4XFYA

Structure of the native full-length dehydrated hiv-1 capsid protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
216
Chain Sequence
PIVQQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 71
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfyA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfyA02
2KODA 1E6JP 1AK4C 4M0IA 4U0EA 1D1DA 2PWMA 2Y4ZA 2BUOA 3DS1A 3DS3A 3DS5A 3NTEA 2WLVA 2X2DD 4NX4C 3G1GA 2X82A 2XGYA 2JYLA 3P05A 2PWOA 2XGUA 3G21A 1M9CC 1AUMA 3BP9A 1EOQA 3LRYA 4PH2A 2XV6A 3G26A 4PH0A 3G29A 4COPA 3DS0A 4IPYA 1A8OA 2M8PA 2XDEA 2GOLB 4XFZA 4QNBA 1EIAA 3G0VA 3DS2A 4DGEC 4DGAC 2JO0A 1U7KA 5HGNA 4XFXA 1M9YC 5HGLA 2PXRC 3DPHA 4U0CA 2M8NA 4U0FA 4XFYA 1EM9A 1M9FC 4WYMA 2M8LA 4E91A 4E92A 1GWPA 4LQWC 2KGFA 1L6NA 2WLVB 2XXMA 5HGOA 1M9DC 1BAJA 1A43A 1QRJA 4PH3A 4XROA 1M9EC 3G28A 4U0AA 4U0DA 3MGEA 3G1IA 4PH1A 5JPAA 2XT1A 4B4NA 3VRLC 2LF4A 4XRQA 1AFVA 4COCA 4HTWA 5HGMA 1G03A 3DTJA 3DS4A 2ONTA 2X83A 2V4XA 5I4TG 3H47A 2GONA 2JYGA 4INBA 4J93A 2L6EA 2XGVA 1P7NA 4U0BA 3H4EA 2JPRA 1M9XC 2EIAA 5HGKA 5DCKA
chains in the Genus database with same CATH superfamily
1NJIQ 2MR8A 5F2OA 1VQOP 2VLOA 2PWMA 2CGQA 1VQ4P 1MZ8A 2WLVA 1VQNP 3G1GA 1M6NA 4PWVB 3G6EP 2JYLA 2PWOA 4UHPB 4PH2A 4PH0A 2JU2A 3B5IA 3WBHA 2KGEA 3DS0A 2FQ2A 1A8OA 2L22A 1EMVA 1Q82Q 1M90Q 2N5IA 4XFZA 2XZ0D 4QNBA 3EJDA 1KC8Q 1VQ9P 1ZNVA 3B4QA 1VHNA 3DS2A 2K0YA 2JO0A 2KGAA 2FAEA 3LMOA 5F2NA 5BS2A 2K94A 1UJZA 4U0FA 2AVAA 2KWLA 1EM9A 1YJ9P 1K8AQ 2KGFA 2PY8A 1VQLP 4DG9A 3CCJP 2LOLA 4PH3A 3HYBA 4CA3A 1QVGO 2ROQA 4U0AA 4U0DA 3MGEA 4GR2A 4R0MA 2PEOA 2KOSA 5CZDB 4XRQA 2EHTA 2PENA 1DV5A 2QA4P 3I55P 2P9XA 1K73Q 1G03A 1CEIA 2FQ1A 2ONTA 1YJWP 2N50A 2XZ1C 2DGYA 1YJNP 3GJNA 2KOOA 2KODA 2AFDA 1E6JP 2GDYA 1ACPA 1AK4C 4M0IA 2N98A 1RO0A 3CMEP 1M1KQ 1GXHA 2GZJA 2LL8A 2MY5A 3E2DA 3NTEA 1KQSO 2GZFA 2GYKA 1Z6MA 2XGUA 3M1MA 1M9CC 1AUMA 3BP9A 1EOQA 2K0XA 2XV6A 2Z46A 4PXHB 2M8PA 2XDEA 2LKIA 1VQ8P 3Q20A 4DGEC 2BHVA 4XFXA 3U43A 4F37A 3G71P 2GZEA 3EJBA 2M5RA 3CCMP 1OR5A 4E92A 1VQ7P 2FADA 3CCUP 3CCVP 