4XFYA

Structure of the native full-length dehydrated hiv-1 capsid protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
216
Chain Sequence
PIVQQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 71
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfyA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfyA02
4U0DA 1M9CC 3G1GA 2M8NA 4U0EA 4PH2A 3G26A 3DS1A 4DGAC 5HGKA 2X83A 1L6NA 2WLVA 3G21A 4J93A 4LQWC 3LRYA 1EOQA 4B4NA 3DS3A 5DCKA 2PWMA 1M9XC 4NX4C 3DPHA 1E6JP 2XGYA 2GOLB 2LF4A 2X2DD 3P05A 2XDEA 4PH1A 1U7KA 4M0IA 1AFVA 2XGVA 2JYLA 4E91A 3VRLC 3H4EA 3DS2A 4WYMA 2XXMA 2X82A 3NTEA 2XV6A 5I4TG 4HTWA 2BUOA 2KGFA 5HGMA 3G0VA 1BAJA 3G1IA 1M9EC 2JPRA 4PH0A 1EM9A 2ONTA 3DTJA 4U0BA 2M8PA 4DGEC 4QNBA 2PXRC 5HGNA 4E92A 4XFYA 2GONA 1EIAA 2JYGA 4PH3A 4COCA 4COPA 3DS5A 2M8LA 4XROA 2Y4ZA 5HGLA 4IPYA 1A8OA 3MGEA 1P7NA 1AUMA 2EIAA 4U0CA 3DS0A 1GWPA 2PWOA 4XRQA 1AK4C 1G03A 2XT1A 3G28A 3H47A 4XFXA 4U0AA 1M9YC 1M9DC 1QRJA 4INBA 3DS4A 1D1DA 2L6EA 3BP9A 2JO0A 3G29A 1A43A 2XGUA 2V4XA 5JPAA 2WLVB 2KODA 4XFZA 5HGOA 4U0FA 1M9FC
chains in the Genus database with same CATH superfamily
3G1GA 2M8NA 3HZQA 3G26A 1M74A 3DS1A 5HGKA 2X83A 1YIJP 3B4QA 1L0HA 3M1MA 3E2DA 2FACA 2FHSC 3LRYA 4B4NA 1L0IA 2OTJP 2FQ1A 1K73Q 2GOLB 3I56P 2GZIA 2PENA 3WBHA 2PEIA 3P05A 2XDEA 1U7KA 1UJZA 4M0IA 1AFVA 2LOLA 2FADA 2XGVA 2N6ZA 2JBGA 3H4EA 3HYBA 1RNIA 3DS2A 2LTEA 2BUOA 1YI2P 2KGFA 2EFJA 3G0VA 3G1IA 5KP7B 2FQ0A 3G71P 2ONTA 1HY8A 2M8PA 2CG5B 4R0MA 5HGNA 4QKOA 1VQNP 4E92A 1BXIA 1KQSO 1Z6MA 2GONA 4COCA 3DS5A 3CXCO 1AF8A 5HGLA 1YITP 4BPHA 2OARA 4U0CA 4IZ6A 4BPGA 4GR2A 2CGQA 2L9FA 3CC4P 3RG2A 4XFXA 2GZJA 3GKLC 2AFEA 2K0XA 1M9DC 4HKGA 1D1DA 2KOQA 2EG5A 4MRTC 2N50A 2LIWA 2LKIA 1K30A 1M9FC 1ACPA 2EHTA 4U0EA 1RO0A 4PWVB 4DGAC 2Z45A 1T8KA 5KP6B 2FVEA 1Q86Q 4PXHB 1KD1Q 3DS3A 4NX4C 2KGAA 2JQ4A 3LMOA 2K0YA 3EJEA 1F80D 2LF4A 1YJWP 2LMLA 2VLNA 5EJDA 2JYLA 2VLPA 2KG6A 2FQ2A 1ZMBA 2ERHA 2X82A 3NTEA 1MZ8A 5I4TG 1VQKP 4CA3A 1M9EC 4PH0A 2N98A 2GDXA 1OR5A 4H2YC 5EW5E 4U0BA 2MR8A 2PEKA 2GDWA 2PXRC 