4XFYA

Structure of the native full-length dehydrated hiv-1 capsid protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
216
Chain Sequence
PIVQQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 71
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfyA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfyA02
2XGYA 2WLVA 2JYLA 4E92A 2XV6A 3DS4A 2JO0A 4XFYA 3H4EA 2XT1A 4U0DA 1GWPA 5HGKA 4U0CA 4XFXA 1A43A 1U7KA 3G29A 4U0EA 2PXRC 2X2DD 4PH0A 3DTJA 4PH3A 5JPAA 4B4NA 4COCA 2PWOA 3G28A 2GONA 1M9DC 3H47A 1E6JP 2M8NA 4IPYA 5HGNA 2GOLB 4XRQA 5I4TG 2XDEA 2WLVB 3BP9A 1QRJA 4U0AA 1M9FC 2L6EA 2M8PA 4PH2A 1EOQA 4U0FA 4QNBA 4LQWC 2PWMA 4M0IA 4E91A 3MGEA 1AFVA 2KGFA 1D1DA 4J93A 4COPA 2Y4ZA 3NTEA 4PH1A 4WYMA 3LRYA 4XROA 1BAJA 3DS3A 2EIAA 1EM9A 4NX4C 3P05A 2JYGA 1P7NA 3G26A 1M9CC 3DPHA 2ONTA 1AK4C 1AUMA 2XXMA 4INBA 5HGOA 3DS5A 4XFZA 4U0BA 2BUOA 2X82A 2KODA 3G1GA 2XGVA 4HTWA 3G1IA 1A8OA 1EIAA 3G0VA 3G21A 3DS1A 5DCKA 3VRLC 5HGLA 4DGEC 1M9EC 2XGUA 2LF4A 2V4XA 2M8LA 1G03A 3DS0A 3DS2A 4DGAC 1M9XC 1L6NA 2JPRA 5HGMA 1M9YC 2X83A
chains in the Genus database with same CATH superfamily
4NEOA 1KLPA 2WLVA 1QVGO 1E0HA 2K0DX 2EHTA 2FQ2A 2CG5B 2VLQA 2XT1A 4U0CA 2CNRA 4XFXA 7CEIA 2KGCA 2N6YA 2X2DD 1HY8A 1IMQA 3RG6C 3CCVP 3I56P 1OR5A 2JB0A 1VHNA 2EHSA 2JBGA 2KR5A 3CCQP 1KD1Q 3CD6P 2KG9A 4XRQA 5I4TG 2LTEA 3BP9A 1ZNVA 1M9FC 2GDYA 4PH2A 1Q82Q 2GZFA 1K73Q 2Z45A 4M0IA 3B4QA 2KWLA 3MGEA 2GDWA 1AFVA 2QEXP 1YJ9P 2KGFA 4J93A 2EFJA 3CC4P 1Q81Q 3NTEA 2EIAA 4NX4C 2JQ4A 2GZGA 1M90Q 2ONTA 1AUMA 2WPTA 2N98A 2N5HA 3GJNA 3U43A 3CCJP 3OW2O 2X82A 2KODA 2AVAA 1GXHA 2PNGA 1M9EC 1YJWP 2LKIA 1CEIA 2FHSC 3DS2A 3B5IA 4DGAC 1M9XC 2CGQA 3EJBA 1YI2P 3CCEP 2K92A 1M9YC 1L0IA 3Q20A 2V4XA 2X83A 2K0YA 2PY8A 1HQBA 4XFYA 3G4SP 2MVUA 3H4EA 2GZJA 5HGKA 3LMOA 2JU1A 5KP7B 3GKLC 2FQ1A 1JJ2O 2KGDA 4U0EA 1DNYA 5BS1A 2MY5A 2PWOA 3G28A 1M9DC 1UJZA 5HVCA 3CMEP 1NJIQ 3CC7P 5BS2A 2LPKA 1QRJA 4U0AA 2L6EA 2FQ0A 1VQ8P 1VQMP 2LL8A 2LIUA 2L9FA 1GXGA 1IMPA 1D1DA 5KP8B 3CMAP 1F80D 2JAZA 4WYMA 2DGYA 5KP6B 1EM9A 