4XFYA

Structure of the native full-length dehydrated hiv-1 capsid protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
216
Chain Sequence
b'PIVQQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 71
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfyA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfyA02
2PXRC 3DS0A 1A8OA 1L6NA 1P7NA 4IPYA 5HGMA 2KGFA 2JYGA 3G1GA 4J93A 1GWPA 2PWMA 1EM9A 3LRYA 1E6JP 3DPHA 2GONA 3G1IA 4XRQA 4U0BA 1EIAA 4INBA 4DGAC 2XV6A 3DTJA 4LQWC 4U0DA 4U0FA 2KODA 2XXMA 2GOLB 1AK4C 3NTEA 3G21A 4NX4C 4PH1A 2XGVA 4E92A 1AUMA 3BP9A 4XFYA 4PH0A 2XGUA 2WLVB 1QRJA 3DS5A 3P05A 1M9YC 2Y4ZA 4COPA 3DS4A 5I4TG 4WYMA 2X83A 3G29A 2LF4A 3DS1A 1M9FC 4PH2A 2XT1A 4QNBA 5HGKA 2M8NA 2ONTA 5HGOA 1M9EC 3VRLC 4PH3A 1D1DA 4B4NA 4XROA 1A43A 3G28A 2V4XA 4U0CA 4XFZA 2M8LA 3MGEA 1U7KA 1G03A 3H47A 4DGEC 2XGYA 3G0VA 2M8PA 2PWOA 5HGNA 3DS3A 1M9CC 4COCA 4U0EA 3DS2A 4E91A 1AFVA 5JPAA 5HGLA 2X82A 1M9XC 1M9DC 2BUOA 1BAJA 3G26A 2JO0A 2XDEA 4M0IA 2L6EA 5DCKA 4U0AA 4XFXA 2JPRA 2WLVA 3H4EA 1EOQA 2EIAA 2X2DD 4HTWA 2JYLA
chains in the Genus database with same CATH superfamily
2PEOA 2PXRC 4MRTC 1VQPP 1IUQA 1VQ7P 2K2QA 1RO2A 2KGFA 2N6YA 2JYGA 3G1GA 3G4SP 1VQ8P 1M74A 2CNRA 1EM9A 2FVAA 2GZJA 3LRYA 1E6JP 4XRQA 2PY8A 2GZFA 1EIAA 1M90Q 4U0DA 2CQ8A 2XXMA 2GOLB 2AFEA 2AFDA 1YIJP 5EW5E 4NX4C 4E92A 1AUMA 2WLVB 1QRJA 2DGYA 1DNYA 2FQ2A 2AVAA 2QEXP 2X83A 4PH2A 1K9MQ 2ONTA 2GDYA 3RG6C 3WBHA 1UNKA 4XROA 1A43A 2JGPA 2K0XA 2Z46A 2V4XA 4U0CA 2PEJA 3EJDA 1VQLP 2DNWA 3Q20A 1MZ8A 3HYBA 4PXHB 2M8PA 2PWOA 3DS3A 2KWLA 3DS2A 2MF4A 4E91A 3CPWO 3CD6P 2JBGA 3LMOA 1M9DC 1GXGA 2WPTA 2BUOA 3CXCO 2JO0A 1N8RQ 3CC7P 4M0IA 1Q82Q 3M1MA 3CCJP 2JPRA 3H4EA 3CCVP 2JYLA 2GDWA 2KOPA 1OR5A 2LPKA 4IPYA 1F80D 2K94A 2N50A 1EMVA 2JU2A 4J93A 2PWMA 2FHSC 3DPHA 3G1IA 2FADA 2MY5A 5EJDA 3OW2O 4U0BA 3CCSP 3CMAP 5KP7B 2OARA 3DTJA 3EJEA 2LTEA 2KODA 4IZ6A 1AF8A 1YHQP 1M6EX 2KOQA 1Q7YQ 2JB0A 3CCLP 4PH0A 2KG6A 1ZMBA 3DS5A 2Y4ZA 4COPA 5I4TG 4WYMA 5KP8B 3DS1A 1M9FC 2JAZA 2XT1A 2LL8A 3GKLC 2N98A 2Z44A 