2PEIA 2KGDA 2WLVB 3EJEA 1KLPA 1M9DC 1A43A 1NQ4A 2KGCA 2EHSA 1YITP 2Z44A 2CQ8A 3CD6P 5JPAA 3CC2P 3CMAP 2CNRA 1KD1Q 1AFVA 3CXCO 4COCA 5HGMA 1IMQA 2VLPA 3CPWO 3HZQA 2KG6A 2AF8A 1N8RQ 1L0IA 2DNWA 3I56P 2L6EA 2XGVA 2FVEA 4U0BA 3H4EA 2JPRA 3RG2A 2L0QA 2EIAA 1YHQP 4MRTC 5HV8A 2QNWA 4U0EA 1D1DA 3DS5A 2Y4ZA 2BUOA 2JB0A 1HY8A 1T8KA 1VQ5P 1Q7YQ 1W2BO 2X2DD 2CG5B 3P05A 1RO2A 2PEKA 3CCSP 3LRYA 1Q86Q 2ERHA 2VLQA 2E1MA 3CCQP 4COPA 4BPFA 1IUQA 2FVAA 5HVCA 2GOLB 2PEQA 3NY7B 2Z45A 1EIAA 3G0VA 2NO8A 2MD9A 2JAZA 2OTLP 5HGNA 3RG6C 1M9YC 4BPHA 1UNKA 2K93A 2M8NA 1QVFO 1VKUA 1M9FC 2JGPA 4WYMA 1HQBA 2N6ZA 1GWPA 1L6NA 2GDWA 4H2WC 2LIUA 5EJDA 2GZGA 1BAJA 2KOPA 3GZLA 2VLNA 2N6YA 1M9EC 2OTJP 4IZ6A 2GDXA 1E0HA 2EG5A 2X2BA 3H0DA 5EW5E 5KP8B 2MF4A 1F80D 4NEOA 3GKLC 2LF4A 2MR7A 1ZMBA 2PEJA 1K30A 2KG9A 4H2YC 7CEIA 1M74A 2JBGA 2LPKA 1VQMP 3DS4A 2K2QA 2V4XA 5I4TG 1YIJP 3H47A 2GONA 2JYGA 4J93A 2CWOA 3G4SP 1VQKP 1M9XC 1L0HA 1DNYA 1FR2A 3DS1A 3DS3A 3CCRP 2KW2A 1AYIA 4NX4C 2X82A 2XGYA 3G21A 4GR6A 1VQ6P 2LMLA 1X3OA 2FACA 3CC7P 3G26A 2PEMA 3G29A 1AF8A 4IPYA 5BS1A 2FHSC 3OW2O 2LTEA 2EFJA 4QKOA 2N5HA 1YI2P 4DGAC 1M6EX 2QEXP 1U7KA 2L9FA 1JJ2O 5HGLA 2JQ4A 2PXRC 2AFEA 3DPHA 4U0CA 2JU1A 4XFYA 1BXIA 3CCEP 4E91A 2M8LA 2FQ0A 2MVUA 5F2KA 1GPJA 4LQWC 2WPTA 2VSQA 2KR5A 1IMPA 2XXMA 5HGOA 2K92A 1S72P 3CC4P 1QRJA 4H2XC 4XROA 3G28A 3G1IA 4PH1A 1K9MQ 3GZMA 2PNGA 2FVFA 2XT1A 3VRLC 4B4NA 1VQPP 2LIWA 4BPGA 5KP7B 1GXGA 2KORA 4HTWA 1RNIA 2K5XA 2OARA 3DTJA 3CE7A 2KOQA 2KG8A 5KP6B 4HKGA 2X83A 2L4BA 2MVVA 2GZIA 4INBA 1Q81Q 3CCLP 1P7NA 2K0DX 5HGKA 5DCKA
chains in the Genus database with same CATH topology
1NJIQ 2KODA 1E6JP 5F2OA 1VQOP 1AK4C 4M0IA 4U0EA 1D1DA 2PWMA 2Y4ZA 2BUOA 1RO0A 3DS1A 3DS3A 3DS5A 1VQ4P 3CMEP 3CCRP 1VQ5P 1M1KQ 1Q7YQ 3E2DA 3NTEA 1W2BO 2WLVA 2X2DD 4NX4C 1KQSO 3G1GA 1M6NA 1VQNP 2X82A 3G6EP 2XGYA 2JYLA 3P05A 2PWOA 2XGUA 1RO2A 2PEKA 3G21A 1M9CC 1AUMA 3BP9A 1EOQA 3M1MA 4GR6A 3CCSP 1VQ6P 3LRYA 4PH2A 2XV6A 2Z46A 1Q86Q 3CC7P 3G26A 2PEMA 4PH0A 3B5IA 3G29A 3WBHA 2E1MA 3CCQP 4COPA 3DS0A 1IUQA 