  2O6K A;  2HOF A;  4IRD A;  5CJ7 A;  1ZQT A;  3B9J A;  2ESE A;  1NI3 A;  2UVR A;  3CW2 C;  1T4G A;  5KFS A;  4FO6 A;  2HMX A;  2KHV A;  5T14 A;  1S9F A;  1Z4O A;  2KVC A;  1XWL A;  4U0C A;  2PMZ F;  2KHQ A;  3ZDA A;  5AI9 A;  4PL2 A;  3NVZ A;  1WCL A;  2E8M A;  1B22 A;  1E6J P;  2LI6 A;  5J2K A;  2KIV A;  4O3M A;  1X2I A;  3ISD A;  4KLS A;  3HRD D;  4UB3 A;  2MRL A;  2VJ4 A;  5KT4 A;  1X66 A;  1ZD3 A;  5B66 U;  9ICP A;  1YT3 A;  7ICV A;  3ZD8 A;  4OJL A;  3G6Y A;  2AGQ A;  8ICW A;  4TUQ A;  1L6N A;  1XSN A;  2FE9 A;  3C1Y A;  2EAN A;  5D49 A;  4U0B A;  3EPI A;  3R9K A;  4YG2 A;  1BNO A;  1ZQZ A;  4QWA A;  4O3S A;  2KJ5 A;  2LYB A;  1S0O A;  1ZQN A;  3FAH A;  3C29 A;  2MA1 A;  4ELT A;  4DF4 A;  3H8M A;  3PR5 B;  2A1A A;  2R8H A;  4DSF A;  5AHX A;  2R8G A;  4Z6E A;  2JEG A;  4O9M A;  2EH9 A;  1S0M A;  3ZD9 A;  3H8S A;  5HGO A;  1JIH A;  2KD1 A;  1BPY A;  1D1D A;  1QSY A;  2J6U A;  1ZQO A;  1BPE A;  4DOB A;  4B9N A;  1XU4 A;  5FP0 A;  4DCC A;  2R8J A;  5KNI A;  1COK A;  3NTE A;  4DSL A;  8ICP A;  1ZQX A;  3Q8Q B;  4IR9 A;  8ICE A;  1C20 A;  4NL9 A;  2HVI A;  2KZZ A;  2X82 A;  1QRJ A;  2HHV A;  5KG1 A;  5L1I A;  9ICG A;  3SR6 A;  2J6S A;  2VA3 A;  2BDP A;  2X2D D;  3OJS A;  7ICG A;  3EZ5 A;  2A1J B;  4KLJ A;  4NY8 A;  4PGX A;  5ALL A;  2FPM A;  4PGQ A;  2H3V A;  5HR7 A;  4NX4 C;  3GV8 B;  3PVX A;  4UBB A;  1SL0 A;  1SKW A;  2NRT A;  2MU2 A;  1KL9 A;  1FFV A;  4Z6F A;  2WF7 A;  5J0Y A;  4YD1 A;  1NK4 A;  5J0S A;  4UAW A;  5AKX A;  1SZP A;  4GC6 A;  7ICL A;  8ICI A;  3F5E A;  5AI0 A;  4OJ5 A;  4M6W B;  2KV2 A;  3VC8 A;  3KHL A;  1HEK A;  5KFP A;  4DSJ A;  2K8C B;  2WFA A;  3C2K A; 
#chains in the Genus database with same CATH homology
 2XI9 A;  2KJ8 A;  1KBU A;  4WJ3 B;  4XFZ A;  4DGE C;  2Y0S C;  3D2Q A;  1SZH A;  4P0P A;  3T79 A;  4GFJ A;  3OPX A;  2XGV A;  2ZIX B;  2K4H A;  4QNB A;  2JGA A;  3D2N A;  2W7P A;  2VKQ A;  3KFU F;  2XGY A;  2DQN B;  3SAH A;  4KX3 A;  3NUQ A;  2RRD A;  2KKV A;  5A0L A;  2JH7 A;  2KEY A;  2WLV B;  4HTW A;  2CN1 A;  2PXR C;  1AK4 C;  3LVW A;  2WB1 C;  3IG8 A;  2E1E A;  4AYB C;  4JMU A;  3ICX A;  2XIC A;  4U0E A;  3RF9 A;  1M9X C;  2Y4Z A;  1A0P A;  3VCB A;  4U0A A;  2ZG6 A;  2ZIX A;  1IIP A;  2N1R A;  4OJO A;  1Q3U A;  3F2B A;  3H4E A;  2WAQ F;  4B4N A;  2M0N A;  4CDG A;  2W03 A;  3ALR A;  1M9F C;  1MA7 A;  2X83 A;  2WLV A;  1PVQ A;  3SQI A;  4CRX A;  4U6P A;  2R18 A;  5HGK A;  1ZQ1 C;  4WYM A;  3H47 A;  3AQE A;  4FZL A;  1M9D C;  4NWI A;  4P0Q A;  4CGZ A;  2GOL B;  3LYS