2X2DD

Acetyl-cypa:hiv-1 n-term capsid domain complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A
publication title Acetylation Regulates Cyclophilin a Catalysis, Immunosuppression and HIV Isomerisation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2x2dD00
3NTEA 2KGFA 2XGUA 2XGYA 1EM9A 1U7KA 4PH3A 2Y4ZA 2XGVA 2XDEA 4U0CA 2PXRC 2GOLB 2X83A 4U0AA 3H47A 4XFYA 4PH0A 4XRQA 1L6NA 1AFVA 4QNBA 1M9XC 4J93A 2M8LA 2M8NA 2V4XA 1EIAA 4B4NA 1AK4C 2WLVA 2JPRA 4U0FA 3P05A 5HGKA 4DGAC 5HGOA 1P7NA 5HGLA 4LQWC 1M9YC 5JPAA 1M9FC 4WYMA 4U0DA 4XFXA 2X2DD 1QRJA 3MGEA 1GWPA 4INBA 2WLVB 1M9CC 5HGMA 4PH2A 2X82A 2GONA 4HTWA 4E91A 4U0BA 4U0EA 1E6JP 4NX4C 2EIAA 3BP9A 2LF4A 1D1DA 1M9DC 1M9EC 2M8PA 2PWMA 5HGNA 4XROA 3H4EA 4E92A 4XFZA 1G03A 4DGEC 2PWOA
chains in the Genus database with same CATH superfamily
3NTEA 2KGFA 2XGUA 2XGYA 1EM9A 1U7KA 4PH3A 2Y4ZA 2XGVA 2XDEA 4U0CA 2PXRC 2GOLB 2X83A 4U0AA 3H47A 4XFYA 4PH0A 4XRQA 1L6NA 1AFVA 4QNBA 1M9XC 4J93A 2M8LA 2M8NA 2V4XA 1EIAA 4B4NA 1AK4C 2WLVA 2JPRA 4U0FA 3P05A 5HGKA 4DGAC 5HGOA 1P7NA 5HGLA 4LQWC 1M9YC 5JPAA 1M9FC 4WYMA 4U0DA 4XFXA 2X2DD 1QRJA 3MGEA 1GWPA 4INBA 2WLVB 1M9CC 5HGMA 4PH2A 2X82A 2GONA 4HTWA 4E91A 4U0BA 4U0EA 1E6JP 4NX4C 2EIAA 3BP9A 2LF4A 1D1DA 1M9DC 1M9EC 2M8PA 2PWMA 5HGNA 4XROA 3H4EA 4E92A 4XFZA 1G03A 4DGEC 2PWOA
chains in the Genus database with same CATH topology
3NTEA 2KGFA 2XGUA 2XGYA 1EM9A 1U7KA 4PH3A 2Y4ZA 2XGVA 2XDEA 4U0CA 2PXRC 2GOLB 2X83A 4U0AA 3H47A 4XFYA 4PH0A 4XRQA 1L6NA 1AFVA 4QNBA 1M9XC 4J93A 2M8LA 2M8NA 2V4XA 1EIAA 4B4NA 1AK4C 2WLVA 2JPRA 4U0FA 3P05A 5HGKA 4DGAC 5HGOA 1P7NA 5HGLA 4LQWC 1M9YC 5JPAA 1M9FC 4WYMA 4U0DA 4XFXA 2X2DD 1QRJA 3MGEA 1GWPA 4INBA 2WLVB 1M9CC 5HGMA 4PH2A 2X82A 2GONA 4HTWA 4E91A 4U0BA 4U0EA 1E6JP 4NX4C 2EIAA 3BP9A 2LF4A 1D1DA 1M9DC 1M9EC 2M8PA 2PWMA 5HGNA 4XROA 3H4EA 4E92A 4XFZA 1G03A 4DGEC 2PWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTE A;  2KGF A;  2XGU A;  2XGY A;  1EM9 A;  1U7K A;  4PH3 A;  2Y4Z A;  2XGV A;  2XDE A;  4U0C A;  2PXR C;  2GOL B;  2X83 A;  4U0A A;  3H47 A;  4XFY A;  4PH0 A;  4XRQ A;  1L6N A;  1AFV A;  4QNB A;  1M9X C;  4J93 A;  2M8L