1EM9A

Rous sarcoma virus capsid protein: n-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and self-association of the Rous sarcoma virus capsid protein.
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
total genus 53
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1em9A00
1GWPA 2LF4A 5HGLA 3P05A 4U0AA 1G03A 2XDEA 4U0BA 2M8PA 1EM9A 2X83A 2PWOA 5HGOA 4HTWA 2WLVB 4XFXA 4LQWC 5JPAA 4PH2A 4U0EA 4NX4C 2EIAA 4E91A 1D1DA 1M9EC 1U7KA 1M9YC 1QRJA 4WYMA 4E92A 4PH0A 1AK4C 2GOLB 1M9XC 2M8NA 4XFZA 4INBA 4XROA 5HGNA 2PWMA 2X82A 1P7NA 3H47A 1M9FC 4J93A 4QNBA 2X2DD 3BP9A 1M9CC 2PXRC 2Y4ZA 3NTEA 5HGKA 2XGVA 4U0CA 5HGMA 2M8LA 2WLVA 2XGUA 2XGYA 1EIAA 4U0FA 4U0DA 4B4NA 2GONA 4DGEC 3H4EA 4PH3A 1E6JP 1L6NA 1M9DC 4XRQA 4DGAC 3MGEA 2JPRA 2KGFA 1AFVA 2V4XA 4XFYA
chains in the Genus database with same CATH superfamily
1GWPA 2LF4A 5HGLA 3P05A 4U0AA 1G03A 2XDEA 4U0BA 2M8PA 1EM9A 2X83A 2PWOA 5HGOA 4HTWA 2WLVB 4XFXA 4LQWC 5JPAA 4PH2A 4U0EA 4NX4C 2EIAA 4E91A 1D1DA 1M9EC 1U7KA 1M9YC 1QRJA 4WYMA 4E92A 4PH0A 1AK4C 2GOLB 1M9XC 2M8NA 4XFZA 4INBA 4XROA 5HGNA 2PWMA 2X82A 1P7NA 3H47A 1M9FC 4J93A 4QNBA 2X2DD 3BP9A 1M9CC 2PXRC 2Y4ZA 3NTEA 5HGKA 2XGVA 4U0CA 5HGMA 2M8LA 2WLVA 2XGUA 2XGYA 1EIAA 4U0FA 4U0DA 4B4NA 2GONA 4DGEC 3H4EA 4PH3A 1E6JP 1L6NA 1M9DC 4XRQA 4DGAC 3MGEA 2JPRA 2KGFA 1AFVA 2V4XA 4XFYA
chains in the Genus database with same CATH topology
1GWPA 2LF4A 5HGLA 3P05A 4U0AA 1G03A 2XDEA 4U0BA 2M8PA 1EM9A 2X83A 2PWOA 5HGOA 4HTWA 2WLVB 4XFXA 4LQWC 5JPAA 4PH2A 4U0EA 4NX4C 2EIAA 4E91A 1D1DA 1M9EC 1U7KA 1M9YC 1QRJA 4WYMA 4E92A 4PH0A 1AK4C 2GOLB 1M9XC 2M8NA 4XFZA 4INBA 4XROA 5HGNA 2PWMA 2X82A 1P7NA 3H47A 1M9FC 4J93A 4QNBA 2X2DD 3BP9A 1M9CC 2PXRC 2Y4ZA 3NTEA 5HGKA 2XGVA 4U0CA 5HGMA 2M8LA 2WLVA 2XGUA 2XGYA 1EIAA 4U0FA 4U0DA 4B4NA 2GONA 4DGEC 3H4EA 4PH3A 1E6JP 1L6NA 1M9DC 4XRQA 4DGAC 3MGEA 2JPRA 2KGFA 1AFVA 2V4XA 4XFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWP A;  2LF4 A;  5HGL A;  3P05 A;  4U0A A;  1G03 A;  2XDE A;  4U0B A;  2M8P A;  1EM9 A;  2X83 A;  2PWO A;  5HGO A;  4HTW A;  2WLV B;  4XFX A;  4LQW C;  5JPA A;  4PH2 A;  4U0E A;  4NX4 C;  2EIA A;  4E91 A;  1D1D