1EM9A

Rous sarcoma virus capsid protein: n-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
b'PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
publication title Structure and self-association of the Rous sarcoma virus capsid protein.
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
molecule tags Viral protein
total genus 53
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1em9A00
1M9XC 2KGFA 2XGYA 4U0FA 1G03A 4E91A 4DGEC 4XFZA 4PH0A 2M8LA 4U0CA 4J93A 2XDEA 2V4XA 2Y4ZA 2XGUA 4DGAC 1L6NA 1EM9A 1M9FC 2M8PA 3H47A 2PWOA 3P05A 2M8NA 2GONA 4WYMA 3NTEA 5HGKA 1M9DC 4XROA 1EIAA 1AK4C 2XGVA 1M9CC 4HTWA 2WLVB 4PH3A 1P7NA 3MGEA 1U7KA 1D1DA 1QRJA 4U0DA 2X83A 4INBA 4XRQA 5HGOA 2JPRA 2EIAA 4B4NA 2X2DD 2WLVA 1M9EC 4QNBA 4LQWC 4XFXA 4XFYA 5HGMA 3BP9A 4U0AA 2X82A 4U0EA 1AFVA 2PXRC 1E6JP 4NX4C 5JPAA 3H4EA 2PWMA 4U0BA 5HGLA 2GOLB 2LF4A 1GWPA 4PH2A 1M9YC 5HGNA 4E92A
chains in the Genus database with same CATH superfamily
1M9XC 2KGFA 2XGYA 4U0FA 1G03A 4E91A 4DGEC 4XFZA 4PH0A 2M8LA 4U0CA 4J93A 2XDEA 2V4XA 2Y4ZA 2XGUA 4DGAC 1L6NA 1EM9A 1M9FC 2M8PA 3H47A 2PWOA 3P05A 2M8NA 2GONA 4WYMA 3NTEA 5HGKA 1M9DC 4XROA 1EIAA 1AK4C 2XGVA 1M9CC 4HTWA 2WLVB 4PH3A 1P7NA 3MGEA 1U7KA 1D1DA 1QRJA 4U0DA 2X83A 4INBA 4XRQA 5HGOA 2JPRA 2EIAA 4B4NA 2X2DD 2WLVA 1M9EC 4QNBA 4LQWC 4XFXA 4XFYA 5HGMA 3BP9A 4U0AA 2X82A 4U0EA 1AFVA 2PXRC 1E6JP 4NX4C 5JPAA 3H4EA 2PWMA 4U0BA 5HGLA 2GOLB 2LF4A 1GWPA 4PH2A 1M9YC 5HGNA 4E92A
chains in the Genus database with same CATH topology
1M9XC 2KGFA 2XGYA 4U0FA 1G03A 4E91A 4DGEC 4XFZA 4PH0A 2M8LA 4U0CA 4J93A 2XDEA 2V4XA 2Y4ZA 2XGUA 4DGAC 1L6NA 1EM9A 1M9FC 2M8PA 3H47A 2PWOA 3P05A 2M8NA 2GONA 4WYMA 3NTEA 5HGKA 1M9DC 4XROA 1EIAA 1AK4C 2XGVA 1M9CC 4HTWA 2WLVB 4PH3A 1P7NA 3MGEA 1U7KA 1D1DA 1QRJA 4U0DA 2X83A 4INBA 4XRQA 5HGOA 2JPRA 2EIAA 4B4NA 2X2DD 2WLVA 1M9EC 4QNBA 4LQWC 4XFXA 4XFYA 5HGMA 3BP9A 4U0AA 2X82A 4U0EA 1AFVA 2PXRC 1E6JP 4NX4C 5JPAA 3H4EA 2PWMA 4U0BA 5HGLA 2GOLB 2LF4A 1GWPA 4PH2A 1M9YC 5HGNA 4E92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9X C;  2KGF A;  2XGY A;  4U0F A;  1G03 A;  4E91 A;  4DGE C;  4XFZ A;  4PH0 A;  2M8L A;  4U0C A;  4J93 A;  2XDE A;  2V4X A;  2Y4Z A;  2XGU A;  4DGA C;  