3B4QA 1K73Q 1M6NA 3G28A 2CGQA 1ZNVA 4XFZA 1U7KA 3H47A 4DGEC 2M5RA 3G0VA 3E2DA 3U43A 5HVCA 5HGNA 5BS2A 3CCUP 1ACPA 4CA3A 4QKOA 2KG8A 1AFVA 2KOOA 3CCEP 2X82A 2EHSA 1IMPA 1FR2A 2OTJP 2KG9A 3G26A 1BAJA 2MR7A 1YJWP 2XDEA 2L6EA 2N5IA 1VQ5P 2Z45A 1YJ9P 2L9FA 3CCRP 2GZGA 1X3OA 1DV5A 1QVGO 2NO8A 2LIUA 1A8OA 1P7NA 3CMEP 1VQNP 5HGMA 1YI2P 1Z6MA 2KGCA 1GWPA 1L0IA 2GONA 2LKIA 2PNGA 1YITP 1JJ2O 1YJNP 4DGAC 2JU1A 2PEQA 2XV6A 2K5XA 5KP6B 1QVFO 2GZIA 5F2KA 2LIWA 1CEIA 2VLNA 4LQWC 2P9XA 2FVFA 2FACA 4HKGA 2KR5A 3G21A 2ERHA 2XGVA 4BPGA 2GDXA 2JQ4A 3DS4A 1KLPA 2N6ZA 1VHNA 2LF4A 3GJNA 4BPFA 2MD9A 4GR2A 4QNBA 4H2WC 2M8NA 5HGOA 1M9EC 2GYKA 2FAEA 4B4NA 2MVUA 3RG2A 3GZMA 2XZ0D 1RO0A 1S72P 1Q81Q 2L4BA 2CWOA 3MGEA 2FQ0A 1KC8Q 1BXIA 2K92A 4R0MA 4U0EA 2KGDA 2EHTA 4DG9A 2L22A 3G6EP 1W2BO 5JPAA 3CC2P 5HGLA 1NJIQ 2QA4P 1M9XC 2PEMA 2LOLA 2EG5A 4BPHA 2K0YA 5DCKA 2GZEA 4U0AA 5F2NA 4XFXA 1UJZA 2VSQA 1VQOP 2EIAA 2X2DD 1VQ4P 4NEOA 2VLPA 2QNWA 3CCMP 1M1KQ 3DS0A 2CG5B 1L6NA 3I56P 2PEKA 2BHVA 2E1MA 5BS1A 2XZ1C 4INBA 2EFJA 2PEIA 1VQ6P 4U0FA 1AK4C 3NTEA 2ROQA 1L0HA 4UHPB 4PH1A 1KQSO 1NQ4A 3BP9A 4XFYA 2XGUA 2L0QA 3CCQP 3P05A 1M9YC 2N5HA 2LMLA 4PWVB 2MVVA 3G29A 1VQMP 5HGKA 3B5IA 3VRLC 4PH3A 3I55P 1D1DA 1KD1Q 2VLQA 2PENA 1HY8A 1GPJA 1VKUA 2KW2A 2M8LA 1AYIA 1G03A 2FVEA 2XGYA 1VQKP 3CC4P 1RNIA 2MR8A 2KOSA 1GXHA 1K30A 2KGEA 1M9CC 4COCA 7CEIA 3G71P 3GZLA 1T8KA 3HZQA 2KORA 1VQ9P 2X2BA 1K8AQ 5F2OA 4H2XC 2VLOA 2K0DX 4GR6A 3H0DA 2K93A 4F37A 1IMQA 3EJBA 1E0HA 2WLVA 1HQBA 4H2YC 2FQ1A 3CE7A 1Q86Q 1EOQA 3NY7B 5HV8A 2OTLP 2KGAA 4HTWA 5CZDB 2AF8A
chains in the Genus database with same CATH topology
1QVGO 3CCMP 2PEOA 2PXRC 1M1KQ 3DS0A 1VQPP 1IUQA 1A8OA 1L6NA 1P7NA 4IPYA 3CMEP 1VQNP 1VQ7P 3I56P 5HGMA 1RO2A 2PEKA 1YI2P 2KGFA 2BHVA 2JYGA 3G1GA 3G4SP 2E1MA 4J93A 1VQ8P 1GWPA 2PWMA 1M74A 1EM9A 3LRYA 1E6JP 3DPHA 2GONA 3G1IA 5BS1A 4XRQA 3OW2O 4U0BA 2PY8A 1YITP 3CCSP 3CMAP 1JJ2O 1YJNP 1EIAA 4INBA 4DGAC 2EFJA 2OARA 2PEIA 2PEQA 2XV6A 1QVFO 3DTJA 5F2KA 1VQ6P 4LQWC 2P9XA 1M90Q 4U0DA 4U0FA 2KODA 2XXMA 2GOLB 