1L7JA

X-ray structure of galactose mutarotase from lactococcus lactis (apo)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
338
structure length
338
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galactose mutarotase
publication title High resolution X-ray structure of galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 89
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1l7jA00
2BRPA 2ZQ0A 2JKPA 1NS4A 2WDAA 3VDCA 3VDBA 2E24A 3IMHA 3VD7A 1NSUA 1N7OA 1JYNA 1RWCA 2WW2A 2JKEA 1MMZA 1DP0A 1NKGA 5E1QA 3I3BA 1JZ7A 1OJPA 1NSRA 2CISA 3I3EA 1HMUA 4DUVA 1K1YA 3T09A 3VD3A 1Z45A 2WW0A 1CB8A 3VD5A 1LF6A 1RWGA 1UG9A 4RNLA 1HN1A 1JYVA 2BRVX 1NSSA 3NJXA 3OBAA 1MMUA 3CZJA 1MMXA 3VD4A 2WVYA 1X1HA 4BZHA 1LOHA 3J7HA 2E22A 3T2PA 1F4AA 1JZ2A 1HM2A 1OJMA 1ULVA 3I3DA 1JZ6A 3K25A 3OS7A 1MMYA 3T0DA 1K1XA 3MWXA 1RW9A 1JZ3A 1N7QA 3Q1NA 1N7PA 1EGUA 2XSGA 2BRWA 1LXMA 3WFAA 1F4HA 1I8QA 4DUXA 1X1IA 3BGAA 3MV11 1JOVA 1W3YA 2X03A 3MV01 2WVXA 1NS7A 3T08A 3OB8A 1SO0A 3DYOA 1JYXA 1YQ2A 2HTAA 3T0BA 2CIRA 2WW3A 3DECA 3ECQA 1JZ4A 1F9GA 1HM3A 1TXKA 2WVZA 2XHNA 3A24A 1OJNA 1JZ8A 1NS2A 3DCDA 1MN0A 1L7JA 5A1AA 2WZSA 3NREA 3T2QA 1NS8A 1N7RA 1X1JA 1LF9A 1RWAA 3DYMA 2WCOA 3E1F1 1NSZA 2D73A 2WVXB 3IAPA 1PX4A 3SEPA 3VD9A 3MUZ1 2WW1A 1C82A 1L7KA 3MUY1 1K1WA 1NSXA 3DYPA 4BZGA 4TTGA 1SNZA 1F1SA 4BZEA 2Q1FA 4AQ0A 2CIQA 3VDAA 3T2OA 1JYWA 1YGAA 1OJOA 2JKAA 1LURA 1J0NA 3T0AA 1NSVA 4DUWA 1N7NA 1RWHA 1HMWA 2ZXQA 1J0MA 1NSMA 4BZFA 1HN0A 3IAQA 1RWFA 1NS0A 2HTBA 1LXKA 1PX3A 1JZ5A 3NJVA
chains in the Genus database with same CATH superfamily
2BRPA 2ZL8A 2JKPA 1OACA 3VD7A 1N7OA 4MMIA 5E1QA 3AMOB 1JZ7A 4KFEA 1OJPA 1NSRA 2CISA 1K1YA 3VD3A 1R33A 2WW0A 3VD5A 1QX1A 1HN1A 3BVUA 1NSSA 3VD4A 2WVYA 3DDGA 4BZHA 3EJQA 2E22A 1F4AA 1TQSA 2OOVA 1HWWA 1QAFA 3OS7A 1MMYA 3BUIA 1RW9A 4FNUA 3Q1NA 2XN2A 3BVWA 2WYHA 5KBPA 4KTRA 3CZNA 3BGAA 1JOVA 1W3YA 2X03A 1PS3A 3MV01 1W5ZA 1QAKA 1JYXA 