2OTLP 1KC8Q 2PEJA 1VHNA 2LIUA 2DNWA 2VSQA 3CE7A 4PH3A 2XZ1C 2QA4P 2KG9A 2EIAA 1EMVA 1UNKA 4XRQA 1AK4C 2Z44A 1S72P 3G28A 1M9YC 1QRJA 2K94A 2JO0A 2XGUA 2EHSA 2V4XA 5JPAA 2WLVB 2AF8A 2Z46A 3GZLA 2L22A 4BPFA 1ZNVA 3CC7P 4U0DA 3G6EP 1M6EX 2NO8A 2MD9A 1VQOP 3G21A 2K5XA 2X2BA 2N5HA 2KR5A 2E1MA 1Q81Q 2PWMA 3DPHA 5BS2A 2JAZA 1M90Q 2XGYA 5F2OA 2VLOA 2PEOA 2X2DD 1VQ8P 1NJIQ 2QNWA 3I55P 2JB0A 1YJNP 1KLPA 3VRLC 1CEIA 3EJDA 2PY8A 2GYKA 1E0HA 3RG6C 3CMEP 1VKUA 2XV6A 4HTWA 5HGMA 3NY7B 1BAJA 1GXHA 1EM9A 1K9MQ 2VLQA 2L0QA 3DTJA 5HV8A 4DGEC 1RO2A 4H2WC 1JJ2O 2KGCA 2KOOA 4XFYA 3CPWO 2L4BA 2KOSA 1VQLP 2Y4ZA 4IPYA 2MVVA 1P7NA 7CEIA 1AUMA 2MF4A 1YJ9P 2JU2A 2JGPA 1GWPA 3CC2P 1FR2A 3OW2O 2CWOA 2XT1A 3GJNA 2MVUA 5CZDB 1VQPP 4INBA 2LPKA 2BHVA 2FVFA 3GZMA 1A43A 1VQ5P 1VQ7P 2PNGA 2MY5A 2KODA 5HGOA 5HVCA 2ROQA 4U0FA 3CCEP 1IMQA 3EJBA 2KORA 1M9CC 2FAEA 3B5IA 3CCQP 4PH2A 1Q82Q 1VQ9P 2WPTA 1M1KQ 2GDYA 1L6NA 2WLVA 4UHPB 2GZFA 4J93A 4LQWC 5KP8B 1VQMP 1EOQA 2PEMA 5DCKA 1M9XC 3CCRP 4GR6A 1QVFO 2KGDA 4F37A 1YHQP 2CNRA 1E6JP 1GPJA 2FVAA 5F2KA 2P9XA 2K2QA 2CQ8A 4PH1A 2N6YA 1VQ4P 1K8AQ 5BS1A 4E91A 1DNYA 1NQ4A 3CD6P 4WYMA 1HQBA 3Q20A 2XXMA 3CCVP 4H2XC 2KGEA 4NEOA 1QVGO 2XZ0D 2JPRA 2QEXP 4DG9A 1DV5A 1W2BO 4QNBA 2GZEA 1IUQA 1Q7YQ 2KWLA 3CCSP 3U43A 2K0DX 1EIAA 2AFDA 2JYGA 2KG8A 3CCJP 4COPA 3CMAP 2KW2A 2MR7A 2M8LA 1IMPA 4XROA 2N5IA 1A8OA 2JU1A 3MGEA 2K92A 1M6NA 1AYIA 1GXGA 3DS0A 2DGYA 2K93A 2LL8A 2PWOA 1N8RQ 3H0DA 3CCMP 1G03A 3G4SP 3CCUP 3CCLP 2GZGA 2M5RA 3H47A 4U0AA 5F2NA 3DS4A 1VQ6P 2L6EA 3BP9A 3G29A 2KOPA 2PEQA 4XFZA 2AVAA 1X3OA
chains in the Genus database with same CATH topology
3CC7P 4U0DA 1M9CC 3G6EP 3B5IA 3G1GA 2M8NA 4U0EA 1M6EX 1RO0A 3CCQP 3HZQA 4PH2A 3G26A 1Q82Q 1M74A 1VQ9P 3DS1A 1M1KQ 4DGAC 5HGKA 2X83A 1L6NA 1VQOP 2WLVA 1YIJP 2Z45A 3G21A 3M1MA 4J93A 4LQWC 3E2DA 1Q86Q 3LRYA 1EOQA 1VQMP 4B4NA 2PEMA 2E1MA 3DS3A 5DCKA 1Q81Q 1KD1Q 2PWMA 1M9XC 4NX4C 3DPHA 3CCRP 5BS2A 4GR6A 2OTJP 1QVFO 1YHQP 1M90Q 1K73Q 1E6JP 2XGYA 5F2OA 5F2KA 2GOLB 3I56P 2PENA 3WBHA 2PEOA 2PEIA 2LF4A 2X2DD 