4DGAC

Trimcyp cyclophilin domain from macaca mulatta: hiv-1 ca(o-loop) complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
138
Chain Sequence
PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPTGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIMCyp
publication title Diverse HIV viruses are targeted by a conformationally dynamic antiviral.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Isomerase/viral protein
total genus 48
structure length 138
sequence length 145
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4dgaC00
4U0CA 1M9XC 2KGFA 1U7KA 4INBA 4XFYA 5HGOA 1M9EC 1GWPA 3P05A 2XGUA 3NTEA 1M9CC 5JPAA 4U0DA 2X2DD 2XGVA 2GONA 1AFVA 4XFZA 2XGYA 2LF4A 1AK4C 5HGMA 2M8PA 2M8LA 1M9FC 2GOLB 2XDEA 4U0FA 4XROA 4QNBA 1EIAA 4PH0A 2PXRC 1QRJA 4U0BA 5HGLA 4E91A 3BP9A 4E92A 1G03A 4PH2A 1M9DC 2PWMA 2Y4ZA 4PH3A 4HTWA 2WLVB 2V4XA 4DGEC 2WLVA 2X83A 2JPRA 4DGAC 4WYMA 4B4NA 5HGKA 2EIAA 5HGNA 4U0EA 4NX4C 1L6NA 4XFXA 2PWOA 3H47A 1EM9A 3MGEA 1D1DA 1M9YC 1E6JP 4J93A 4U0AA 4XRQA 2M8NA 1P7NA 3H4EA 2X82A 4LQWC
chains in the Genus database with same CATH superfamily
4U0CA 1M9XC 2KGFA 1U7KA 4INBA 4XFYA 5HGOA 1M9EC 1GWPA 3P05A 2XGUA 3NTEA 1M9CC 5JPAA 4U0DA 2X2DD 2XGVA 2GONA 1AFVA 4XFZA 2XGYA 2LF4A 1AK4C 5HGMA 2M8PA 2M8LA 1M9FC 2GOLB 2XDEA 4U0FA 4XROA 4QNBA 1EIAA 4PH0A 2PXRC 1QRJA 4U0BA 5HGLA 4E91A 3BP9A 4E92A 1G03A 4PH2A 1M9DC 2PWMA 2Y4ZA 4PH3A 4HTWA 2WLVB 2V4XA 4DGEC 2WLVA 2X83A 2JPRA 4DGAC 4WYMA 4B4NA 5HGKA 2EIAA 5HGNA 4U0EA 4NX4C 1L6NA 4XFXA 2PWOA 3H47A 1EM9A 3MGEA 1D1DA 1M9YC 1E6JP 4J93A 4U0AA 4XRQA 2M8NA 1P7NA 3H4EA 2X82A 4LQWC
chains in the Genus database with same CATH topology
4U0CA 1M9XC 2KGFA 1U7KA 4INBA 4XFYA 5HGOA 1M9EC 1GWPA 3P05A 2XGUA 3NTEA 1M9CC 5JPAA 4U0DA 2X2DD 2XGVA 2GONA 1AFVA 4XFZA 2XGYA 2LF4A 1AK4C 5HGMA 2M8PA 2M8LA 1M9FC 2GOLB 2XDEA 4U0FA 4XROA 4QNBA 1EIAA 4PH0A 2PXRC 1QRJA 4U0BA 5HGLA 4E91A 3BP9A 4E92A 1G03A 4PH2A 1M9DC 2PWMA 2Y4ZA 4PH3A 4HTWA 2WLVB 2V4XA 4DGEC 2WLVA 2X83A 2JPRA 4DGAC 4WYMA 4B4NA 5HGKA 2EIAA 5HGNA 4U0EA 4NX4C 1L6NA 4XFXA 2PWOA 3H47A 1EM9A 3MGEA 1D1DA 1M9YC 1E6JP 4J93A 4U0AA 4XRQA 2M8NA 1P7NA 3H4EA 2X82A 4LQWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0C A;  1M9X C;  2KGF A;  1U7K A;  4INB A;  4XFY A;  5HGO A;  1M9E C;  1GWP A;  