A;  1M9E C;  1U7K A;  1M9Y C;  1QRJ A;  4WYM A;  4E92 A;  4PH0 A;  1AK4 C;  2GOL B;  1M9X C;  2M8N A;  4XFZ A;  4INB A;  4XRO A;  5HGN A;  2PWM A;  2X82 A;  1P7N A;  3H47 A;  1M9F C;  4J93 A;  4QNB A;  2X2D D;  3BP9 A;  1M9C C;  2PXR C;  2Y4Z A;  3NTE A;  5HGK A;  2XGV A;  4U0C A;  5HGM A;  2M8L A;  2WLV A;  2XGU A;  2XGY A;  1EIA A;  4U0F A;  4U0D A;  4B4N A;  2GON A;  4DGE C;  3H4E A;  4PH3 A;  1E6J P;  1L6N A;  1M9D C;  4XRQ A;  4DGA C;  3MGE A;  2JPR A;  2KGF A;  1AFV A;  2V4X A;  4XFY A; 
#chains in the Genus database with same CATH topology
 1GWP A;  2LF4 A;  5HGL A;  3P05 A;  4U0A A;  1G03 A;  2XDE A;  4U0B A;  2M8P A;  1EM9 A;  2X83 A;  2PWO A;  5HGO A;  4HTW A;  2WLV B;  4XFX A;  4LQW C;  5JPA A;  4PH2 A;  4U0E A;  4NX4 C;  2EIA A;  4E91 A;  1D1D A;  1M9E C;  1U7K A;  1M9Y C;  1QRJ A;  4WYM A;  4E92 A;  4PH0 A;  1AK4 C;  2GOL B;  1M9X C;  2M8N A;  4XFZ A;  4INB A;  4XRO A;  5HGN A;  2PWM A;  2X82 A;  1P7N A;  3H47 A;  1M9F C;  4J93 A;  4QNB A;  2X2D D;  3BP9 A;  1M9C C;  2PXR C;  2Y4Z A;  3NTE A;  5HGK A;  2XGV A;  4U0C A;  5HGM A;  2M8L A;  2WLV A;  2XGU A;  2XGY A;  1EIA A;  4U0F A;  4U0D A;  4B4N A;  2GON A;  4DGE C;  3H4E A;  4PH3 A;  1E6J P;  1L6N A;  1M9D C;  4XRQ A;  4DGA C;  3MGE A;  2JPR A;  2KGF A;  1AFV A;  2V4X A;  4XFY A; 
#chains in the Genus database with same CATH homology
 1GWP A;  2LF4 A;  5HGL A;  3P05 A;  4U0A A;  1G03 A;  2XDE A;  4U0B A;  2M8P A;  1EM9 A;  2X83 A;  2PWO A;  5HGO A;  4HTW A;  2WLV B;  4XFX A;  4LQW C;  5JPA A;  4PH2 A;  4U0E A;  4NX4 C;  2EIA A;  4E91 A;  1D1D A;  1M9E C;  1U7K A;  1M9Y C;  1QRJ A;  4WYM A;  4E92 A;  4PH0 A;  1AK4 C;  2GOL B;  1M9X C;  2M8N A;  4XFZ A;  4INB A;  4XRO A;  5HGN A;  2PWM A;  2X82 A;  1P7N A;  3H47 A;  1M9F C;  4J93 A;  4QNB A;  2X2D D;  3BP9 A;  1M9C C;  2PXR C;  2Y4Z A;  3NTE A;  5HGK A;  2XGV A;  4U0C A;  5HGM A;  2M8L A;  2WLV A;  2XGU A;  2XGY A;  1EIA A;  4U0F A;  4U0D A;  4B4N A;  2GON A;  4DGE C;  3H4E A;  4PH3 A;  1E6J P;  1L6N A;  1M9D C;  4XRQ A;  4DGA C;  3MGE A;  2JPR A;  2KGF A;  1AFV A;  2V4X A;  4XFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...