3P05A 2P9XA 1VQ8P 2XDEA 1NJIQ 4PH1A 1VQ4P 1U7KA 1K8AQ 1YJWP 4M0IA 1AFVA 3I55P 5BS1A 2XGVA 1YJNP 2JYLA 4E91A 3VRLC 3H4EA 3HYBA 3CD6P 1RNIA 4WYMA 3DS2A 3Q20A 2XXMA 3CCEP 3CCVP 1ZMBA 2PY8A 2X82A 3NTEA 3RG6C 3CMEP 2XV6A 5I4TG 4HTWA 2BUOA 1YI2P 2KGFA 2EFJA 5HGMA 1QVGO 1VQKP 3G0VA 1BAJA 3G1IA 1M9EC 2JPRA 2QEXP 4PH0A 1EM9A 1K9MQ 3G71P 2ONTA 3DTJA 4U0BA 2PEKA 2M8PA 4DGEC 4QNBA 1W2BO 2PXRC 1IUQA 5HGNA 1RO2A 1VQNP 1Q7YQ 1JJ2O 4E92A 2OTLP 1KC8Q 1KQSO 4XFYA 2PEJA 3CCSP 3CPWO 2GONA 1EIAA 3CCJP 2JYGA 4PH3A 2QA4P 4COCA 4COPA 3DS5A 3CMAP 1VQLP 3CXCO 2M8LA 4XROA 2Y4ZA 5HGLA 4IPYA 1A8OA 1YITP 3MGEA 1P7NA 1M6NA 1AUMA 2OARA 1YJ9P 2EIAA 4U0CA 3DS0A 2DGYA 1GWPA 3CC2P 3OW2O 4GR2A 2PWOA 4XRQA 3H0DA 1N8RQ 1AK4C 3CCMP 1G03A 2CWOA 3CC4P 2XT1A 3G4SP 2Z44A 3CCUP 3G28A 1S72P 3CCLP 3H47A 4XFXA 4U0AA 1M9YC 1VQPP 5F2NA 1M9DC 1QRJA 4INBA 3DS4A 1VQ6P 1D1DA 2BHVA 2L6EA 3BP9A 2EG5A 2JO0A 3G29A 1A43A 2XGUA 2V4XA 5JPAA 1VQ5P 1VQ7P 2WLVB 1K30A 2KODA 2PEQA 2Z46A 4XFZA 5HGOA 4U0FA 1M9FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0D A;  1M9C C;  3G1G A;  2M8N A;  4U0E A;  4PH2 A;  3G26 A;  3DS1 A;  4DGA C;  5HGK A;  2X83 A;  1L6N A;  2WLV A;  3G21 A;  4J93 A;  4LQW C;  3LRY A;  1EOQ A;  4B4N A;  3DS3 A;  5DCK A;  2PWM A;  1M9X C;  4NX4 C;  3DPH A;  1E6J P;  2XGY A;  2GOL B;  2LF4 A;  2X2D D;  3P05 A;  2XDE A;  4PH1 A;  1U7K A;  4M0I A;  1AFV A;  2XGV A;  2JYL A;  4E91 A;  3VRL C;  3H4E A;  3DS2 A;  4WYM A;  2XXM A;  2X82 A;  3NTE A;  2XV6 A;  5I4T G;  4HTW A;  2BUO A;  2KGF A;  5HGM A;  3G0V A;  1BAJ A;  3G1I A;  1M9E C;  2JPR A;  4PH0 A;  1EM9 A;  2ONT A;  3DTJ A;  4U0B A;  2M8P A;  4DGE C;  4QNB A;  2PXR C;  5HGN A;  4E92 A;  4XFY A;  2GON A;  1EIA A;  2JYG A;  4PH3 A;  4COC A;  4COP A;  3DS5 A;  2M8L A;  4XRO A;  2Y4Z A;  5HGL A;  4IPY A;  1A8O A;  3MGE A;  1P7N A;  1AUM A;  2EIA A;  4U0C A;  3DS0 A;  1GWP A;  2PWO A;  4XRQ A;  1AK4 C;  1G03 A;  2XT1 A;  3G28 A;  3H47 A;  4XFX A;  4U0A A;  1M9Y C;  1M9D C;  1QRJ A;  4INB A;  3DS4 A;  1D1D A;  2L6E A;  3BP9 A;  2JO0 A;  3G29 A;  1A43 A;  2XGU A;  2V4X A;  5JPA A;  2WLV B;  2KOD A;  4XFZ A;  5HGO A;  4U0F A;  1M9F C; 