4IPYA 1A8OA 2M8PA 2XDEA 1Q82Q 5BS1A 1M90Q 2GOLB 2PEQA 3OW2O 4XFZA 2Z45A 4QNBA 1EIAA 1KC8Q 1VQ9P 3G0VA 1VQ8P 2EFJA 3Q20A 3DS2A 4DGEC 1YI2P 2OTLP 2BHVA 4DGAC 2JO0A 1M6EX 2QEXP 1U7KA 5HGNA 4XFXA 1M9YC 3RG6C 1JJ2O 5F2NA 5BS2A 5HGLA 3G71P 2PXRC 3DPHA 4U0CA 3CCMP 2M8NA 1QVFO 4U0FA 4XFYA 1EM9A 1M9FC 3CCEP 4WYMA 2M8LA 4E91A 4E92A 1VQ7P 1YJ9P 5F2KA 1K8AQ 1GWPA 4LQWC 2KGFA 2PY8A 1L6NA 3CCUP 3CCVP 2PEIA 1VQLP 2WLVB 2XXMA 3CCJP 5HGOA 1M9DC 1BAJA 1S72P 1A43A 3CC4P 1QRJA 4PH3A 3HYBA 1YITP 1QVGO 2Z44A 4XROA 1M9EC 2OTJP 3G28A 4U0AA 4U0DA 3MGEA 4GR2A 2EG5A 3G1IA 3H0DA 3CD6P 4PH1A 5JPAA 1K9MQ 3CC2P 3CMAP 2XT1A 4B4NA 3VRLC 2LF4A 2PEOA 1VQPP 1ZMBA 1KD1Q 4XRQA 2PEJA 2PENA 1AFVA 1K30A 2QA4P 3CXCO 3I55P 2P9XA 1K73Q 4COCA 4HTWA 5HGMA 3CPWO 1M74A 1RNIA 2OARA 1G03A 3DTJA 3HZQA 1VQMP 3DS4A 2ONTA 1YJWP 2X83A 2V4XA 5I4TG 1YIJP 1N8RQ 3H47A 2GONA 3I56P 2JYGA 4INBA 4J93A 2L6EA 1Q81Q 2XGVA 2DGYA 3CCLP 1P7NA 4U0BA 3H4EA 2JPRA 2CWOA 3G4SP 1YJNP 1M9XC 2EIAA 1VQKP 5HGKA 5DCKA 1YHQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOD A;  1E6J P;  1AK4 C;  4M0I A;  4U0E A;  1D1D A;  2PWM A;  2Y4Z A;  2BUO A;  3DS1 A;  3DS3 A;  3DS5 A;  3NTE A;  2WLV A;  2X2D D;  4NX4 C;  3G1G A;  2X82 A;  2XGY A;  2JYL A;  3P05 A;  2PWO A;  2XGU A;  3G21 A;  1M9C C;  1AUM A;  3BP9 A;  1EOQ A;  3LRY A;  4PH2 A;  2XV6 A;  3G26 A;  4PH0 A;  3G29 A;  4COP A;  3DS0 A;  4IPY A;  1A8O A;  2M8P A;  2XDE A;  2GOL B;  4XFZ A;  4QNB A;  1EIA A;  3G0V A;  3DS2 A;  4DGE C;  4DGA C;  2JO0 A;  1U7K A;  5HGN A;  4XFX A;  1M9Y C;  5HGL A;  2PXR C;  3DPH A;  4U0C A;  2M8N A;  4U0F A;  4XFY A;  1EM9 A;  1M9F C;  4WYM A;  2M8L A;  4E91 A;  4E92 A;  1GWP A;  4LQW C;  2KGF A;  1L6N A;  2WLV B;  2XXM A;  5HGO A;  1M9D C;  1BAJ A;  1A43 A;  1QRJ A;  4PH3 A;  4XRO A;  1M9E C;  3G28 A;  4U0A A;  4U0D A;  3MGE A;  3G1I A;  4PH1 A;  5JPA A;  2XT1 A;  4B4N A;  3VRL C;  2LF4 A;  4XRQ A;  1AFV A;  4COC A;  4HTW A;  5HGM A;  1G03 A;  3DTJ A;  3DS4 A;  2ONT A;  2X83 A;  2V4X A;  5I4T G;  3H47 A;  2GON A;  2JYG A;  4INB A;  4J93 A;  2L6E A;  2XGV A;  1P7N A;  4U0B A;  3H4E A;  2JPR A;  1M9X C;  2EIA A;  5HGK A;  5DCK A; 