2AFEA 1UNKA 1P7NA 2BHVA 1VQPP 1Q7YQ 4XFZA 2BUOA 3CCMP 3G1GA 2XGVA 1FR2A 4HTWA 3G1IA 3G0VA 1K8AQ 5F2KA 1VQLP 1VQ4P 3DS1A 2GDXA 2FAEA 5CZDB 2XGUA 3H0DA 2LF4A 2XZ0D 5EJDA 2L0QA 1VQ5P 3DS0A 3CCRP 4H2YC 2Z46A 1VQ9P 4BPHA 2VLNA 2PENA 2FVFA 2XGYA 4CA3A 2FACA 2VLOA 1M6NA 3I55P 2OTLP 1X3OA 4E92A 2FVEA 3DS4A 2JO0A 4F37A 1VQ6P 1EMVA 3G71P 1A43A 2ROQA 2DNWA 5JPAA 4B4NA 3CCSP 2FVAA 2KG8A 2KOSA 2K93A 2M8NA 1DV5A 4IPYA 5HGNA 1VQ7P 1Z6MA 1ZMBA 1VQKP 2KOQA 4H2WC 1MZ8A 3HYBA 2CWOA 1EOQA 4U0FA 4QNBA 4LQWC 2PWMA 1AYIA 3E2DA 4E91A 1Q86Q 2ERHA 2P9XA 4BPFA 2VLPA 4COPA 1AF8A 2MF4A 4PWVB 4XROA 1BAJA 3CE7A 1K30A 2K0XA 2K94A 2NO8A 1N8RQ 3G26A 2PEQA 2MR7A 2KGEA 2XXMA 2AF8A 4INBA 5HGOA 2MVVA 4U0BA 2L22A 3EJDA 2OARA 1A8OA 3M1MA 1EIAA 2OTJP 2LIWA 2MR8A 5DCKA 3VRLC 2KW2A 1YJNP 2X2BA 4MRTC 4BPGA 2XZ1C 3CCLP 4PXHB 5HGMA 5F2NA 2JU2A 2PEOA 2GYKA 4UHPB 3RG2A 2KGAA 2PEJA 1KQSO 2JYLA 2XV6A 1YITP 2VSQA 1YHQP 1M1KQ 4U0DA 1GWPA 1U7KA 1VKUA 2K2QA 2LMLA 1RO2A 3G29A 2JGPA 2PXRC 4PH0A 1NQ4A 3DTJA 4PH3A 3CPWO 2FADA 4COCA 2GONA 3H47A 1E6JP 4GR6A 2M5RA 1RNIA 2GOLB 2KOPA 2QA4P 2XDEA 2WLVB 1T8KA 2M8PA 2QNWA 3WBHA 1BXIA 3EJEA 3CC2P 4HKGA 2L4BA 2Y4ZA 4DG9A 2N5IA 5HV8A 2GZIA 4PH1A 3GZMA 3GZLA 3LRYA 3DS3A 5EW5E 1L0HA 2CQ8A 3P05A 2KOOA 2KG6A 2MD9A 4GR2A 1VQOP 2JYGA 1M9CC 3HZQA 3DPHA 2PEIA 1AK4C 2K5XA 5F2OA 1ACPA 2PEMA 4H2XC 2AFDA 2Z44A 2PEKA 1RO0A 3DS5A 2KORA 1KC8Q 4IZ6A 1M74A 4R0MA 1W2BO 3G21A 3CCUP 1GPJA 2N50A 2GZEA 1YIJP 5HGLA 4DGEC 2E1MA 2N6ZA 1QVFO 1K9MQ 4QKOA 2M8LA 1G03A 1L6NA 2EG5A 2JPRA 3G6EP 1VQNP 3CXCO 1IUQA 1M6EX 1S72P 2LOLA 3NY7B
chains in the Genus database with same CATH topology
2PENA 2XGYA 2PY8A 1M6NA 2PEJA 3I55P 2WLVA 1QVGO 1KQSO 2OTLP 2JYLA 4E92A 2XV6A 3DS4A 2JO0A 1YITP 4XFYA 3G4SP 1VQ6P 1YHQP 1M1KQ 3H4EA 2XT1A 4U0DA 1GWPA 3G71P 5HGKA 4U0CA 4XFXA 1A43A 1U7KA 1RO2A 3G29A 1JJ2O 4U0EA 2PXRC 2X2DD 4PH0A 3DTJA 4PH3A 5JPAA 3CPWO 4B4NA 3RG6C 5BS1A 4COCA 3CCSP 2PWOA 3CCVP 3G28A 2GONA 3I56P 1M9DC 3CMEP 1NJIQ 3H47A 1E6JP 2M8NA 4GR6A 4IPYA 3CC7P 3CCQP 5HGNA 1KD1Q 3CD6P 1VQ7P 5BS2A 