#chains in the Genus database with same CATH topology
 3G1G A;  2M8N A;  3HZQ A;  3G26 A;  1M74 A;  3DS1 A;  5HGK A;  2X83 A;  1YIJ P;  3B4Q A;  1L0H A;  3M1M A;  3E2D A;  2FAC A;  2FHS C;  3LRY A;  4B4N A;  1L0I A;  2OTJ P;  2FQ1 A;  1K73 Q;  2GOL B;  3I56 P;  2GZI A;  2PEN A;  3WBH A;  2PEI A;  3P05 A;  2XDE A;  1U7K A;  1UJZ A;  4M0I A;  1AFV A;  2LOL A;  2FAD A;  2XGV A;  2N6Z A;  2JBG A;  3H4E A;  3HYB A;  1RNI A;  3DS2 A;  2LTE A;  2BUO A;  1YI2 P;  2KGF A;  2EFJ A;  3G0V A;  3G1I A;  5KP7 B;  2FQ0 A;  3G71 P;  2ONT A;  1HY8 A;  2M8P A;  2CG5 B;  4R0M A;  5HGN A;  4QKO A;  1VQN P;  4E92 A;  1BXI A;  1KQS O;  1Z6M A;  2GON A;  4COC A;  3DS5 A;  3CXC O;  1AF8 A;  5HGL A;  1YIT P;  4BPH A;  2OAR A;  4U0C A;  4IZ6 A;  4BPG A;  4GR2 A;  2CGQ A;  2L9F A;  3CC4 P;  3RG2 A;  4XFX A;  2GZJ A;  3GKL C;  2AFE A;  2K0X A;  1M9D C;  4HKG A;  1D1D A;  2KOQ A;  2EG5 A;  4MRT C;  2N50 A;  2LIW A;  2LKI A;  1K30 A;  1M9F C;  1ACP A;  2EHT A;  4U0E A;  1RO0 A;  4PWV B;  4DGA C;  2Z45 A;  1T8K A;  5KP6 B;  2FVE A;  1Q86 Q;  4PXH B;  1KD1 Q;  3DS3 A;  4NX4 C;  2KGA A;  2JQ4 A;  3LMO A;  2K0Y A;  3EJE A;  1F80 D;  2LF4 A;  1YJW P;  2LML A;  2VLN A;  5EJD A;  2JYL A;  2VLP A;  2KG6 A;  2FQ2 A;  1ZMB A;  2ERH A;  2X82 A;  3NTE A;  1MZ8 A;  5I4T G;  1VQK P;  4CA3 A;  1M9E C;  4PH0 A;  2N98 A;  2GDX A;  1OR5 A;  4H2Y C;  5EW5 E;  4U0B A;  2MR8 A;  2PEK A;  2GDW A;  2PXR C;  2OTL P;  1KC8 Q;  2PEJ A;  1VHN A;  2LIU A;  2DNW A;  2VSQ A;  3CE7 A;  4PH3 A;  2XZ1 C;  2QA4 P;  2KG9 A;  2EIA A;  1EMV A;  1UNK A;  4XRQ A;  1AK4 C;  2Z44 A;  1S72 P;  3G28 A;  1M9Y C;  1QRJ A;  2K94 A;  2JO0 A;  2XGU A;  2EHS A;  2V4X A;  5JPA A;  2WLV B;  2AF8 A;  2Z46 A;  3GZL A;  2L22 A;  4BPF A;  1ZNV A;  3CC7 P;  4U0D A;  3G6E P;  1M6E X;  2NO8 A;  2MD9 A;  1VQO P;  3G21 A;  2K5X A;  2X2B A;  2N5H A;  2KR5 A;  2E1M A;  1Q81 Q;  2PWM A;  3DPH A;  5BS2 A;  2JAZ A;  1M90 