#chains in the Genus database with same CATH topology
 1NJI Q;  2MR8 A;  5F2O A;  1VQO P;  2VLO A;  2PWM A;  2CGQ A;  1VQ4 P;  1MZ8 A;  2WLV A;  1VQN P;  3G1G A;  1M6N A;  4PWV B;  3G6E P;  2JYL A;  2PWO A;  4UHP B;  4PH2 A;  4PH0 A;  2JU2 A;  3B5I A;  3WBH A;  2KGE A;  3DS0 A;  2FQ2 A;  1A8O A;  2L22 A;  1EMV A;  1Q82 Q;  1M90 Q;  2N5I A;  4XFZ A;  2XZ0 D;  4QNB A;  3EJD A;  1KC8 Q;  1VQ9 P;  1ZNV A;  3B4Q A;  1VHN A;  3DS2 A;  2K0Y A;  2JO0 A;  2KGA A;  2FAE A;  3LMO A;  5F2N A;  5BS2 A;  2K94 A;  1UJZ A;  4U0F A;  2AVA A;  2KWL A;  1EM9 A;  1YJ9 P;  1K8A Q;  2KGF A;  2PY8 A;  1VQL P;  4DG9 A;  3CCJ P;  2LOL A;  4PH3 A;  3HYB A;  4CA3 A;  1QVG O;  2ROQ A;  4U0A A;  4U0D A;  3MGE A;  4GR2 A;  4R0M A;  2PEO A;  2KOS A;  5CZD B;  4XRQ A;  2EHT A;  2PEN A;  1DV5 A;  2QA4 P;  3I55 P;  2P9X A;  1K73 Q;  1G03 A;  1CEI A;  2FQ1 A;  2ONT A;  1YJW P;  2N50 A;  2XZ1 C;  2DGY A;  1YJN P;  3GJN A;  2KOO A;  2KOD A;  2AFD A;  1E6J P;  2GDY A;  1ACP A;  1AK4 C;  4M0I A;  2N98 A;  1RO0 A;  3CME P;  1M1K Q;  1GXH A;  2GZJ A;  2LL8 A;  2MY5 A;  3E2D A;  3NTE A;  1KQS O;  2GZF A;  2GYK A;  1Z6M A;  2XGU A;  3M1M A;  1M9C C;  1AUM A;  3BP9 A;  1EOQ A;  2K0X A;  2XV6 A;  2Z46 A;  4PXH B;  2M8P A;  2XDE A;  2LKI A;  1VQ8 P;  3Q20 A;  4DGE C;  2BHV A;  4XFX A;  3U43 A;  4F37 A;  3G71 P;  2GZE A;  3EJB A;  2M5R A;  3CCM P;  1OR5 A;  4E92 A;  1VQ7 P;  2FAD A;  3CCU P;  3CCV P;  2PEI A;  2KGD A;  2WLV B;  3EJE A;  1KLP A;  1M9D C;  1A43 A;  1NQ4 A;  2KGC A;  2EHS A;  1YIT P;  2Z44 A;  2CQ8 A;  3CD6 P;  5JPA A;  3CC2 P;  3CMA P;  2CNR A;  1KD1 Q;  1AFV A;  3CXC O;  4COC A;  5HGM A;  1IMQ A;  2VLP A;  3CPW O;  3HZQ A;  2KG6 A;  2AF8 A;  1N8R Q;  1L0I A;  2DNW A;  3I56 P;  2L6E A;  2XGV A;  2FVE A;  4U0B A;  3H4E A;  2JPR A;  3RG2 A;  2L0Q A;  2EIA A;  1YHQ P;  4MRT C;  5HV8 A;  2QNW A;  4U0E A;  1D1D A;  3DS5 A;  2Y4Z A;  2BUO A;  2JB0 A;  1HY8 A;  1T8K