1AK4C 3NTEA 1YIJP 1YHQP 1M6EX 4NX4C 3G21A 4PH1A 2XGVA 1KQSO 1Q7YQ 4E92A 1AUMA 3BP9A 3CCLP 4XFYA 4PH0A 2XGUA 2WLVB 1QRJA 1ZMBA 2DGYA 3DS5A 3P05A 3CCQP 1M9YC 2Y4ZA 4COPA 3DS4A 5I4TG 4WYMA 2X83A 2QEXP 3G29A 2LF4A 3DS1A 1M9FC 4PH2A 4GR2A 2XT1A 4QNBA 5HGKA 1VQMP 2M8NA 1K9MQ 2ONTA 5HGOA 1M9EC 3B5IA 3VRLC 4PH3A 3RG6C 3WBHA 1D1DA 3I55P 1KD1Q 2Z44A 1K73Q 2PENA 4B4NA 4XROA 1A43A 1M6NA 3G28A 2Z46A 1RO0A 2V4XA 4U0CA 2PEJA 1S72P 1Q81Q 4XFZA 1VQLP 2M8LA 2CWOA 3Q20A 3MGEA 1U7KA 1G03A 3H47A 4DGEC 2XGYA 1VQKP 3G0VA 3CC4P 1RNIA 3E2DA 3HYBA 2M8PA 2PWOA 5HGNA 3DS3A 1KC8Q 5BS2A 3CCUP 1K30A 1M9CC 4COCA 4U0EA 3DS2A 3G71P 4E91A 3HZQA 3CPWO 3CD6P 3G6EP 1AFVA 1W2BO 5JPAA 1VQ9P 3CC2P 3CCEP 5HGLA 1K8AQ 2X82A 5F2OA 1NJIQ 2OTJP 2QA4P 1M9XC 4GR6A 1M9DC 3H0DA 2PEMA 2EG5A 2BUOA 1BAJA 3G26A 3CXCO 2JO0A 1N8RQ 3CC7P 1YJWP 2XDEA 4M0IA 1Q82Q 2L6EA 5DCKA 3M1MA 4U0AA 3CCJP 5F2NA 1VQ5P 4XFXA 2JPRA 2WLVA 2Z45A 1YJ9P 3H4EA 1Q86Q 1EOQA 1VQOP 2EIAA 3CCRP 2X2DD 3CCVP 1VQ4P 2OTLP 4HTWA 2JYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXR C;  3DS0 A;  1A8O A;  1L6N A;  1P7N A;  4IPY A;  5HGM A;  2KGF A;  2JYG A;  3G1G A;  4J93 A;  1GWP A;  2PWM A;  1EM9 A;  3LRY A;  1E6J P;  3DPH A;  2GON A;  3G1I A;  4XRQ A;  4U0B A;  1EIA A;  4INB A;  4DGA C;  2XV6 A;  3DTJ A;  4LQW C;  4U0D A;  4U0F A;  2KOD A;  2XXM A;  2GOL B;  1AK4 C;  3NTE A;  3G21 A;  4NX4 C;  4PH1 A;  2XGV A;  4E92 A;  1AUM A;  3BP9 A;  4XFY A;  4PH0 A;  2XGU A;  2WLV B;  1QRJ A;  3DS5 A;  3P05 A;  1M9Y C;  2Y4Z A;  4COP A;  3DS4 A;  5I4T G;  4WYM A;  2X83 A;  3G29 A;  2LF4 A;  3DS1 A;  1M9F C;  4PH2 A;  2XT1 A;  4QNB A;  5HGK A;  2M8N A;  2ONT A;  5HGO A;  1M9E C;  3VRL C;  4PH3 A;  1D1D A;  4B4N A;  4XRO A;  1A43 A;  3G28 A;  2V4X A;  4U0C A;  4XFZ A;  2M8L A;  3MGE A;  1U7K A;  1G03 A;  3H47 A;  4DGE C;  2XGY A;  3G0V A;  2M8P A;  2PWO A;  5HGN A;  3DS3 A;  1M9C C;  4COC A;  4U0E A;  3DS2 A;  4E91 A;  1AFV A;  5JPA A;  5HGL A;  2X82 A;  1M9X C;  1M9D C;  2BUO A;  1BAJ A;  3G26 A;  2JO0 A;  2XDE A;  4M0I A;  2L6E A;  5DCK A;  4U0A A;  4XFX A;  2JPR A;  2WLV A;  3H4E A;  1EOQ A;  2EIA A;  2X2D D;  4HTW A;  2JYL A; 
