The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
170
|
structure length |
170
|
Chain Sequence |
VHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A New Crystal Form of the Nk1 Splice Variant of Hgf/Sf Demonstrates Extensive Hinge Movement and Suggests that the Nk1 Dimer Originates by Domain Swapping
pubmed doi rcsb |
| molecule keywords |
HEPATOCYTE GROWTH FACTOR
|
| molecule tags |
Hormone/growth factor
|
| source organism |
Homo sapiens
|
| total genus |
37
|
| structure length |
170
|
| sequence length |
170
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2001-10-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00024 | PAN_1 | PAN domain |
| A | PF00051 | Kringle | Kringle domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Plasminogen Kringle 4 | Plasminogen Kringle 4 | ||
| Alpha Beta | 3-Layer(bba) Sandwich | Hepatocyte Growth Factor | Hepatocyte Growth Factor |
#chains in the Genus database with same CATH superfamily 4R19 A; 1JFN A; 1PKR A; 2J8J A; 5CS9 A; 1GMO A; 4UAO A; 2Q8A A; 4BVC A; 2F83 A; 4R1B A; 5CS3 A; 4HZH A; 2KJ4 A; 2Z8W A; 1CEB A; 2PF2 A; 2HPP P; 1KIV A; 2I9B A; 4CIK A; 4APL A; 2L0S A; 1KRN A; 2YIO A; 5CP9 A; 4Z0D A; 1B2I A; 1I71 A; 2SPT A; 5CT1 A; 2Z8V A; 5EOK A; 4A5T S; 2KNF A; 4Z09 A; 2FD6 A; 4BVD A; 2K51 A; 3U73 A; 2DOH X; 4UV6 A; 5CS5 A; 3SP8 A; 1I5K A; 1W8K A; 1HPJ A; 3ZWZ A; 3LAQ A; 4BVW A; 1HKY A; 1PMK A; 2HGF A; 2HPQ P; 2K13 X; 2PK4 A; 5EOD A; 1HPK A; 2QJ4 A; 3HN4 A; 3MKP A; 2LL3 A; 3KIV A; 1CEA A; 3BT2 A; 1NL2 A; 1KI0 A; 5CT3 A; 4NZQ A; 2J8L A; 2YIP A; 4IUA A; 1YXE A; 1NL1 A; 2Q8B A; 4R1C A; 1PK2 A; 5COE A; 5CSQ A; 2PF1 A; 1URK A; 3NXP A; 3ZLE A; 1Z40 A; 2LL4 M; 1I8N A; 5HPG A; 5CT2 A; 3BT1 A; 1GP9 A; 1W81 A; 2FEB A; 4APM A; 1KDU A; 4BV5 A; 2X2Z A; 4DUR A; 3SRI A; 3SRJ A; 1A0H A; 1GMN A; 2Y8R A; 1PK4 A; 3HMR A; 1NK1 A; 3E6P L; 4Z0F A; 3HMT A; 3HMS A; 4Z0E A; 4BVV A; 2YIL A; 4KIV A; 4O03 A; 4BV7 A; 1PML A; 4R1A A; 2K4R A; 2DOI A; 5I25 A; 5CS1 A; 4D3C A; 1TPK A; 2QJ2 A; 2I9A A; 3K65 A; 1BHT A; #chains in the Genus database with same CATH topology 4R19 A; 4YIV A; 1JFN A; 1PKR A; 2J8J A; 5CS9 A; 1GMO A; 4UAO A; 4YIZ A; 2Q8A