1RNIA 2GOLB 4XRQA 5I4TG 1ZMBA 2XDEA 2QA4P 2WLVB 1VQKP 3BP9A 1QRJA 4U0AA 1M9FC 2L6EA 2M8PA 3HYBA 2CWOA 4PH2A 1EOQA 1Q82Q 4U0FA 1VQ8P 1VQMP 4QNBA 3WBHA 4LQWC 1K73Q 2PWMA 2Z45A 4M0IA 3E2DA 3CC2P 4E91A 3MGEA 1Q86Q 1AFVA 2QEXP 1YJ9P 2KGFA 2P9XA 1D1DA 4J93A 4COPA 2Y4ZA 2EFJA 3CC4P 1Q81Q 3NTEA 3CMAP 4PH1A 4WYMA 2DGYA 3LRYA 4XROA 1BAJA 3DS3A 1K30A 2EIAA 1EM9A 4NX4C 3Q20A 3P05A 4GR2A 1VQOP 1N8RQ 1M90Q 2JYGA 1P7NA 3G26A 1M9CC 3HZQA 3DPHA 2PEIA 2ONTA 1AK4C 1AUMA 2PEQA 2BHVA 5F2OA 1VQPP 2PEMA 2XXMA 1Q7YQ 2Z44A 4INBA 5HGOA 2PEKA 1RO0A 3CCJP 3DS5A 4XFZA 4U0BA 3OW2O 2X82A 2BUOA 2KODA 1KC8Q 3CCMP 3G1GA 1M74A 2OARA 2XGVA 4HTWA 3G1IA 1W2BO 1A8OA 3M1MA 1EIAA 3G0VA 1K8AQ 3G21A 5F2KA 1VQLP 3CCUP 1VQ4P 2OTJP 3DS1A 5DCKA 3VRLC 1YJNP 1YIJP 5HGLA 4DGEC 1M9EC 2E1MA 1QVFO 1YJWP 1K9MQ 2XGUA 3H0DA 2LF4A 2V4XA 2M8LA 1G03A 1VQ5P 3DS0A 3DS2A 3B5IA 3CCRP 4DGAC 3CCLP 1M9XC 1L6NA 2EG5A 2JPRA 3G6EP 1VQNP 2Z46A 1YI2P 3CXCO 1VQ9P 3CCEP 5HGMA 5F2NA 1M9YC 1IUQA 1M6EX 1S72P 2PEOA 2X83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGY A;  2WLV A;  2JYL A;  4E92 A;  2XV6 A;  3DS4 A;  2JO0 A;  4XFY A;  3H4E A;  2XT1 A;  4U0D A;  1GWP A;  5HGK A;  4U0C A;  4XFX A;  1A43 A;  1U7K A;  3G29 A;  4U0E A;  2PXR C;  2X2D D;  4PH0 A;  3DTJ A;  4PH3 A;  5JPA A;  4B4N A;  4COC A;  2PWO A;  3G28 A;  2GON A;  1M9D C;  3H47 A;  1E6J P;  2M8N A;  4IPY A;  5HGN A;  2GOL B;  4XRQ A;  5I4T G;  2XDE A;  2WLV B;  3BP9 A;  1QRJ A;  4U0A A;  1M9F C;  2L6E A;  2M8P A;  4PH2 A;  1EOQ A;  4U0F A;  4QNB A;  4LQW C;  2PWM A;  4M0I A;  4E91 A;  3MGE A;  1AFV A;  2KGF A;  1D1D A;  4J93 A;  4COP A;  2Y4Z A;  3NTE A;  4PH1 A;  4WYM A;  3LRY A;  4XRO A;  1BAJ A;  3DS3 A;  2EIA A;  1EM9 A;  4NX4 C;  3P05 A;  2JYG A;  1P7N A;  3G26 A;  1M9C C;  3DPH A;  2ONT A;  1AK4 C;  1AUM A;  2XXM A;  4INB A;  5HGO A;  3DS5 A;  4XFZ A;  4U0B A;  2BUO A;  2X82 A;  2KOD A;  3G1G A;  2XGV A;  4HTW A;  3G1I A;  1A8O A;  1EIA A;  3G0V A;  3G21 A;  3DS1 A;  5DCK A;  3VRL C;  5HGL A;  4DGE C;  1M9E C;  2XGU A;  2LF4 A;  2V4X A;  2M8L A;  1G03 A;  3DS0 A;  3DS2 A;  4DGA C;  1M9X C;  1L6N A;  2JPR A;  5HGM A;  1M9Y C;  2X83 A; 