3P05 A;  2XGU A;  3NTE A;  1M9C C;  5JPA A;  4U0D A;  2X2D D;  2XGV A;  2GON A;  1AFV A;  4XFZ A;  2XGY A;  2LF4 A;  1AK4 C;  5HGM A;  2M8P A;  2M8L A;  1M9F C;  2GOL B;  2XDE A;  4U0F A;  4XRO A;  4QNB A;  1EIA A;  4PH0 A;  2PXR C;  1QRJ A;  4U0B A;  5HGL A;  4E91 A;  3BP9 A;  4E92 A;  1G03 A;  4PH2 A;  1M9D C;  2PWM A;  2Y4Z A;  4PH3 A;  4HTW A;  2WLV B;  2V4X A;  4DGE C;  2WLV A;  2X83 A;  2JPR A;  4DGA C;  4WYM A;  4B4N A;  5HGK A;  2EIA A;  5HGN A;  4U0E A;  4NX4 C;  1L6N A;  4XFX A;  2PWO A;  3H47 A;  1EM9 A;  3MGE A;  1D1D A;  1M9Y C;  1E6J P;  4J93 A;  4U0A A;  4XRQ A;  2M8N A;  1P7N A;  3H4E A;  2X82 A;  4LQW C; 
#chains in the Genus database with same CATH topology
 4U0C A;  1M9X C;  2KGF A;  1U7K A;  4INB A;  4XFY A;  5HGO A;  1M9E C;  1GWP A;  3P05 A;  2XGU A;  3NTE A;  1M9C C;  5JPA A;  4U0D A;  2X2D D;  2XGV A;  2GON A;  1AFV A;  4XFZ A;  2XGY A;  2LF4 A;  1AK4 C;  5HGM A;  2M8P A;  2M8L A;  1M9F C;  2GOL B;  2XDE A;  4U0F A;  4XRO A;  4QNB A;  1EIA A;  4PH0 A;  2PXR C;  1QRJ A;  4U0B A;  5HGL A;  4E91 A;  3BP9 A;  4E92 A;  1G03 A;  4PH2 A;  1M9D C;  2PWM A;  2Y4Z A;  4PH3 A;  4HTW A;  2WLV B;  2V4X A;  4DGE C;  2WLV A;  2X83 A;  2JPR A;  4DGA C;  4WYM A;  4B4N A;  5HGK A;  2EIA A;  5HGN A;  4U0E A;  4NX4 C;  1L6N A;  4XFX A;  2PWO A;  3H47 A;  1EM9 A;  3MGE A;  1D1D A;  1M9Y C;  1E6J P;  4J93 A;  4U0A A;  4XRQ A;  2M8N A;  1P7N A;  3H4E A;  2X82 A;  4LQW C; 
#chains in the Genus database with same CATH homology
 4U0C A;  1M9X C;  2KGF A;  1U7K A;  4INB A;  4XFY A;  5HGO A;  1M9E C;  1GWP A;  3P05 A;  2XGU A;  3NTE A;  1M9C C;  5JPA A;  4U0D A;  2X2D D;  2XGV A;  2GON A;  1AFV A;  4XFZ A;  2XGY A;  2LF4 A;  1AK4 C;  5HGM A;  2M8P A;  2M8L A;  1M9F C;  2GOL B;  2XDE A;  4U0F A;  4XRO A;  4QNB A;  1EIA A;  4PH0 A;  2PXR C;  1QRJ A;  4U0B A;  5HGL A;  4E91 A;  3BP9 A;  4E92 A;  1G03 A;  4PH2 A;  1M9D C;  2PWM A;  2Y4Z A;  4PH3 A;  4HTW A;  2WLV B;  2V4X A;  4DGE C;  2WLV A;  2X83 A;  2JPR A;  4DGA C;  4WYM A;  4B4N A;  5HGK A;  2EIA A;  5HGN A;  4U0E A;  4NX4 C;  1L6N A;  4XFX A;  2PWO A;  3H47 A;  1EM9 A;  3MGE A;  1D1D A;  1M9Y C;  1E6J P;  4J93 A;  4U0A A;  4XRQ A;  2M8N A;  1P7N A;  3H4E A;  2X82 A;  4LQW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...