4DGAC

Trimcyp cyclophilin domain from macaca mulatta: hiv-1 ca(o-loop) complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
138
Chain Sequence
PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPTGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse HIV viruses are targeted by a conformationally dynamic antiviral.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Isomerase/viral protein
molecule keywords TRIMCyp
total genus 48
structure length 138
sequence length 145
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4dgaC00
1M9FC 3MGEA 3P05A 5HGNA 1G03A 2GOLB 2JPRA 4J93A 4E92A 1P7NA 2PXRC 2X2DD 4QNBA 4WYMA 4PH2A 3H47A 1AFVA 4DGAC 2WLVB 5HGLA 1L6NA 4PH0A 4U0FA 1EM9A 4PH3A 2WLVA 2X83A 4XROA 2KGFA 4B4NA 1M9YC 2EIAA 3BP9A 1D1DA 1GWPA 4XFZA 1E6JP 2GONA 2LF4A 1U7KA 2M8LA 1AK4C 2PWOA 2Y4ZA 4LQWC 4U0EA 5JPAA 5HGMA 2XGVA 2XGUA 2XGYA 1M9CC 4DGEC 2PWMA 1M9DC 1QRJA 2V4XA 4U0CA 1M9EC 2M8NA 4U0DA 4XFXA 4U0AA 4NX4C 2XDEA 4HTWA 4E91A 1M9XC 4XRQA 5HGKA 2X82A 3H4EA 2M8PA 4INBA 4U0BA 1EIAA 4XFYA 5HGOA 3NTEA
chains in the Genus database with same CATH superfamily
1M9FC 3MGEA 3P05A 5HGNA 1G03A 2GOLB 2JPRA 4J93A 4E92A 1P7NA 2PXRC 2X2DD 4QNBA 4WYMA 4PH2A 3H47A 1AFVA 4DGAC 2WLVB 5HGLA 1L6NA 4PH0A 4U0FA 1EM9A 4PH3A 2WLVA 2X83A 4XROA 2KGFA 4B4NA 1M9YC 2EIAA 3BP9A 1D1DA 1GWPA 4XFZA 1E6JP 2GONA 2LF4A 1U7KA 2M8LA 1AK4C 2PWOA 2Y4ZA 4LQWC 4U0EA 5JPAA 5HGMA 2XGVA 2XGUA 2XGYA 1M9CC 4DGEC 2PWMA 1M9DC 1QRJA 2V4XA 4U0CA 1M9EC 2M8NA 4U0DA 4XFXA 4U0AA 4NX4C 2XDEA 4HTWA 4E91A 1M9XC 4XRQA 5HGKA 2X82A 3H4EA 2M8PA 4INBA 4U0BA 1EIAA 4XFYA 5HGOA 3NTEA
chains in the Genus database with same CATH topology
1M9FC 3MGEA 3P05A 5HGNA 1G03A 2GOLB 2JPRA 4J93A 4E92A 1P7NA 2PXRC 2X2DD 4QNBA 4WYMA 4PH2A 3H47A 1AFVA 4DGAC 2WLVB 5HGLA 1L6NA 4PH0A 4U0FA 1EM9A 4PH3A 2WLVA 2X83A 4XROA 2KGFA 4B4NA 1M9YC 2EIAA 3BP9A 1D1DA 1GWPA 4XFZA 1E6JP 2GONA 2LF4A 1U7KA 2M8LA 1AK4C 2PWOA 2Y4ZA 4LQWC 4U0EA 5JPAA 5HGMA 2XGVA 2XGUA 2XGYA 1M9CC 4DGEC 2PWMA 1M9DC 1QRJA 2V4XA 4U0CA 1M9EC 2M8NA 4U0DA 4XFXA 4U0AA 4NX4C 2XDEA 4HTWA 4E91A 1M9XC 4XRQA 5HGKA 2X82A 3H4EA 2M8PA 4INBA 4U0BA 1EIAA 4XFYA 5HGOA 3NTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9F C;  3MGE A;  3P05 A;  5HGN A;  1G03 A;  2GOL B;  2JPR A;  4J93 A;  4E92 A;  