#chains in the Genus database with same CATH topology
 2PEO A;  2PXR C;  4MRT C;  1VQP P;  1IUQ A;  1VQ7 P;  2K2Q A;  1RO2 A;  2KGF A;  2N6Y A;  2JYG A;  3G1G A;  3G4S P;  1VQ8 P;  1M74 A;  2CNR A;  1EM9 A;  2FVA A;  2GZJ A;  3LRY A;  1E6J P;  4XRQ A;  2PY8 A;  2GZF A;  1EIA A;  1M90 Q;  4U0D A;  2CQ8 A;  2XXM A;  2GOL B;  2AFE A;  2AFD A;  1YIJ P;  5EW5 E;  4NX4 C;  4E92 A;  1AUM A;  2WLV B;  1QRJ A;  2DGY A;  1DNY A;  2FQ2 A;  2AVA A;  2QEX P;  2X83 A;  4PH2 A;  1K9M Q;  2ONT A;  2GDY A;  3RG6 C;  3WBH A;  1UNK A;  4XRO A;  1A43 A;  2JGP A;  2K0X A;  2Z46 A;  2V4X A;  4U0C A;  2PEJ A;  3EJD A;  1VQL P;  2DNW A;  3Q20 A;  1MZ8 A;  3HYB A;  4PXH B;  2M8P A;  2PWO A;  3DS3 A;  2KWL A;  3DS2 A;  2MF4 A;  4E91 A;  3CPW O;  3CD6 P;  2JBG A;  3LMO A;  1M9D C;  1GXG A;  2WPT A;  2BUO A;  3CXC O;  2JO0 A;  1N8R Q;  3CC7 P;  4M0I A;  1Q82 Q;  3M1M A;  3CCJ P;  2JPR A;  3H4E A;  3CCV P;  2JYL A;  2GDW A;  2KOP A;  1OR5 A;  2LPK A;  4IPY A;  1F80 D;  2K94 A;  2N50 A;  1EMV A;  2JU2 A;  4J93 A;  2PWM A;  2FHS C;  3DPH A;  3G1I A;  2FAD A;  2MY5 A;  5EJD A;  3OW2 O;  4U0B A;  3CCS P;  3CMA P;  5KP7 B;  2OAR A;  3DTJ A;  3EJE A;  2LTE A;  2KOD A;  4IZ6 A;  1AF8 A;  1YHQ P;  1M6E X;  2KOQ A;  1Q7Y Q;  2JB0 A;  3CCL P;  4PH0 A;  2KG6 A;  1ZMB A;  3DS5 A;  2Y4Z A;  4COP A;  5I4T G;  4WYM A;  5KP8 B;  3DS1 A;  1M9F C;  2JAZ A;  2XT1 A;  2LL8 A;  3GKL C;  2N98 A;  2Z44 A;  3B4Q A;  1K73 Q;  1M6N A;  3G28 A;  2CGQ A;  1ZNV A;  4XFZ A;  1U7K A;  3H47 A;  4DGE C;  2M5R A;  3G0V A;  3E2D A;  3U43 A;  5HVC A;  5HGN A;  5BS2 A;  3CCU P;  1ACP A;  4CA3 A;  4QKO A;  2KG8 A;  1AFV A;  2KOO A;  3CCE P;  2X82 A;  2EHS A;  1IMP A;  1FR2 A;  2OTJ P;  2KG9 A;  3G26 A;  1BAJ A;  2MR7 A;  1YJW P;  2XDE A;  2L6E A;  2N5I A;  1VQ5 P;  2Z45 A;  1YJ9 P;  2L9F A;  3CCR P;  2GZG A;  1X3O A;  1DV5 A;  1QVG O;  2NO8 A;  2LIU A;  1A8O A;  1P7N A;  3CME P;  1VQN P;  5HGM