A;  1VQ5 P;  1Q7Y Q;  1W2B O;  2X2D D;  2CG5 B;  3P05 A;  1RO2 A;  2PEK A;  3CCS P;  3LRY A;  1Q86 Q;  2ERH A;  2VLQ A;  2E1M A;  3CCQ P;  4COP A;  4BPF A;  1IUQ A;  2FVA A;  5HVC A;  2GOL B;  2PEQ A;  3NY7 B;  2Z45 A;  1EIA A;  3G0V A;  2NO8 A;  2MD9 A;  2JAZ A;  2OTL P;  5HGN A;  3RG6 C;  1M9Y C;  4BPH A;  1UNK A;  2K93 A;  2M8N A;  1QVF O;  1VKU A;  1M9F C;  2JGP A;  4WYM A;  1HQB A;  2N6Z A;  1GWP A;  1L6N A;  2GDW A;  4H2W C;  2LIU A;  5EJD A;  2GZG A;  1BAJ A;  2KOP A;  3GZL A;  2VLN A;  2N6Y A;  1M9E C;  2OTJ P;  4IZ6 A;  2GDX A;  1E0H A;  2EG5 A;  2X2B A;  3H0D A;  5EW5 E;  5KP8 B;  2MF4 A;  1F80 D;  4NEO A;  3GKL C;  2LF4 A;  2MR7 A;  1ZMB A;  2PEJ A;  1K30 A;  2KG9 A;  4H2Y C;  7CEI A;  1M74 A;  2JBG A;  2LPK A;  1VQM P;  3DS4 A;  2K2Q A;  2V4X A;  5I4T G;  1YIJ P;  3H47 A;  2GON A;  2JYG A;  4J93 A;  2CWO A;  3G4S P;  1VQK P;  1M9X C;  1L0H A;  1DNY A;  1FR2 A;  3DS1 A;  3DS3 A;  3CCR P;  2KW2 A;  1AYI A;  4NX4 C;  2X82 A;  2XGY A;  3G21 A;  4GR6 A;  1VQ6 P;  2LML A;  1X3O A;  2FAC A;  3CC7 P;  3G26 A;  2PEM A;  3G29 A;  1AF8 A;  4IPY A;  5BS1 A;  2FHS C;  3OW2 O;  2LTE A;  2EFJ A;  4QKO A;  2N5H A;  1YI2 P;  4DGA C;  1M6E X;  2QEX P;  1U7K A;  2L9F A;  1JJ2 O;  5HGL A;  2JQ4 A;  2PXR C;  2AFE A;  3DPH A;  4U0C A;  2JU1 A;  4XFY A;  1BXI A;  3CCE P;  4E91 A;  2M8L A;  2FQ0 A;  2MVU A;  5F2K A;  1GPJ A;  4LQW C;  2WPT A;  2VSQ A;  2KR5 A;  1IMP A;  2XXM A;  5HGO A;  2K92 A;  1S72 P;  3CC4 P;  1QRJ A;  4H2X C;  4XRO A;  3G28 A;  3G1I A;  4PH1 A;  1K9M Q;  3GZM A;  2PNG A;  2FVF A;  2XT1 A;  3VRL C;  4B4N A;  1VQP P;  2LIW A;  4BPG A;  5KP7 B;  1GXG A;  2KOR A;  4HTW A;  1RNI A;  2K5X A;  2OAR A;  3DTJ A;  3CE7 A;  2KOQ A;  2KG8 A;  5KP6 B;  4HKG A;  2X83 A;  2L4B A;  2MVV A;  2GZI A;  4INB A;  1Q81 Q;  3CCL P;  1P7N A;  2K0D X;  5HGK A;  5DCK A; 
#chains in the Genus database with same CATH homology
