4DGAC

Trimcyp cyclophilin domain from macaca mulatta: hiv-1 ca(o-loop) complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
138
Chain Sequence
PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPTGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/viral protein
molecule keywords TRIMCyp
publication title Diverse HIV viruses are targeted by a conformationally dynamic antiviral.
pubmed doi rcsb
source organism Macaca mulatta
total genus 48
structure length 138
sequence length 145
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4dgaC00
1M9EC 1QRJA 5HGLA 1U7KA 4XFZA 2V4XA 4XRQA 2X82A 4E92A 2GONA 2X2DD 4DGAC 4HTWA 1D1DA 3H4EA 4PH2A 1AK4C 4INBA 5HGNA 4PH0A 4B4NA 3MGEA 5HGOA 1G03A 4XFYA 4U0FA 2XGVA 4XFXA 4U0DA 4U0EA 4U0CA 4WYMA 2PXRC 2XDEA 4DGEC 1GWPA 2WLVA 4QNBA 2Y4ZA 2X83A 4XROA 2WLVB 2PWMA 2XGYA 2XGUA 3P05A 5HGKA 5JPAA 4NX4C 1M9DC 4PH3A 2KGFA 5HGMA 4LQWC 2M8LA 1M9YC 3NTEA 4U0BA 2M8NA 2GOLB 1E6JP 2EIAA 2LF4A 4E91A 1AFVA 1EM9A 1M9CC 1M9XC 2M8PA 3BP9A 3H47A 1EIAA 1P7NA 1L6NA 2JPRA 4J93A 1M9FC 4U0AA 2PWOA
chains in the Genus database with same CATH superfamily
1M9EC 1QRJA 5HGLA 1U7KA 4XFZA 2V4XA 4XRQA 2X82A 4E92A 2GONA 2X2DD 4DGAC 4HTWA 1D1DA 3H4EA 4PH2A 1AK4C 4INBA 5HGNA 4PH0A 4B4NA 3MGEA 5HGOA 1G03A 4XFYA 4U0FA 2XGVA 4XFXA 4U0DA 4U0EA 4U0CA 4WYMA 2PXRC 2XDEA 4DGEC 1GWPA 2WLVA 4QNBA 2Y4ZA 2X83A 4XROA 2WLVB 2PWMA 2XGYA 2XGUA 3P05A 5HGKA 5JPAA 4NX4C 1M9DC 4PH3A 2KGFA 5HGMA 4LQWC 2M8LA 1M9YC 3NTEA 4U0BA 2M8NA 2GOLB 1E6JP 2EIAA 2LF4A 4E91A 1AFVA 1EM9A 1M9CC 1M9XC 2M8PA 3BP9A 3H47A 1EIAA 1P7NA 1L6NA 2JPRA 4J93A 1M9FC 4U0AA 2PWOA
chains in the Genus database with same CATH topology
1M9EC 1QRJA 5HGLA 1U7KA 4XFZA 2V4XA 4XRQA 2X82A 4E92A 2GONA 2X2DD 4DGAC 4HTWA 1D1DA 3H4EA 4PH2A 1AK4C 4INBA 5HGNA 4PH0A 4B4NA 3MGEA 5HGOA 1G03A 4XFYA 4U0FA 2XGVA 4XFXA 4U0DA 4U0EA 4U0CA 4WYMA 2PXRC 2XDEA 4DGEC 1GWPA 2WLVA 4QNBA 2Y4ZA 2X83A 4XROA 2WLVB 2PWMA 2XGYA 2XGUA 3P05A 5HGKA 5JPAA 4NX4C 1M9DC 4PH3A 2KGFA 5HGMA 4LQWC 2M8LA 1M9YC 3NTEA 4U0BA 2M8NA 2GOLB 1E6JP 2EIAA 2LF4A 4E91A 1AFVA 1EM9A 1M9CC 1M9XC 2M8PA 3BP9A 3H47A 1EIAA 1P7NA 1L6NA 2JPRA 4J93A 1M9FC 4U0AA 2PWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9E C;  1QRJ A;  5HGL A;  1U7K A;  4XFZ A;  2V4X A;  4XRQ A;  2X82 A;  4E92 