A;  1YI2 P;  1Z6M A;  2KGC A;  1GWP A;  1L0I A;  2GON A;  2LKI A;  2PNG A;  1YIT P;  1JJ2 O;  1YJN P;  4DGA C;  2JU1 A;  2PEQ A;  2XV6 A;  2K5X A;  5KP6 B;  1QVF O;  2GZI A;  5F2K A;  2LIW A;  1CEI A;  2VLN A;  4LQW C;  2P9X A;  2FVF A;  2FAC A;  4HKG A;  2KR5 A;  3G21 A;  2ERH A;  2XGV A;  4BPG A;  2GDX A;  2JQ4 A;  3DS4 A;  1KLP A;  2N6Z A;  1VHN A;  2LF4 A;  3GJN A;  4BPF A;  2MD9 A;  4GR2 A;  4QNB A;  4H2W C;  2M8N A;  5HGO A;  1M9E C;  2GYK A;  2FAE A;  4B4N A;  2MVU A;  3RG2 A;  3GZM A;  2XZ0 D;  1RO0 A;  1S72 P;  1Q81 Q;  2L4B A;  2CWO A;  3MGE A;  2FQ0 A;  1KC8 Q;  1BXI A;  2K92 A;  4R0M A;  4U0E A;  2KGD A;  2EHT A;  4DG9 A;  2L22 A;  3G6E P;  1W2B O;  5JPA A;  3CC2 P;  5HGL A;  1NJI Q;  2QA4 P;  1M9X C;  2PEM A;  2LOL A;  2EG5 A;  4BPH A;  2K0Y A;  5DCK A;  2GZE A;  4U0A A;  5F2N A;  4XFX A;  1UJZ A;  2VSQ A;  1VQO P;  2EIA A;  2X2D D;  1VQ4 P;  4NEO A;  2VLP A;  2QNW A;  3CCM P;  1M1K Q;  3DS0 A;  2CG5 B;  1L6N A;  3I56 P;  2PEK A;  2BHV A;  2E1M A;  5BS1 A;  2XZ1 C;  4INB A;  2EFJ A;  2PEI A;  1VQ6 P;  4U0F A;  1AK4 C;  3NTE A;  2ROQ A;  1L0H A;  4UHP B;  4PH1 A;  1KQS O;  1NQ4 A;  3BP9 A;  4XFY A;  2XGU A;  2L0Q A;  3CCQ P;  3P05 A;  1M9Y C;  2N5H A;  2LML A;  4PWV B;  2MVV A;  3G29 A;  1VQM P;  5HGK A;  3B5I A;  3VRL C;  4PH3 A;  3I55 P;  1D1D A;  1KD1 Q;  2VLQ A;  2PEN A;  1HY8 A;  1GPJ A;  1VKU A;  2KW2 A;  2M8L A;  1AYI A;  1G03 A;  2FVE A;  2XGY A;  1VQK P;  3CC4 P;  1RNI A;  2MR8 A;  2KOS A;  1GXH A;  1K30 A;  2KGE A;  1M9C C;  4COC A;  7CEI A;  3G71 P;  3GZL A;  1T8K A;  3HZQ A;  2KOR A;  1VQ9 P;  2X2B A;  1K8A Q;  5F2O A;  4H2X C;  2VLO A;  2K0D X;  4GR6 A;  3H0D A;  2K93 A;  4F37 A;  1IMQ A;  3EJB A;  1E0H A;  2WLV A;  1HQB A;  4H2Y C;  2FQ1 A;  3CE7 A;  1Q86 Q;  1EOQ A;  3NY7 B;  5HV8 A;  2OTL P;  2KGA A;  4HTW A;  5CZD B;  2AF8 A; 
#chains in the Genus database with same CATH homology