2HTAA 2CIRA 3ECQA 3T0UA 1HM3A 3A24A 2CG1A 3DCDA 1MN0A 1L7JA 5A1AA 1SIHA 1QALA 1LF9A 1UI8A 3QDEA 3HIIA 2CQSA 2D73A 2WVXB 3IAPA 4KTPA 1PX4A 1L7KA 1A2VA 4FNTA 3EJRA 1TQVA 4BZEA 2Q1FA 1O7DD 2CIQA 3VDAA 1YGAA 1W2ZA 3WIQA 2CWTA 1NSVA 2E2TA 2WO0A 3BLBA 4EV5A 4KFFA 3D52A 3D50A 3IAQA 1NS0A 2HTBA 3E7JA 3BUQA 3VDBA 3S4CA 2E24A 2CQTA 1JYNA 2WW2A 3AFLA 1DP0A 3D4ZA 2WYIA 3D51A 3S4BA 2E2UA 3I3EA 2OQEC 2FUQA 3HI7A 1UG9A 1IVUA 1D6UA 3OBAA 4FNVA 1MMUA 3CZJA 3D3IA 2FUTA 3ACSA 3BUBA 2YFOA 3DX1A 1D6YA 2OQEA 4KFDA 1OJMA 3ALAA 3I3DA 2Y73A 1AVLA 3X3ZA 3T0DA 1JZ3A 1N7QA 1N7PA 3D4YA 1TQUA 2F7RA 1IVWA 1F4HA 4DUXA 1X1IA 3MV11 2F7OA 2WOHA 2CFGA 3DX2A 3OB8A 1V7VA 1TQTA 3W7XA 2WW3A 1JZ4A 2YFNA 1OJNA 1LVNA 1W6CA 5JMDA 3RSYA 3T2QA 1X1JA 3KIIA 3KN4A 2EACA 3CV5A 3VSMA 1NSZA 2CFLA 3RRSA 2F1AA 2WW1A 1C82A 3BUPA 3NBBA 1F1SA 1TQWA 1W6GA 4BTWA 3T2OA 1JYWA 1OJOA 2JKAA 3DX0A 1J0NA 2EADA 2ZXQA 3DX4A 1NSMA 1HN0A 3SX1A 2EAEA 1RWFA 1LXKA 1PX3A 3EJUA 1JZ5A 3NJVA 2ZQ0A 5JMFA 1NS4A 2WDAA 3WIRA 3IMHA 3S4AA 4K35A 1NKGA 3BVTA 4NEIA 2BT3A 1V7XA 3DX3A 1SPUA 1HMUA 1Z45A 4J5TA 3LVTA 1LF6A 1RWGA 1JYVA 3TY1A 3NBJA 1MMXA 4K3AA 3J7HA 4FNQA 1WMPA 1RKYA 3T2PA 3HIGA 3WVFA 3ACTA 1JZ2A 3X42A 1HM2A 4UFCA 3BVXA 1JZ6A 2W0QA 2WGQA 1HTYA 1K1XA 1IVVA 1EGUA 2BRWA 3WFAA 4BTXA 3S4DA 1EKMA 3BUDA 1US1A 2WVXA 1NS7A 3A0OA 3T08A 2ALWA 1UI7A 1SO0A 3BLCA 3T0BA 3DECA 1F9GA 1QWUA 1NS2A 3BVVA 3W7TA 1NS8A 4FNSA 5CA3A 1N7RA 3DYMA 2C10A 2CWUA 2WCOA 3SEPA 3MUZ1 2F7PA 3MUY1 1K1WA 1NSXA 3DYPA 4BZGA 2CFKA 4AQ0A 1SIIA 2Y74A 1N9EA 4OK4A 2CFWA 1LURA 3N9HA 2OOVC 3EJSA 3T0AA 4BTYA 1WMOA 4DUWA 1HMWA 4FNRA 1J0MA 2RDYA 4OJZA 1IQYA 1R34A 1TU5A 3W7UA 3QFYA 4EV2A 3X40A 1H54A 3E80A 3VDCA 1NSUA 4OK2A 1RWCA 3VSNA 2JKEA 1MMZA 3EJTA 3W7WA 3I3BA 3QG0A 3MI6A 1KSIA 2OW6A 4DUVA 3T09A 1QWNA 3AMOA 3AFJA 1CB8A 1IU7A 2E2VA 3LOYA 4RNLA 2EABA 3X3XA 2BRVX 3NJXA 2YX9A 1X1HA 1LOHA 4FNPA 1HXKA 1DYUA 2C11A 1ULVA 3BS6A 3K25A 3CZSA 1V7WA 3WA3A 3MWXA 