Q;  2XGY A;  5F2O A;  2VLO A;  2PEO A;  2X2D D;  1VQ8 P;  1NJI Q;  2QNW A;  3I55 P;  2JB0 A;  1YJN P;  1KLP A;  3VRL C;  1CEI A;  3EJD A;  2PY8 A;  2GYK A;  1E0H A;  3RG6 C;  3CME P;  1VKU A;  2XV6 A;  4HTW A;  5HGM A;  3NY7 B;  1BAJ A;  1GXH A;  1EM9 A;  1K9M Q;  2VLQ A;  2L0Q A;  3DTJ A;  5HV8 A;  4DGE C;  1RO2 A;  4H2W C;  1JJ2 O;  2KGC A;  2KOO A;  4XFY A;  3CPW O;  2L4B A;  2KOS A;  1VQL P;  2Y4Z A;  4IPY A;  2MVV A;  1P7N A;  7CEI A;  1AUM A;  2MF4 A;  1YJ9 P;  2JU2 A;  2JGP A;  1GWP A;  3CC2 P;  1FR2 A;  3OW2 O;  2CWO A;  2XT1 A;  3GJN A;  2MVU A;  5CZD B;  1VQP P;  4INB A;  2LPK A;  2BHV A;  2FVF A;  3GZM A;  1A43 A;  1VQ5 P;  1VQ7 P;  2PNG A;  2MY5 A;  2KOD A;  5HGO A;  5HVC A;  2ROQ A;  4U0F A;  3CCE P;  1IMQ A;  3EJB A;  2KOR A;  1M9C C;  2FAE A;  3B5I A;  3CCQ P;  4PH2 A;  1Q82 Q;  1VQ9 P;  2WPT A;  1M1K Q;  2GDY A;  1L6N A;  2WLV A;  4UHP B;  2GZF A;  4J93 A;  4LQW C;  5KP8 B;  1VQM P;  1EOQ A;  2PEM A;  5DCK A;  1M9X C;  3CCR P;  4GR6 A;  1QVF O;  2KGD A;  4F37 A;  1YHQ P;  2CNR A;  1E6J P;  1GPJ A;  2FVA A;  5F2K A;  2P9X A;  2K2Q A;  2CQ8 A;  4PH1 A;  2N6Y A;  1VQ4 P;  1K8A Q;  5BS1 A;  4E91 A;  1DNY A;  1NQ4 A;  3CD6 P;  4WYM A;  1HQB A;  3Q20 A;  2XXM A;  3CCV P;  4H2X C;  2KGE A;  4NEO A;  1QVG O;  2XZ0 D;  2JPR A;  2QEX P;  4DG9 A;  1DV5 A;  1W2B O;  4QNB A;  2GZE A;  1IUQ A;  1Q7Y Q;  2KWL A;  3CCS P;  3U43 A;  2K0D X;  1EIA A;  2AFD A;  2JYG A;  2KG8 A;  3CCJ P;  4COP A;  3CMA P;  2KW2 A;  2MR7 A;  2M8L A;  1IMP A;  4XRO A;  2N5I A;  1A8O A;  2JU1 A;  3MGE A;  2K92 A;  1M6N A;  1AYI A;  1GXG A;  3DS0 A;  2DGY A;  2K93 A;  2LL8 A;  2PWO A;  1N8R Q;  3H0D A;  3CCM P;  1G03 A;  3G4S P;  3CCU P;  3CCL P;  2GZG A;  2M5R A;  3H47 A;  4U0A A;  5F2N A;  3DS4 A;  1VQ6 P;  2L6E A;  3BP9 A;  3G29 A;  2KOP A;  2PEQ A;  4XFZ A;  2AVA A;  1X3O A; 
#chains in the Genus database with same CATH homology