1L6N A;  1EM9 A;  1M9F C;  2M8P A;  3H47 A;  2PWO A;  3P05 A;  2M8N A;  2GON A;  4WYM A;  3NTE A;  5HGK A;  1M9D C;  4XRO A;  1EIA A;  1AK4 C;  2XGV A;  1M9C C;  4HTW A;  2WLV B;  4PH3 A;  1P7N A;  3MGE A;  1U7K A;  1D1D A;  1QRJ A;  4U0D A;  2X83 A;  4INB A;  4XRQ A;  5HGO A;  2JPR A;  2EIA A;  4B4N A;  2X2D D;  2WLV A;  1M9E C;  4QNB A;  4LQW C;  4XFX A;  4XFY A;  5HGM A;  3BP9 A;  4U0A A;  2X82 A;  4U0E A;  1AFV A;  2PXR C;  1E6J P;  4NX4 C;  5JPA A;  3H4E A;  2PWM A;  4U0B A;  5HGL A;  2GOL B;  2LF4 A;  1GWP A;  4PH2 A;  1M9Y C;  5HGN A;  4E92 A; 
#chains in the Genus database with same CATH topology
 1M9X C;  2KGF A;  2XGY A;  4U0F A;  1G03 A;  4E91 A;  4DGE C;  4XFZ A;  4PH0 A;  2M8L A;  4U0C A;  4J93 A;  2XDE A;  2V4X A;  2Y4Z A;  2XGU A;  4DGA C;  1L6N A;  1EM9 A;  1M9F C;  2M8P A;  3H47 A;  2PWO A;  3P05 A;  2M8N A;  2GON A;  4WYM A;  3NTE A;  5HGK A;  1M9D C;  4XRO A;  1EIA A;  1AK4 C;  2XGV A;  1M9C C;  4HTW A;  2WLV B;  4PH3 A;  1P7N A;  3MGE A;  1U7K A;  1D1D A;  1QRJ A;  4U0D A;  2X83 A;  4INB A;  4XRQ A;  5HGO A;  2JPR A;  2EIA A;  4B4N A;  2X2D D;  2WLV A;  1M9E C;  4QNB A;  4LQW C;  4XFX A;  4XFY A;  5HGM A;  3BP9 A;  4U0A A;  2X82 A;  4U0E A;  1AFV A;  2PXR C;  1E6J P;  4NX4 C;  5JPA A;  3H4E A;  2PWM A;  4U0B A;  5HGL A;  2GOL B;  2LF4 A;  1GWP A;  4PH2 A;  1M9Y C;  5HGN A;  4E92 A; 
#chains in the Genus database with same CATH homology
 1M9X C;  2KGF A;  2XGY A;  4U0F A;  1G03 A;  4E91 A;  4DGE C;  4XFZ A;  4PH0 A;  2M8L A;  4U0C A;  4J93 A;  2XDE A;  2V4X A;  2Y4Z A;  2XGU A;  4DGA C;  1L6N A;  1EM9 A;  1M9F C;  2M8P A;  3H47 A;  2PWO A;  3P05 A;  2M8N A;  2GON A;  4WYM A;  3NTE A;  5HGK A;  1M9D C;  4XRO A;  1EIA A;  1AK4 C;  2XGV A;  1M9C C;  4HTW A;  2WLV B;  4PH3 A;  1P7N A;  3MGE A;  1U7K A;  1D1D A;  1QRJ A;  4U0D A;  2X83 A;  4INB A;  4XRQ A;  5HGO A;  2JPR A;  2EIA A;  4B4N A;  2X2D D;  2WLV A;  1M9E C;  4QNB A;  4LQW C;  4XFX A;  4XFY A;  5HGM A;  3BP9 A;  4U0A A;  2X82 A;  4U0E A;  1AFV A;  2PXR C;  1E6J P;  4NX4 C;  5JPA A;  3H4E A;  2PWM A;  4U0B A;  5HGL A;  2GOL B;  2LF4 A;  1GWP A;  4PH2 A;  1M9Y C;  5HGN A;  4E92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...