2CFDA 2WOFA 1IQXA 3W7SA 2XSGA 1LXMA 1W7CA 1I8QA 1PU4A 2CG0A 3X41A 3SXXA 3K5TA 3DYOA 1YQ2A 3MPHA 3EJPA 1TXKA 2WVZA 3DDFA 2XHNA 1JZ8A 2F18A 2WZSA 3NREA 2F1BA 2F7QA 1RWAA 2PNCA 1JRQA 3E1F1 3QFZA 3VD9A 1D6ZA 1W4NA 1AVKA 4TTGA 1SNZA 2CWVA 1IVXA 2FYVA 3X3YA 5GW7A 4MMHA 2XN1A 3WA2X 1RJOA 1N7NA 1RWHA 2D1WA 1WMNA 2XN0A 4BZFA 3PGBA 2OW7A 1AV4A
chains in the Genus database with same CATH topology
2BRPA 2ZQ0A 5JMFA 2JKPA 3E80A 1NS4A 2WDAA 3VDCA 3VDBA 2E24A 3IMHA 3VD7A 1NSUA 4OK2A 1N7OA 1JYNA 1RWCA 2WW2A 3VSNA 2JKEA 1MMZA 3AFLA 1DP0A 3E7JA 4MMIA 1NKGA 5E1QA 3I3BA 4NEIA 1JZ7A 1OJPA 1NSRA 2CISA 3I3EA 1HMUA 4DUVA 1K1YA 3T09A 2FUQA 1Z45A 3VD3A 2WW0A 1CB8A 4J5TA 3VD5A 1LF6A 1RWGA 1UG9A 4RNLA 1HN1A 1JYVA 2BRVX 3TY1A 1NSSA 3NJXA 3OBAA 4FNVA 1MMUA 3CZJA 1MMXA 3VD4A 2WVYA 1X1HA 2FUTA 4BZHA 1LOHA 3J7HA 2E22A 3T2PA 3WVFA 1F4AA 1JZ2A 1HM2A 1OJMA 1ULVA 3BS6A 3I3DA 1JZ6A 3K25A 3OS7A 1MMYA 3T0DA 1K1XA 3MWXA 1RW9A 1JZ3A 1N7QA 3Q1NA 1N7PA 1EGUA 2XSGA 2BRWA 1LXMA 3WFAA 1F4HA 1I8QA 4DUXA 1X1IA 3BGAA 3MV11 1JOVA 1W3YA 2X03A 3MV01 2WVXA 1NS7A 3A0OA 3T08A 3OB8A 1SO0A 3DYOA 1JYXA 1YQ2A 2HTAA 3BLCA 3T0BA 2CIRA 2WW3A 3DECA 3ECQA 1JZ4A 1F9GA 1HM3A 1TXKA 2WVZA 2XHNA 3A24A 1OJNA 1JZ8A 1NS2A 3DCDA 1MN0A 5JMDA 1L7JA 5A1AA 2WZSA 3NREA 3T2QA 1NS8A 1N7RA 1X1JA 1LF9A 1RWAA 3DYMA 3VSMA 2WCOA 3E1F1 1NSZA 2D73A 2WVXB 3IAPA 1PX4A 3SEPA 3VD9A 3MUZ1 2WW1A 1C82A 1L7KA 3MUY1 1K1WA 1NSXA 3DYPA 4BZGA 4TTGA 1SNZA 1F1SA 4BZEA 2Q1FA 4AQ0A 2CIQA 3VDAA 3T2OA 1JYWA 1YGAA 1OJOA 2JKAA 4MMHA 1LURA 4OK4A 1J0NA 3T0AA 1NSVA 4DUWA 1N7NA 1RWHA 1HMWA 2ZXQA 1J0MA 1NSMA 4BZFA 4OJZA 1HN0A 3IAQA 1RWFA 1NS0A 2HTBA 1LXKA 1PX3A 1JZ5A 3NJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRP A;  2ZQ0 A;  2JKP A;  1NS4 A;  2WDA A;  3VDC A;  3VDB A;  2E24 A;  3IMH A;  3VD7 A;  1NSU A;  1N7O A;  1JYN A;  1RWC A;  2WW2 A;  2JKE A;  1MMZ A;  1DP0 A;  1NKG A;  5E1Q A;  3I3B A;  1JZ7 A;  1OJP A;  1NSR A;  2CIS