 3CC7 P;  4U0D A;  1M9C C;  3G6E P;  3B5I A;  3G1G A;  2M8N A;  4U0E A;  1M6E X;  1RO0 A;  3CCQ P;  3HZQ A;  4PH2 A;  3G26 A;  1Q82 Q;  1M74 A;  1VQ9 P;  3DS1 A;  1M1K Q;  4DGA C;  5HGK A;  2X83 A;  1L6N A;  1VQO P;  2WLV A;  1YIJ P;  2Z45 A;  3G21 A;  3M1M A;  4J93 A;  4LQW C;  3E2D A;  1Q86 Q;  3LRY A;  1EOQ A;  1VQM P;  4B4N A;  2PEM A;  2E1M A;  3DS3 A;  5DCK A;  1Q81 Q;  1KD1 Q;  2PWM A;  1M9X C;  4NX4 C;  3DPH A;  3CCR P;  5BS2 A;  4GR6 A;  2OTJ P;  1QVF O;  1YHQ P;  1M90 Q;  1K73 Q;  1E6J P;  2XGY A;  5F2O A;  5F2K A;  2GOL B;  3I56 P;  2PEN A;  3WBH A;  2PEO A;  2PEI A;  2LF4 A;  2X2D D;  3P05 A;  2P9X A;  1VQ8 P;  2XDE A;  1NJI Q;  4PH1 A;  1VQ4 P;  1U7K A;  1K8A Q;  1YJW P;  4M0I A;  1AFV A;  3I55 P;  5BS1 A;  2XGV A;  1YJN P;  2JYL A;  4E91 A;  3VRL C;  3H4E A;  3HYB A;  3CD6 P;  1RNI A;  4WYM A;  3DS2 A;  3Q20 A;  2XXM A;  3CCE P;  3CCV P;  1ZMB A;  2PY8 A;  2X82 A;  3NTE A;  3RG6 C;  3CME P;  2XV6 A;  5I4T G;  4HTW A;  2BUO A;  1YI2 P;  2KGF A;  2EFJ A;  5HGM A;  1QVG O;  1VQK P;  3G0V A;  1BAJ A;  3G1I A;  1M9E C;  2JPR A;  2QEX P;  4PH0 A;  1EM9 A;  1K9M Q;  3G71 P;  2ONT A;  3DTJ A;  4U0B A;  2PEK A;  2M8P A;  4DGE C;  4QNB A;  1W2B O;  2PXR C;  1IUQ A;  5HGN A;  1RO2 A;  1VQN P;  1Q7Y Q;  1JJ2 O;  4E92 A;  2OTL P;  1KC8 Q;  1KQS O;  4XFY A;  2PEJ A;  3CCS P;  3CPW O;  2GON A;  1EIA A;  3CCJ P;  2JYG A;  4PH3 A;  2QA4 P;  4COC A;  4COP A;  3DS5 A;  3CMA P;  1VQL P;  3CXC O;  2M8L A;  4XRO A;  2Y4Z A;  5HGL A;  4IPY A;  1A8O A;  1YIT P;  3MGE A;  1P7N A;  1M6N A;  1AUM A;  2OAR A;  1YJ9 P;  2EIA A;  4U0C A;  3DS0 A;  2DGY A;  1GWP A;  3CC2 P;  3OW2 O;  4GR2 A;  2PWO A;  4XRQ A;  3H0D A;  1N8R Q;  1AK4 C;  3CCM P;  1G03 A;  2CWO A;  3CC4 P;  2XT1 A;  3G4S P;  2Z44 A;  3CCU P;  3G28 A;  1S72 P;  3CCL P;  3H47 A;  4XFX A;  4U0A A;  1M9Y C;  1VQP P;  5F2N A;  1M9D C;  1QRJ A;  4INB A;  3DS4 A;  1VQ6 P;  1D1D A;  2BHV A;  2L6E A;  3BP9 A;  2EG5 A;  2JO0 A;  3G29 A;  1A43 A;  2XGU A;  2V4X A;  5JPA A;  1VQ5 P;  1VQ7 P;  2WLV B;  1K30 A;  2KOD A;  2PEQ A;  2Z46 A;  4XFZ A;  5HGO A;  4U0F A;  1M9F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...