1EM9A

Rous sarcoma virus capsid protein: n-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
publication title Structure and self-association of the Rous sarcoma virus capsid protein.
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
total genus 53
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1em9A00
3NTEA 4U0AA 4HTWA 5HGOA 3MGEA 1G03A 4LQWC 2XGUA 3P05A 2EIAA 2PXRC 1M9EC 1E6JP 1M9DC 4PH3A 4U0CA 4WYMA 2M8LA 2GONA 2PWMA 1U7KA 4PH0A 2M8NA 1M9FC 1L6NA 2XDEA 4INBA 4DGEC 5HGKA 1M9XC 4XFXA 1EIAA 5HGLA 4E92A 4J93A 4XFYA 2XGVA 2M8PA 4U0BA 4NX4C 5JPAA 3H47A 2PWOA 5HGMA 4E91A 1M9YC 3BP9A 4B4NA 2WLVB 4XROA 1EM9A 1AFVA 4PH2A 2WLVA 2V4XA 2GOLB 2KGFA 2LF4A 2JPRA 5HGNA 4XRQA 2X82A 4XFZA 1D1DA 1GWPA 4QNBA 1M9CC 4U0FA 3H4EA 2Y4ZA 2X83A 4DGAC 1P7NA 2XGYA 1AK4C 4U0EA 2X2DD 4U0DA 1QRJA
chains in the Genus database with same CATH superfamily
3NTEA 4U0AA 4HTWA 5HGOA 3MGEA 1G03A 4LQWC 2XGUA 3P05A 2EIAA 2PXRC 1M9EC 1E6JP 1M9DC 4PH3A 4U0CA 4WYMA 2M8LA 2GONA 2PWMA 1U7KA 4PH0A 2M8NA 1M9FC 1L6NA 2XDEA 4INBA 4DGEC 5HGKA 1M9XC 4XFXA 1EIAA 5HGLA 4E92A 4J93A 4XFYA 2XGVA 2M8PA 4U0BA 4NX4C 5JPAA 3H47A 2PWOA 5HGMA 4E91A 1M9YC 3BP9A 4B4NA 2WLVB 4XROA 1EM9A 1AFVA 4PH2A 2WLVA 2V4XA 2GOLB 2KGFA 2LF4A 2JPRA 5HGNA 4XRQA 2X82A 4XFZA 1D1DA 1GWPA 4QNBA 1M9CC 4U0FA 3H4EA 2Y4ZA 2X83A 4DGAC 1P7NA 2XGYA 1AK4C 4U0EA 2X2DD 4U0DA 1QRJA
chains in the Genus database with same CATH topology
3NTEA 4U0AA 4HTWA 5HGOA 3MGEA 1G03A 4LQWC 2XGUA 3P05A 2EIAA 2PXRC 1M9EC 1E6JP 1M9DC 4PH3A 4U0CA 4WYMA 2M8LA 2GONA 2PWMA 1U7KA 4PH0A 2M8NA 1M9FC 1L6NA 2XDEA 4INBA 4DGEC 5HGKA 1M9XC 4XFXA 1EIAA 5HGLA 4E92A 4J93A 4XFYA 2XGVA 2M8PA 4U0BA 4NX4C 5JPAA 3H47A 2PWOA 5HGMA 4E91A 1M9YC 3BP9A 4B4NA 2WLVB 4XROA 1EM9A 1AFVA 4PH2A 2WLVA 2V4XA 2GOLB 2KGFA 2LF4A 2JPRA 5HGNA 4XRQA 2X82A 4XFZA 1D1DA 1GWPA 4QNBA 1M9CC 4U0FA 3H4EA 2Y4ZA 2X83A 4DGAC 1P7NA 2XGYA 1AK4C 4U0EA 2X2DD 4U0DA 1QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTE A;  4U0A A;  4HTW A;  5HGO A;  3MGE A;  1G03 A;  4LQW C;  2XGU A;  3P05 A;  2EIA A;  2PXR C;  1M9E C;  1E6J P;  1M9D C;  4PH3 A;  4U0C A;  4WYM A;  2M8L A;  2GON A;  2PWM A;  1U7K A;  4PH0 A;  