 1NJI Q;  2KOD A;  1E6J P;  5F2O A;  1VQO P;  1AK4 C;  4M0I A;  4U0E A;  1D1D A;  2PWM A;  2Y4Z A;  2BUO A;  1RO0 A;  3DS1 A;  3DS3 A;  3DS5 A;  1VQ4 P;  3CME P;  3CCR P;  1VQ5 P;  1M1K Q;  1Q7Y Q;  3E2D A;  3NTE A;  1W2B O;  2WLV A;  2X2D D;  4NX4 C;  1KQS O;  3G1G A;  1M6N A;  1VQN P;  2X82 A;  3G6E P;  2XGY A;  2JYL A;  3P05 A;  2PWO A;  2XGU A;  1RO2 A;  2PEK A;  3G21 A;  1M9C C;  1AUM A;  3BP9 A;  1EOQ A;  3M1M A;  4GR6 A;  3CCS P;  1VQ6 P;  3LRY A;  4PH2 A;  2XV6 A;  2Z46 A;  1Q86 Q;  3CC7 P;  3G26 A;  2PEM A;  4PH0 A;  3B5I A;  3G29 A;  3WBH A;  2E1M A;  3CCQ P;  4COP A;  3DS0 A;  1IUQ A;  4IPY A;  1A8O A;  2M8P A;  2XDE A;  1Q82 Q;  5BS1 A;  1M90 Q;  2GOL B;  2PEQ A;  3OW2 O;  4XFZ A;  2Z45 A;  4QNB A;  1EIA A;  1KC8 Q;  1VQ9 P;  3G0V A;  1VQ8 P;  2EFJ A;  3Q20 A;  3DS2 A;  4DGE C;  1YI2 P;  2OTL P;  2BHV A;  4DGA C;  2JO0 A;  1M6E X;  2QEX P;  1U7K A;  5HGN A;  4XFX A;  1M9Y C;  3RG6 C;  1JJ2 O;  5F2N A;  5BS2 A;  5HGL A;  3G71 P;  2PXR C;  3DPH A;  4U0C A;  3CCM P;  2M8N A;  1QVF O;  4U0F A;  4XFY A;  1EM9 A;  1M9F C;  3CCE P;  4WYM A;  2M8L A;  4E91 A;  4E92 A;  1VQ7 P;  1YJ9 P;  5F2K A;  1K8A Q;  1GWP A;  4LQW C;  2KGF A;  2PY8 A;  1L6N A;  3CCU P;  3CCV P;  2PEI A;  1VQL P;  2WLV B;  2XXM A;  3CCJ P;  5HGO A;  1M9D C;  1BAJ A;  1S72 P;  1A43 A;  3CC4 P;  1QRJ A;  4PH3 A;  3HYB A;  1YIT P;  1QVG O;  2Z44 A;  4XRO A;  1M9E C;  2OTJ P;  3G28 A;  4U0A A;  4U0D A;  3MGE A;  4GR2 A;  2EG5 A;  3G1I A;  3H0D A;  3CD6 P;  4PH1 A;  5JPA A;  1K9M Q;  3CC2 P;  3CMA P;  2XT1 A;  4B4N A;  3VRL C;  2LF4 A;  2PEO A;  1VQP P;  1ZMB A;  1KD1 Q;  4XRQ A;  2PEJ A;  2PEN A;  1AFV A;  1K30 A;  2QA4 P;  3CXC O;  3I55 P;  2P9X A;  1K73 Q;  4COC A;  4HTW A;  5HGM A;  3CPW O;  1M74 A;  1RNI A;  2OAR A;  1G03 A;  3DTJ A;  3HZQ A;  1VQM P;  3DS4 A;  2ONT A;  1YJW P;  2X83 A;  2V4X A;  5I4T G;  1YIJ P;  1N8R Q;  3H47 A;  2GON A;  3I56 P;  2JYG A;  4INB A;  4J93 A;  2L6E A;  1Q81 Q;  2XGV A;  2DGY A;  3CCL P;  1P7N A;  4U0B A;  3H4E A;  2JPR A;  2CWO A;  3G4S P;  1YJN P;  1M9X C;  2EIA A;  1VQK P;  5HGK A;  5DCK A;  1YHQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...