#chains in the Genus database with same CATH topology
 4NEO A;  1KLP A;  2WLV A;  1QVG O;  1E0H A;  2K0D X;  2EHT A;  2FQ2 A;  2CG5 B;  2VLQ A;  2XT1 A;  4U0C A;  2CNR A;  4XFX A;  7CEI A;  2KGC A;  2N6Y A;  2X2D D;  1HY8 A;  1IMQ A;  3RG6 C;  3CCV P;  3I56 P;  1OR5 A;  2JB0 A;  1VHN A;  2EHS A;  2JBG A;  2KR5 A;  3CCQ P;  1KD1 Q;  3CD6 P;  2KG9 A;  4XRQ A;  5I4T G;  2LTE A;  3BP9 A;  1ZNV A;  1M9F C;  2GDY A;  4PH2 A;  1Q82 Q;  2GZF A;  1K73 Q;  2Z45 A;  4M0I A;  3B4Q A;  2KWL A;  3MGE A;  2GDW A;  1AFV A;  2QEX P;  1YJ9 P;  2KGF A;  4J93 A;  2EFJ A;  3CC4 P;  1Q81 Q;  3NTE A;  2EIA A;  4NX4 C;  2JQ4 A;  2GZG A;  1M90 Q;  2ONT A;  1AUM A;  2WPT A;  2N98 A;  2N5H A;  3GJN A;  3U43 A;  3CCJ P;  3OW2 O;  2X82 A;  2KOD A;  2AVA A;  1GXH A;  2PNG A;  1M9E C;  1YJW P;  2LKI A;  1CEI A;  2FHS C;  3DS2 A;  3B5I A;  4DGA C;  1M9X C;  2CGQ A;  3EJB A;  1YI2 P;  3CCE P;  2K92 A;  1M9Y C;  1L0I A;  3Q20 A;  2V4X A;  2X83 A;  2K0Y A;  2PY8 A;  1HQB A;  4XFY A;  3G4S P;  2MVU A;  3H4E A;  2GZJ A;  5HGK A;  3LMO A;  2JU1 A;  5KP7 B;  3GKL C;  2FQ1 A;  1JJ2 O;  2KGD A;  4U0E A;  1DNY A;  5BS1 A;  2MY5 A;  2PWO A;  3G28 A;  1M9D C;  1UJZ A;  5HVC A;  3CME P;  1NJI Q;  3CC7 P;  5BS2 A;  2LPK A;  1QRJ A;  4U0A A;  2L6E A;  2FQ0 A;  1VQ8 P;  1VQM P;  2LL8 A;  2LIU A;  2L9F A;  1GXG A;  1IMP A;  1D1D A;  5KP8 B;  3CMA P;  1F80 D;  2JAZ A;  4WYM A;  2DGY A;  5KP6 B;  1EM9 A;  2AFE A;  1UNK A;  1P7N A;  2BHV A;  1VQP P;  1Q7Y Q;  4XFZ A;  2BUO A;  3CCM P;  3G1G A;  2XGV A;  1FR2 A;  4HTW A;  3G1I A;  3G0V A;  1K8A Q;  5F2K A;  1VQL P;  1VQ4 P;  3DS1 A;  2GDX A;  2FAE A;  5CZD B;  2XGU A;  3H0D A;  2LF4 A;  2XZ0 D;  5EJD A;  2L0Q A;  1VQ5 P;  3DS0 A;  3CCR P;  4H2Y C;  2Z46 A;  1VQ9 P;  4BPH A;  2VLN A;  2PEN A;  2FVF A;  2XGY A;  4CA3 A;  2FAC A;  2VLO A;  1M6N A;  3I55 P;  2OTL P;  1X3O A;  4E92 A;  2FVE A;  3DS4 A;  2JO0 A;  4F37 A;  1VQ6 P;  1EMV