2M8N A;  1M9F C;  1L6N A;  2XDE A;  4INB A;  4DGE C;  5HGK A;  1M9X C;  4XFX A;  1EIA A;  5HGL A;  4E92 A;  4J93 A;  4XFY A;  2XGV A;  2M8P A;  4U0B A;  4NX4 C;  5JPA A;  3H47 A;  2PWO A;  5HGM A;  4E91 A;  1M9Y C;  3BP9 A;  4B4N A;  2WLV B;  4XRO A;  1EM9 A;  1AFV A;  4PH2 A;  2WLV A;  2V4X A;  2GOL B;  2KGF A;  2LF4 A;  2JPR A;  5HGN A;  4XRQ A;  2X82 A;  4XFZ A;  1D1D A;  1GWP A;  4QNB A;  1M9C C;  4U0F A;  3H4E A;  2Y4Z A;  2X83 A;  4DGA C;  1P7N A;  2XGY A;  1AK4 C;  4U0E A;  2X2D D;  4U0D A;  1QRJ A; 
#chains in the Genus database with same CATH topology
 3NTE A;  4U0A A;  4HTW A;  5HGO A;  3MGE A;  1G03 A;  4LQW C;  2XGU A;  3P05 A;  2EIA A;  2PXR C;  1M9E C;  1E6J P;  1M9D C;  4PH3 A;  4U0C A;  4WYM A;  2M8L A;  2GON A;  2PWM A;  1U7K A;  4PH0 A;  2M8N A;  1M9F C;  1L6N A;  2XDE A;  4INB A;  4DGE C;  5HGK A;  1M9X C;  4XFX A;  1EIA A;  5HGL A;  4E92 A;  4J93 A;  4XFY A;  2XGV A;  2M8P A;  4U0B A;  4NX4 C;  5JPA A;  3H47 A;  2PWO A;  5HGM A;  4E91 A;  1M9Y C;  3BP9 A;  4B4N A;  2WLV B;  4XRO A;  1EM9 A;  1AFV A;  4PH2 A;  2WLV A;  2V4X A;  2GOL B;  2KGF A;  2LF4 A;  2JPR A;  5HGN A;  4XRQ A;  2X82 A;  4XFZ A;  1D1D A;  1GWP A;  4QNB A;  1M9C C;  4U0F A;  3H4E A;  2Y4Z A;  2X83 A;  4DGA C;  1P7N A;  2XGY A;  1AK4 C;  4U0E A;  2X2D D;  4U0D A;  1QRJ A; 
#chains in the Genus database with same CATH homology
 3NTE A;  4U0A A;  4HTW A;  5HGO A;  3MGE A;  1G03 A;  4LQW C;  2XGU A;  3P05 A;  2EIA A;  2PXR C;  1M9E C;  1E6J P;  1M9D C;  4PH3 A;  4U0C A;  4WYM A;  2M8L A;  2GON A;  2PWM A;  1U7K A;  4PH0 A;  2M8N A;  1M9F C;  1L6N A;  2XDE A;  4INB A;  4DGE C;  5HGK A;  1M9X C;  4XFX A;  1EIA A;  5HGL A;  4E92 A;  4J93 A;  4XFY A;  2XGV A;  2M8P A;  4U0B A;  4NX4 C;  5JPA A;  3H47 A;  2PWO A;  5HGM A;  4E91 A;  1M9Y C;  3BP9 A;  4B4N A;  2WLV B;  4XRO A;  1EM9 A;  1AFV A;  4PH2 A;  2WLV A;  2V4X A;  2GOL B;  2KGF A;  2LF4 A;  2JPR A;  5HGN A;  4XRQ A;  2X82 A;  4XFZ A;  1D1D A;  1GWP A;  4QNB A;  1M9C C;  4U0F A;  3H4E A;  2Y4Z A;  2X83 A;  4DGA C;  1P7N A;  2XGY A;  1AK4 C;  4U0E A;  2X2D D;  4U0D A;  1QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...