A;  3I3E A;  1HMU A;  4DUV A;  1K1Y A;  3T09 A;  3VD3 A;  1Z45 A;  2WW0 A;  1CB8 A;  3VD5 A;  1LF6 A;  1RWG A;  1UG9 A;  4RNL A;  1HN1 A;  1JYV A;  2BRV X;  1NSS A;  3NJX A;  3OBA A;  1MMU A;  3CZJ A;  1MMX A;  3VD4 A;  2WVY A;  1X1H A;  4BZH A;  1LOH A;  3J7H A;  2E22 A;  3T2P A;  1F4A A;  1JZ2 A;  1HM2 A;  1OJM A;  1ULV A;  3I3D A;  1JZ6 A;  3K25 A;  3OS7 A;  1MMY A;  3T0D A;  1K1X A;  3MWX A;  1RW9 A;  1JZ3 A;  1N7Q A;  3Q1N A;  1N7P A;  1EGU A;  2XSG A;  2BRW A;  1LXM A;  3WFA A;  1F4H A;  1I8Q A;  4DUX A;  1X1I A;  3BGA A;  3MV1 1;  1JOV A;  1W3Y A;  2X03 A;  3MV0 1;  2WVX A;  1NS7 A;  3T08 A;  3OB8 A;  1SO0 A;  3DYO A;  1JYX A;  1YQ2 A;  2HTA A;  3T0B A;  2CIR A;  2WW3 A;  3DEC A;  3ECQ A;  1JZ4 A;  1F9G A;  1HM3 A;  1TXK A;  2WVZ A;  2XHN A;  3A24 A;  1OJN A;  1JZ8 A;  1NS2 A;  3DCD A;  1MN0 A;  1L7J A;  5A1A A;  2WZS A;  3NRE A;  3T2Q A;  1NS8 A;  1N7R A;  1X1J A;  1LF9 A;  1RWA A;  3DYM A;  2WCO A;  3E1F 1;  1NSZ A;  2D73 A;  2WVX B;  3IAP A;  1PX4 A;  3SEP A;  3VD9 A;  3MUZ 1;  2WW1 A;  1C82 A;  1L7K A;  3MUY 1;  1K1W A;  1NSX A;  3DYP A;  4BZG A;  4TTG A;  1SNZ A;  1F1S A;  4BZE A;  2Q1F A;  4AQ0 A;  2CIQ A;  3VDA A;  3T2O A;  1JYW A;  1YGA A;  1OJO A;  2JKA A;  1LUR A;  1J0N A;  3T0A A;  1NSV A;  4DUW A;  1N7N A;  1RWH A;  1HMW A;  2ZXQ A;  1J0M A;  1NSM A;  4BZF A;  1HN0 A;  3IAQ A;  1RWF A;  1NS0 A;  2HTB A;  1LXK A;  1PX3 A;  1JZ5 A;  3NJV A; 
#chains in the Genus database with same CATH topology
 2BRP A;  2ZL8 A;  2JKP A;  1OAC A;  3VD7 A;  1N7O A;  4MMI A;  5E1Q A;  3AMO B;  1JZ7 A;  4KFE A;  1OJP A;  1NSR A;  2CIS A;  1K1Y A;  3VD3 A;  1R33 A;  2WW0 A;  3VD5 A;  1QX1 A;  1HN1 A;  3BVU A;  1NSS A;  3VD4 A;  2WVY A;  3DDG A;  4BZH A;  3EJQ A;  2E22 A;  1F4A A;  1TQS A;  2OOV A;  1HWW A;  1QAF A;  3OS7 A;  1MMY A;  3BUI A;  1RW9 A;  4FNU A;  3Q1N A;  2XN2 A;  3BVW A;  2WYH A;  5KBP A;  4KTR A;  3CZN A;  3BGA A;  