A;  2M8N A;  2V4X A;  1EIA A;  4B4N A;  1AK4 C;  2WLV A;  2JPR A;  4U0F A;  3P05 A;  5HGK A;  4DGA C;  5HGO A;  1P7N A;  5HGL A;  4LQW C;  1M9Y C;  5JPA A;  1M9F C;  4WYM A;  4U0D A;  4XFX A;  2X2D D;  1QRJ A;  3MGE A;  1GWP A;  4INB A;  2WLV B;  1M9C C;  5HGM A;  4PH2 A;  2X82 A;  2GON A;  4HTW A;  4E91 A;  4U0B A;  4U0E A;  1E6J P;  4NX4 C;  2EIA A;  3BP9 A;  2LF4 A;  1D1D A;  1M9D C;  1M9E C;  2M8P A;  2PWM A;  5HGN A;  4XRO A;  3H4E A;  4E92 A;  4XFZ A;  1G03 A;  4DGE C;  2PWO A; 
#chains in the Genus database with same CATH topology
 3NTE A;  2KGF A;  2XGU A;  2XGY A;  1EM9 A;  1U7K A;  4PH3 A;  2Y4Z A;  2XGV A;  2XDE A;  4U0C A;  2PXR C;  2GOL B;  2X83 A;  4U0A A;  3H47 A;  4XFY A;  4PH0 A;  4XRQ A;  1L6N A;  1AFV A;  4QNB A;  1M9X C;  4J93 A;  2M8L A;  2M8N A;  2V4X A;  1EIA A;  4B4N A;  1AK4 C;  2WLV A;  2JPR A;  4U0F A;  3P05 A;  5HGK A;  4DGA C;  5HGO A;  1P7N A;  5HGL A;  4LQW C;  1M9Y C;  5JPA A;  1M9F C;  4WYM A;  4U0D A;  4XFX A;  2X2D D;  1QRJ A;  3MGE A;  1GWP A;  4INB A;  2WLV B;  1M9C C;  5HGM A;  4PH2 A;  2X82 A;  2GON A;  4HTW A;  4E91 A;  4U0B A;  4U0E A;  1E6J P;  4NX4 C;  2EIA A;  3BP9 A;  2LF4 A;  1D1D A;  1M9D C;  1M9E C;  2M8P A;  2PWM A;  5HGN A;  4XRO A;  3H4E A;  4E92 A;  4XFZ A;  1G03 A;  4DGE C;  2PWO A; 
#chains in the Genus database with same CATH homology
 3NTE A;  2KGF A;  2XGU A;  2XGY A;  1EM9 A;  1U7K A;  4PH3 A;  2Y4Z A;  2XGV A;  2XDE A;  4U0C A;  2PXR C;  2GOL B;  2X83 A;  4U0A A;  3H47 A;  4XFY A;  4PH0 A;  4XRQ A;  1L6N A;  1AFV A;  4QNB A;  1M9X C;  4J93 A;  2M8L A;  2M8N A;  2V4X A;  1EIA A;  4B4N A;  1AK4 C;  2WLV A;  2JPR A;  4U0F A;  3P05 A;  5HGK A;  4DGA C;  5HGO A;  1P7N A;  5HGL A;  4LQW C;  1M9Y C;  5JPA A;  1M9F C;  4WYM A;  4U0D A;  4XFX A;  2X2D D;  1QRJ A;  3MGE A;  1GWP A;  4INB A;  2WLV B;  1M9C C;  5HGM A;  4PH2 A;  2X82 A;  2GON A;  4HTW A;  4E91 A;  4U0B A;  4U0E A;  1E6J P;  4NX4 C;  2EIA A;  3BP9 A;  2LF4 A;  1D1D A;  1M9D C;  1M9E C;  2M8P A;  2PWM A;  5HGN A;  4XRO A;  3H4E A;  4E92 A;  4XFZ A;  1G03 A;  4DGE C;  2PWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...