A;  3G71 P;  1A43 A;  2ROQ A;  2DNW A;  5JPA A;  4B4N A;  3CCS P;  2FVA A;  2KG8 A;  2KOS A;  2K93 A;  2M8N A;  1DV5 A;  4IPY A;  5HGN A;  1VQ7 P;  1Z6M A;  1ZMB A;  1VQK P;  2KOQ A;  4H2W C;  1MZ8 A;  3HYB A;  2CWO A;  1EOQ A;  4U0F A;  4QNB A;  4LQW C;  2PWM A;  1AYI A;  3E2D A;  4E91 A;  1Q86 Q;  2ERH A;  2P9X A;  4BPF A;  2VLP A;  4COP A;  1AF8 A;  2MF4 A;  4PWV B;  4XRO A;  1BAJ A;  3CE7 A;  1K30 A;  2K0X A;  2K94 A;  2NO8 A;  1N8R Q;  3G26 A;  2PEQ A;  2MR7 A;  2KGE A;  2XXM A;  2AF8 A;  4INB A;  5HGO A;  2MVV A;  4U0B A;  2L22 A;  3EJD A;  2OAR A;  1A8O A;  3M1M A;  1EIA A;  2OTJ P;  2LIW A;  2MR8 A;  5DCK A;  3VRL C;  2KW2 A;  1YJN P;  2X2B A;  4MRT C;  4BPG A;  2XZ1 C;  3CCL P;  4PXH B;  5HGM A;  5F2N A;  2JU2 A;  2PEO A;  2GYK A;  4UHP B;  3RG2 A;  2KGA A;  2PEJ A;  1KQS O;  2JYL A;  2XV6 A;  1YIT P;  2VSQ A;  1YHQ P;  1M1K Q;  4U0D A;  1GWP A;  1U7K A;  1VKU A;  2K2Q A;  2LML A;  1RO2 A;  3G29 A;  2JGP A;  2PXR C;  4PH0 A;  1NQ4 A;  3DTJ A;  4PH3 A;  3CPW O;  2FAD A;  4COC A;  2GON A;  3H47 A;  1E6J P;  4GR6 A;  2M5R A;  1RNI A;  2GOL B;  2KOP A;  2QA4 P;  2XDE A;  2WLV B;  1T8K A;  2M8P A;  2QNW A;  3WBH A;  1BXI A;  3EJE A;  3CC2 P;  4HKG A;  2L4B A;  2Y4Z A;  4DG9 A;  2N5I A;  5HV8 A;  2GZI A;  4PH1 A;  3GZM A;  3GZL A;  3LRY A;  3DS3 A;  5EW5 E;  1L0H A;  2CQ8 A;  3P05 A;  2KOO A;  2KG6 A;  2MD9 A;  4GR2 A;  1VQO P;  2JYG A;  1M9C C;  3HZQ A;  3DPH A;  2PEI A;  1AK4 C;  2K5X A;  5F2O A;  1ACP A;  2PEM A;  4H2X C;  2AFD A;  2Z44 A;  2PEK A;  1RO0 A;  3DS5 A;  2KOR A;  1KC8 Q;  4IZ6 A;  1M74 A;  4R0M A;  1W2B O;  3G21 A;  3CCU P;  1GPJ A;  2N50 A;  2GZE A;  1YIJ P;  5HGL A;  4DGE C;  2E1M A;  2N6Z A;  1QVF O;  1K9M Q;  4QKO A;  2M8L A;  1G03 A;  1L6N A;  2EG5 A;  2JPR A;  3G6E P;  1VQN P;  3CXC O;  1IUQ A;  1M6E X;  1S72 P;  2LOL A;  3NY7 B; 
#chains in the Genus database with same CATH homology