1JOV A;  1W3Y A;  2X03 A;  1PS3 A;  3MV0 1;  1W5Z A;  1QAK A;  1JYX A;  2HTA A;  2CIR A;  3ECQ A;  3T0U A;  1HM3 A;  3A24 A;  2CG1 A;  3DCD A;  1MN0 A;  1L7J A;  5A1A A;  1SIH A;  1QAL A;  1LF9 A;  1UI8 A;  3QDE A;  3HII A;  2CQS A;  2D73 A;  2WVX B;  3IAP A;  4KTP A;  1PX4 A;  1L7K A;  1A2V A;  4FNT A;  3EJR A;  1TQV A;  4BZE A;  2Q1F A;  1O7D D;  2CIQ A;  3VDA A;  1YGA A;  1W2Z A;  3WIQ A;  2CWT A;  1NSV A;  2E2T A;  2WO0 A;  3BLB A;  4EV5 A;  4KFF A;  3D52 A;  3D50 A;  3IAQ A;  1NS0 A;  2HTB A;  3E7J A;  3BUQ A;  3VDB A;  3S4C A;  2E24 A;  2CQT A;  1JYN A;  2WW2 A;  3AFL A;  1DP0 A;  3D4Z A;  2WYI A;  3D51 A;  3S4B A;  2E2U A;  3I3E A;  2OQE C;  2FUQ A;  3HI7 A;  1UG9 A;  1IVU A;  1D6U A;  3OBA A;  4FNV A;  1MMU A;  3CZJ A;  3D3I A;  2FUT A;  3ACS A;  3BUB A;  2YFO A;  3DX1 A;  1D6Y A;  2OQE A;  4KFD A;  1OJM A;  3ALA A;  3I3D A;  2Y73 A;  1AVL A;  3X3Z A;  3T0D A;  1JZ3 A;  1N7Q A;  1N7P A;  3D4Y A;  1TQU A;  2F7R A;  1IVW A;  1F4H A;  4DUX A;  1X1I A;  3MV1 1;  2F7O A;  2WOH A;  2CFG A;  3DX2 A;  3OB8 A;  1V7V A;  1TQT A;  3W7X A;  2WW3 A;  1JZ4 A;  2YFN A;  1OJN A;  1LVN A;  1W6C A;  5JMD A;  3RSY A;  3T2Q A;  1X1J A;  3KII A;  3KN4 A;  2EAC A;  3CV5 A;  3VSM A;  1NSZ A;  2CFL A;  3RRS A;  2F1A A;  2WW1 A;  1C82 A;  3BUP A;  3NBB A;  1F1S A;  1TQW A;  1W6G A;  4BTW A;  3T2O A;  1JYW A;  1OJO A;  2JKA A;  3DX0 A;  1J0N A;  2EAD A;  2ZXQ A;  3DX4 A;  1NSM A;  1HN0 A;  3SX1 A;  2EAE A;  1RWF A;  1LXK A;  1PX3 A;  3EJU A;  1JZ5 A;  3NJV A;  2ZQ0 A;  5JMF A;  1NS4 A;  2WDA A;  3WIR A;  3IMH A;  3S4A A;  4K35 A;  1NKG A;  3BVT A;  4NEI A;  2BT3 A;  1V7X A;  3DX3 A;  1SPU A;  1HMU A;  1Z45 A;  4J5T A;  3LVT A;  1LF6 A;  1RWG A;  1JYV A;  3TY1 A;  3NBJ A;  1MMX A;  4K3A A;  3J7H A;  4FNQ A;  1WMP A;  1RKY A;  3T2P A;  3HIG A;  3WVF A;  3ACT A;  1JZ2 A;  3X42 A;  1HM2 A;  4UFC A;  3BVX A;  1JZ6 A;  2W0Q A;  2WGQ A;  1HTY A;  1K1X