A;  4ICA A;  2VIX A;  2PMZ C;  2ZXH A;  2JMG A;  5CRX A;  2KOB A;  2GH1 A;  3HKZ F;  1URJ A;  2DF4 B;  2KIC A;  2XGU A;  2GON A;  2ZIW B;  1P7D A;  4U0D A;  1ECW A;  4BJQ A;  2H3I A;  2A3V A;  2M8P A;  2Q4T A;  1HIW A;  5KL8 B;  4OJ6 A;  5HR6 A;  2G06 A;  3AQF A;  2XVT A;  1M9C C;  1WUD A;  4FZN A;  4PH2 A;  2M8L A;  4A8E A;  1AFV A;  2Y0S F;  2EIA A;  2OM6 A;  2G09 A;  4U0F A;  2KKP A;  1T94 A;  1XO0 A;  2H3Q A;  2V4X A;  2VJ5 A;  2OXO A;  2ZIV B;  2G5H B;  2Z7J A;  2KJ9 A;  4QNL A;  1GO3 F;  2ZIU B;  4BUG A;  2GOL A;  2XDE A;  4NV0 A;  3ONN A;  3PSF A;  4KX5 A;  2CRX A;  1F44 A;  2YX8 A;  4P0Q B;  2F8L A;  2JHD A;  1Z1B A;  1M9E C;  2M8N A;  2ZIW A;  2G07 A;  4FE3 A;  2K4I A;  2JH1 A;  5C0Y A;  3IN5 A;  3N7S C;  1UPH A;  3CYM A;  2YB1 A;  2K8A A;  3F2C A;  3GU3 A;  3RFA A;  2WB1 F;  3KZX A;  4AYB F;  5JPA A;  3M7D A;  3SAG A;  1P7N A;  2HBM A;  2DGZ A;  2HBK A;  3LVV A;  2F76 X;  1DRG A;  2PWO A;  3M6Z A;  3BP9 A;  3IP4 B;  3IG5 A;  4QIW C;  5HGN A;  2ZIV A;  2F77 X;  3PSP A;  3N7R C;  2KGF A;  2G08 A;  2ZIU A;  2G0A A;  3H0R B;  4E91 A;  4IC9 A;  3PSI A;  4XFY A;  1XNS A;  4PH0 A;  4XRO A;  4NLC A;  5HGL A;  1OUQ A;  3C28 A;  2LYA A;  2HBJ A;  4QJF B;  2YB4 A;  3PZP A;  3F53 A;  2HBL A;  2HOF A;  4BX9 C;  2PWM A;  3SMV A;  2HMX A;  1D8B A;  3D2S A;  2KHV A;  5T14 A;  4PL1 A;  3L3F X;  1TAM A;  5KL1 B;  2KVC A;  4U7C A;  2NV3 A;  1PVP A;  4U0C A;  5HGM A;  2OYY A;  2PMZ F;  3O0F A;  2KHQ A;  1M9Y C;  3NRW A;  4PL2 A;  2LF4 A;  2HOQ A;  4OO1 J;  1E6J P;  3DEE A;  1GWP A;  4XRQ A;  1A6S A;  4O3M A;  2G5I B;  3CRX A;  1CRX A;  2K89 A;  3K1Z A;  1PVR A;  2MRL A;  2VJ4 A;  2W7O A;  1YT3 A;  2K8B B;  2LKY A;  2XID A;  4OJL A;  2OH2 A;  1Q3V A;  2KNJ A;  1L6N A;  2F2A B;  1G03 A;  3MGV A;  4PH3 A;  4U0B A;  2RP5 A;  4ACO A;  4XFX A;  2CPR A;  2KJ5 A;  2LYB A;  3C29 A;  2MA1 A;  2BDU A;  2E1F A;  2RHF A;  2D6F C;  2HOI A;  2H3Z A;  4DGA C;  2WAQ C;  5HGO A;  2KD1 A;  2KIW A;  1D1D A;  3H0L B;  3SAF A;  2LBO A;  3NTE A;  3H0M B;  4P0P B;  3P05 A;  4NLB A;  2X82 A;  1QRJ A;  3M6K A;  2X2D D;  1U7K A;  2K4E A;  1Z19 A;  1NZB A;  4OJP A;  4J93 A;  4KMO B;  2LHT A;  2H3V A;  2ZXI A;  5HR7 A;  3HKZ C;  4NX4 C;  4C0Z A;  1ED1 A;  3MGE A;  4QIW F;  2E5S A;  4LQW C;  2JPR A;  3CP8 A;  1EM9 A;  2W04 A;  4INB A;  3E0F A;  1EIA A;  3F5E A;  4OJ5 A;  3N7P D;  2H3F A;  2KV2 A;  3AL0 B;  3VC8 A;  1HEK A;  3F2D A;  3GZF A;  3PST A;  2K8C B;  4E92 A;  4FZM A;  3F5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...