A; 4BVC A; 2F83 A; 4R1B A; 5CS3 A; 4HZH A; 2KJ4 A; 2Z8W A; 1CEB A; 2PF2 A; 2HPP P; 1KIV A; 2I9B A; 4CIK A; 4APL A; 2L0S A; 1KRN A; 2YIO A; 5CP9 A; 4Z0D A; 1B2I A; 1I71 A; 2SPT A; 5CT1 A; 2Z8V A; 5EOK A; 4A5T S; 2KNF A; 4Z09 A; 2FD6 A; 4BVD A; 2K51 A; 3U73 A; 2DOH X; 4UV6 A; 5CS5 A; 3SP8 A; 1I5K A; 1W8K A; 1HPJ A; 3ZWZ A; 3LAQ A; 4BVW A; 1HKY A; 1PMK A; 2HGF A; 2HPQ P; 2K13 X; 2PK4 A; 5EOD A; 1HPK A; 2QJ4 A; 3HN4 A; 3MKP A; 2LL3 A; 3KIV A; 1CEA A; 3BT2 A; 1NL2 A; 1KI0 A; 5CT3 A; 4NZQ A; 2J8L A; 2YIP A; 4IUA A; 1YXE A; 1NL1 A; 2Q8B A; 4R1C A; 1PK2 A; 5COE A; 5CSQ A; 2PF1 A; 1URK A; 3NXP A; 3ZLE A; 1Z40 A; 2LL4 M; 1I8N A; 5HPG A; 5CT2 A; 3BT1 A; 1GP9 A; 1W81 A; 2FEB A; 4APM A; 1KDU A; 4BV5 A; 2X2Z A; 4DUR A; 3SRI A; 3SRJ A; 1A0H A; 1GMN A; 2Y8R A; 1PK4 A; 3HMR A; 1NK1 A; 3E6P L; 4Z0F A; 3HMT A; 3HMS A; 4Z0E A; 4BVV A; 2YIL A; 4KIV A; 4O03 A; 4BV7 A; 1PML A; 4R1A A; 2K4R A; 2DOI A; 5I25 A; 5CS1 A; 4D3C A; 1TPK A; 2QJ2 A; 2KL5 A; 2I9A A; 3K65 A; 1BHT A; #chains in the Genus database with same CATH homology 4R19 A; 4YIV A; 1JFN A; 1PKR A; 2J8J A; 5CS9 A; 1GMO A; 4UAO A; 4YIZ A; 2Q8A A; 4BVC A; 2F83 A; 4R1B A; 5CS3 A; 4HZH A; 2KJ4 A; 2Z8W A; 1CEB A; 2PF2 A; 2HPP P; 1KIV A; 2I9B A; 4CIK A; 4APL A; 2L0S A; 1KRN A; 2YIO A; 5CP9 A; 4Z0D A; 1B2I A; 1I71 A; 2SPT A; 5CT1 A; 2Z8V A; 5EOK A; 4A5T S; 2KNF A; 4Z09 A; 2FD6 A; 4BVD A; 2K51 A; 3U73 A; 2DOH X; 4UV6 A; 5CS5 A; 3SP8 A; 1I5K A; 1W8K A; 1HPJ A; 3ZWZ A; 3LAQ A; 4BVW A; 1HKY A; 1PMK A; 2HGF A; 2HPQ P; 2K13 X; 2PK4 A; 5EOD A; 1HPK A; 2QJ4 A; 3HN4 A; 3MKP A; 2LL3 A; 3KIV A; 1CEA A; 3BT2 A; 1NL2 A; 1KI0 A; 5CT3 A; 4NZQ A; 2J8L A; 2YIP A; 4IUA A; 1YXE A; 1NL1 A; 2Q8B A; 4R1C A; 1PK2 A; 5COE A; 5CSQ A; 2PF1 A; 1URK A; 3NXP A; 3ZLE A; 1Z40 A; 2LL4 M; 1I8N A; 5HPG A; 5CT2 A; 3BT1 A; 1GP9 A; 1W81 A; 2FEB A; 4APM A; 1KDU A; 4BV5 A; 2X2Z A; 4DUR A; 3SRI A; 3SRJ A; 1A0H A; 1GMN A; 2Y8R A; 1PK4 A; 3HMR A; 1NK1 A; 3E6P L; 4Z0F A; 3HMT A; 3HMS A; 4Z0E A; 4BVV A; 2YIL A; 4KIV A; 4O03 A; 4BV7 A; 1PML A; 4R1A A; 2K4R A; 2DOI A; 5I25 A; 5CS1 A; 4D3C A; 1TPK A; 2QJ2 A; 2KL5 A; 2I9A A; 3K65 A; 1BHT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...