1P7N A;  2PXR C;  2X2D D;  4QNB A;  4WYM A;  4PH2 A;  3H47 A;  1AFV A;  4DGA C;  2WLV B;  5HGL A;  1L6N A;  4PH0 A;  4U0F A;  1EM9 A;  4PH3 A;  2WLV A;  2X83 A;  4XRO A;  2KGF A;  4B4N A;  1M9Y C;  2EIA A;  3BP9 A;  1D1D A;  1GWP A;  4XFZ A;  1E6J P;  2GON A;  2LF4 A;  1U7K A;  2M8L A;  1AK4 C;  2PWO A;  2Y4Z A;  4LQW C;  4U0E A;  5JPA A;  5HGM A;  2XGV A;  2XGU A;  2XGY A;  1M9C C;  4DGE C;  2PWM A;  1M9D C;  1QRJ A;  2V4X A;  4U0C A;  1M9E C;  2M8N A;  4U0D A;  4XFX A;  4U0A A;  4NX4 C;  2XDE A;  4HTW A;  4E91 A;  1M9X C;  4XRQ A;  5HGK A;  2X82 A;  3H4E A;  2M8P A;  4INB A;  4U0B A;  1EIA A;  4XFY A;  5HGO A;  3NTE A; 
#chains in the Genus database with same CATH topology
 1M9F C;  3MGE A;  3P05 A;  5HGN A;  1G03 A;  2GOL B;  2JPR A;  4J93 A;  4E92 A;  1P7N A;  2PXR C;  2X2D D;  4QNB A;  4WYM A;  4PH2 A;  3H47 A;  1AFV A;  4DGA C;  2WLV B;  5HGL A;  1L6N A;  4PH0 A;  4U0F A;  1EM9 A;  4PH3 A;  2WLV A;  2X83 A;  4XRO A;  2KGF A;  4B4N A;  1M9Y C;  2EIA A;  3BP9 A;  1D1D A;  1GWP A;  4XFZ A;  1E6J P;  2GON A;  2LF4 A;  1U7K A;  2M8L A;  1AK4 C;  2PWO A;  2Y4Z A;  4LQW C;  4U0E A;  5JPA A;  5HGM A;  2XGV A;  2XGU A;  2XGY A;  1M9C C;  4DGE C;  2PWM A;  1M9D C;  1QRJ A;  2V4X A;  4U0C A;  1M9E C;  2M8N A;  4U0D A;  4XFX A;  4U0A A;  4NX4 C;  2XDE A;  4HTW A;  4E91 A;  1M9X C;  4XRQ A;  5HGK A;  2X82 A;  3H4E A;  2M8P A;  4INB A;  4U0B A;  1EIA A;  4XFY A;  5HGO A;  3NTE A; 
#chains in the Genus database with same CATH homology
 1M9F C;  3MGE A;  3P05 A;  5HGN A;  1G03 A;  2GOL B;  2JPR A;  4J93 A;  4E92 A;  1P7N A;  2PXR C;  2X2D D;  4QNB A;  4WYM A;  4PH2 A;  3H47 A;  1AFV A;  4DGA C;  2WLV B;  5HGL A;  1L6N A;  4PH0 A;  4U0F A;  1EM9 A;  4PH3 A;  2WLV A;  2X83 A;  4XRO A;  2KGF A;  4B4N A;  1M9Y C;  2EIA A;  3BP9 A;  1D1D A;  1GWP A;  4XFZ A;  1E6J P;  2GON A;  2LF4 A;  1U7K A;  2M8L A;  1AK4 C;  2PWO A;  2Y4Z A;  4LQW C;  4U0E A;  5JPA A;  5HGM A;  2XGV A;  2XGU A;  2XGY A;  1M9C C;  4DGE C;  2PWM A;  1M9D C;  1QRJ A;  2V4X A;  4U0C A;  1M9E C;  2M8N A;  4U0D A;  4XFX A;  4U0A A;  4NX4 C;  2XDE A;  4HTW A;  4E91 A;  1M9X C;  4XRQ A;  5HGK A;  2X82 A;  3H4E A;  2M8P A;  4INB A;  4U0B A;  1EIA A;  4XFY A;  5HGO A;  3NTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...