A;  2GON A;  2X2D D;  4DGA C;  4HTW A;  1D1D A;  3H4E A;  4PH2 A;  1AK4 C;  4INB A;  5HGN A;  4PH0 A;  4B4N A;  3MGE A;  5HGO A;  1G03 A;  4XFY A;  4U0F A;  2XGV A;  4XFX A;  4U0D A;  4U0E A;  4U0C A;  4WYM A;  2PXR C;  2XDE A;  4DGE C;  1GWP A;  2WLV A;  4QNB A;  2Y4Z A;  2X83 A;  4XRO A;  2WLV B;  2PWM A;  2XGY A;  2XGU A;  3P05 A;  5HGK A;  5JPA A;  4NX4 C;  1M9D C;  4PH3 A;  2KGF A;  5HGM A;  4LQW C;  2M8L A;  1M9Y C;  3NTE A;  4U0B A;  2M8N A;  2GOL B;  1E6J P;  2EIA A;  2LF4 A;  4E91 A;  1AFV A;  1EM9 A;  1M9C C;  1M9X C;  2M8P A;  3BP9 A;  3H47 A;  1EIA A;  1P7N A;  1L6N A;  2JPR A;  4J93 A;  1M9F C;  4U0A A;  2PWO A; 
#chains in the Genus database with same CATH topology
 1M9E C;  1QRJ A;  5HGL A;  1U7K A;  4XFZ A;  2V4X A;  4XRQ A;  2X82 A;  4E92 A;  2GON A;  2X2D D;  4DGA C;  4HTW A;  1D1D A;  3H4E A;  4PH2 A;  1AK4 C;  4INB A;  5HGN A;  4PH0 A;  4B4N A;  3MGE A;  5HGO A;  1G03 A;  4XFY A;  4U0F A;  2XGV A;  4XFX A;  4U0D A;  4U0E A;  4U0C A;  4WYM A;  2PXR C;  2XDE A;  4DGE C;  1GWP A;  2WLV A;  4QNB A;  2Y4Z A;  2X83 A;  4XRO A;  2WLV B;  2PWM A;  2XGY A;  2XGU A;  3P05 A;  5HGK A;  5JPA A;  4NX4 C;  1M9D C;  4PH3 A;  2KGF A;  5HGM A;  4LQW C;  2M8L A;  1M9Y C;  3NTE A;  4U0B A;  2M8N A;  2GOL B;  1E6J P;  2EIA A;  2LF4 A;  4E91 A;  1AFV A;  1EM9 A;  1M9C C;  1M9X C;  2M8P A;  3BP9 A;  3H47 A;  1EIA A;  1P7N A;  1L6N A;  2JPR A;  4J93 A;  1M9F C;  4U0A A;  2PWO A; 
#chains in the Genus database with same CATH homology
 1M9E C;  1QRJ A;  5HGL A;  1U7K A;  4XFZ A;  2V4X A;  4XRQ A;  2X82 A;  4E92 A;  2GON A;  2X2D D;  4DGA C;  4HTW A;  1D1D A;  3H4E A;  4PH2 A;  1AK4 C;  4INB A;  5HGN A;  4PH0 A;  4B4N A;  3MGE A;  5HGO A;  1G03 A;  4XFY A;  4U0F A;  2XGV A;  4XFX A;  4U0D A;  4U0E A;  4U0C A;  4WYM A;  2PXR C;  2XDE A;  4DGE C;  1GWP A;  2WLV A;  4QNB A;  2Y4Z A;  2X83 A;  4XRO A;  2WLV B;  2PWM A;  2XGY A;  2XGU A;  3P05 A;  5HGK A;  5JPA A;  4NX4 C;  1M9D C;  4PH3 A;  2KGF A;  5HGM A;  4LQW C;  2M8L A;  1M9Y C;  3NTE A;  4U0B A;  2M8N A;  2GOL B;  1E6J P;  2EIA A;  2LF4 A;  4E91 A;  1AFV A;  1EM9 A;  1M9C C;  1M9X C;  2M8P A;  3BP9 A;  3H47 A;  1EIA A;  1P7N A;  1L6N A;  2JPR A;  4J93 A;  1M9F C;  4U0A A;  2PWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...