 2PEN A;  2XGY A;  2PY8 A;  1M6N A;  2PEJ A;  3I55 P;  2WLV A;  1QVG O;  1KQS O;  2OTL P;  2JYL A;  4E92 A;  2XV6 A;  3DS4 A;  2JO0 A;  1YIT P;  4XFY A;  3G4S P;  1VQ6 P;  1YHQ P;  1M1K Q;  3H4E A;  2XT1 A;  4U0D A;  1GWP A;  3G71 P;  5HGK A;  4U0C A;  4XFX A;  1A43 A;  1U7K A;  1RO2 A;  3G29 A;  1JJ2 O;  4U0E A;  2PXR C;  2X2D D;  4PH0 A;  3DTJ A;  4PH3 A;  5JPA A;  3CPW O;  4B4N A;  3RG6 C;  5BS1 A;  4COC A;  3CCS P;  2PWO A;  3CCV P;  3G28 A;  2GON A;  3I56 P;  1M9D C;  3CME P;  1NJI Q;  3H47 A;  1E6J P;  2M8N A;  4GR6 A;  4IPY A;  3CC7 P;  3CCQ P;  5HGN A;  1KD1 Q;  3CD6 P;  1VQ7 P;  5BS2 A;  1RNI A;  2GOL B;  4XRQ A;  5I4T G;  1ZMB A;  2XDE A;  2QA4 P;  2WLV B;  1VQK P;  3BP9 A;  1QRJ A;  4U0A A;  1M9F C;  2L6E A;  2M8P A;  3HYB A;  2CWO A;  4PH2 A;  1EOQ A;  1Q82 Q;  4U0F A;  1VQ8 P;  1VQM P;  4QNB A;  3WBH A;  4LQW C;  1K73 Q;  2PWM A;  2Z45 A;  4M0I A;  3E2D A;  3CC2 P;  4E91 A;  3MGE A;  1Q86 Q;  1AFV A;  2QEX P;  1YJ9 P;  2KGF A;  2P9X A;  1D1D A;  4J93 A;  4COP A;  2Y4Z A;  2EFJ A;  3CC4 P;  1Q81 Q;  3NTE A;  3CMA P;  4PH1 A;  4WYM A;  2DGY A;  3LRY A;  4XRO A;  1BAJ A;  3DS3 A;  1K30 A;  2EIA A;  1EM9 A;  4NX4 C;  3Q20 A;  3P05 A;  4GR2 A;  1VQO P;  1N8R Q;  1M90 Q;  2JYG A;  1P7N A;  3G26 A;  1M9C C;  3HZQ A;  3DPH A;  2PEI A;  2ONT A;  1AK4 C;  1AUM A;  2PEQ A;  2BHV A;  5F2O A;  1VQP P;  2PEM A;  2XXM A;  1Q7Y Q;  2Z44 A;  4INB A;  5HGO A;  2PEK A;  1RO0 A;  3CCJ P;  3DS5 A;  4XFZ A;  4U0B A;  3OW2 O;  2X82 A;  2BUO A;  2KOD A;  1KC8 Q;  3CCM P;  3G1G A;  1M74 A;  2OAR A;  2XGV A;  4HTW A;  3G1I A;  1W2B O;  1A8O A;  3M1M A;  1EIA A;  3G0V A;  1K8A Q;  3G21 A;  5F2K A;  1VQL P;  3CCU P;  1VQ4 P;  2OTJ P;  3DS1 A;  5DCK A;  3VRL C;  1YJN P;  1YIJ P;  5HGL A;  4DGE C;  1M9E C;  2E1M A;  1QVF O;  1YJW P;  1K9M Q;  2XGU A;  3H0D A;  2LF4 A;  2V4X A;  2M8L A;  1G03 A;  1VQ5 P;  3DS0 A;  3DS2 A;  3B5I A;  3CCR P;  4DGA C;  3CCL P;  1M9X C;  1L6N A;  2EG5 A;  2JPR A;  3G6E P;  1VQN P;  2Z46 A;  1YI2 P;  3CXC O;  1VQ9 P;  3CCE P;  5HGM A;  5F2N A;  1M9Y C;  1IUQ A;  1M6E X;  1S72 P;  2PEO A;  2X83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...