 1QVG O;  3CCM P;  2PEO A;  2PXR C;  1M1K Q;  3DS0 A;  1VQP P;  1IUQ A;  1A8O A;  1L6N A;  1P7N A;  4IPY A;  3CME P;  1VQN P;  1VQ7 P;  3I56 P;  5HGM A;  1RO2 A;  2PEK A;  1YI2 P;  2KGF A;  2BHV A;  2JYG A;  3G1G A;  3G4S P;  2E1M A;  4J93 A;  1VQ8 P;  1GWP A;  2PWM A;  1M74 A;  1EM9 A;  3LRY A;  1E6J P;  3DPH A;  2GON A;  3G1I A;  5BS1 A;  4XRQ A;  3OW2 O;  4U0B A;  2PY8 A;  1YIT P;  3CCS P;  3CMA P;  1JJ2 O;  1YJN P;  1EIA A;  4INB A;  4DGA C;  2EFJ A;  2OAR A;  2PEI A;  2PEQ A;  2XV6 A;  1QVF O;  3DTJ A;  5F2K A;  1VQ6 P;  4LQW C;  2P9X A;  1M90 Q;  4U0D A;  4U0F A;  2KOD A;  2XXM A;  2GOL B;  1AK4 C;  3NTE A;  1YIJ P;  1YHQ P;  1M6E X;  4NX4 C;  3G21 A;  4PH1 A;  2XGV A;  1KQS O;  1Q7Y Q;  4E92 A;  1AUM A;  3BP9 A;  3CCL P;  4XFY A;  4PH0 A;  2XGU A;  2WLV B;  1QRJ A;  1ZMB A;  2DGY A;  3DS5 A;  3P05 A;  3CCQ P;  1M9Y C;  2Y4Z A;  4COP A;  3DS4 A;  5I4T G;  4WYM A;  2X83 A;  2QEX P;  3G29 A;  2LF4 A;  3DS1 A;  1M9F C;  4PH2 A;  4GR2 A;  2XT1 A;  4QNB A;  5HGK A;  1VQM P;  2M8N A;  1K9M Q;  2ONT A;  5HGO A;  1M9E C;  3B5I A;  3VRL C;  4PH3 A;  3RG6 C;  3WBH A;  1D1D A;  3I55 P;  1KD1 Q;  2Z44 A;  1K73 Q;  2PEN A;  4B4N A;  4XRO A;  1A43 A;  1M6N A;  3G28 A;  2Z46 A;  1RO0 A;  2V4X A;  4U0C A;  2PEJ A;  1S72 P;  1Q81 Q;  4XFZ A;  1VQL P;  2M8L A;  2CWO A;  3Q20 A;  3MGE A;  1U7K A;  1G03 A;  3H47 A;  4DGE C;  2XGY A;  1VQK P;  3G0V A;  3CC4 P;  1RNI A;  3E2D A;  3HYB A;  2M8P A;  2PWO A;  5HGN A;  3DS3 A;  1KC8 Q;  5BS2 A;  3CCU P;  1K30 A;  1M9C C;  4COC A;  4U0E A;  3DS2 A;  3G71 P;  4E91 A;  3HZQ A;  3CPW O;  3CD6 P;  3G6E P;  1AFV A;  1W2B O;  5JPA A;  1VQ9 P;  3CC2 P;  3CCE P;  5HGL A;  1K8A Q;  2X82 A;  5F2O A;  1NJI Q;  2OTJ P;  2QA4 P;  1M9X C;  4GR6 A;  1M9D C;  3H0D A;  2PEM A;  2EG5 A;  2BUO A;  1BAJ A;  3G26 A;  3CXC O;  2JO0 A;  1N8R Q;  3CC7 P;  1YJW P;  2XDE A;  4M0I A;  1Q82 Q;  2L6E A;  5DCK A;  3M1M A;  4U0A A;  3CCJ P;  5F2N A;  1VQ5 P;  4XFX A;  2JPR A;  2WLV A;  2Z45 A;  1YJ9 P;  3H4E A;  1Q86 Q;  1EOQ A;  1VQO P;  2EIA A;  3CCR P;  2X2D D;  3CCV P;  1VQ4 P;  2OTL P;  4HTW A;  2JYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...