A;  1IVV A;  1EGU A;  2BRW A;  3WFA A;  4BTX A;  3S4D A;  1EKM A;  3BUD A;  1US1 A;  2WVX A;  1NS7 A;  3A0O A;  3T08 A;  2ALW A;  1UI7 A;  1SO0 A;  3BLC A;  3T0B A;  3DEC A;  1F9G A;  1QWU A;  1NS2 A;  3BVV A;  3W7T A;  1NS8 A;  4FNS A;  5CA3 A;  1N7R A;  3DYM A;  2C10 A;  2CWU A;  2WCO A;  3SEP A;  3MUZ 1;  2F7P A;  3MUY 1;  1K1W A;  1NSX A;  3DYP A;  4BZG A;  2CFK A;  4AQ0 A;  1SII A;  2Y74 A;  1N9E A;  4OK4 A;  2CFW A;  1LUR A;  3N9H A;  2OOV C;  3EJS A;  3T0A A;  4BTY A;  1WMO A;  4DUW A;  1HMW A;  4FNR A;  1J0M A;  2RDY A;  4OJZ A;  1IQY A;  1R34 A;  1TU5 A;  3W7U A;  3QFY A;  4EV2 A;  3X40 A;  1H54 A;  3E80 A;  3VDC A;  1NSU A;  4OK2 A;  1RWC A;  3VSN A;  2JKE A;  1MMZ A;  3EJT A;  3W7W A;  3I3B A;  3QG0 A;  3MI6 A;  1KSI A;  2OW6 A;  4DUV A;  3T09 A;  1QWN A;  3AMO A;  3AFJ A;  1CB8 A;  1IU7 A;  2E2V A;  3LOY A;  4RNL A;  2EAB A;  3X3X A;  2BRV X;  3NJX A;  2YX9 A;  1X1H A;  1LOH A;  4FNP A;  1HXK A;  1DYU A;  2C11 A;  1ULV A;  3BS6 A;  3K25 A;  3CZS A;  1V7W A;  3WA3 A;  3MWX A;  2CFD A;  2WOF A;  1IQX A;  3W7S A;  2XSG A;  1LXM A;  1W7C A;  1I8Q A;  1PU4 A;  2CG0 A;  3X41 A;  3SXX A;  3K5T A;  3DYO A;  1YQ2 A;  3MPH A;  3EJP A;  1TXK A;  2WVZ A;  3DDF A;  2XHN A;  1JZ8 A;  2F18 A;  2WZS A;  3NRE A;  2F1B A;  2F7Q A;  1RWA A;  2PNC A;  1JRQ A;  3E1F 1;  3QFZ A;  3VD9 A;  1D6Z A;  1W4N A;  1AVK A;  4TTG A;  1SNZ A;  2CWV A;  1IVX A;  2FYV A;  3X3Y A;  5GW7 A;  4MMH A;  2XN1 A;  3WA2 X;  1RJO A;  1N7N A;  1RWH A;  2D1W A;  1WMN A;  2XN0 A;  4BZF A;  3PGB A;  2OW7 A;  1AV4 A; 
#chains in the Genus database with same CATH homology
 2BRP A;  2ZQ0 A;  5JMF A;  2JKP A;  3E80 A;  1NS4 A;  2WDA A;  3VDC A;  3VDB A;  2E24 A;  3IMH A;  3VD7 A;  1NSU A;  4OK2 A;  1N7O A;  1JYN A;  1RWC A;  2WW2 A;  3VSN A;  2JKE A;  1MMZ A;  3AFL A;  1DP0 A;  3E7J A;  4MMI A;  1NKG A;  5E1Q A;  3I3B A;  4NEI A;  1JZ7 A;  1OJP A;  1NSR A;  2CIS A;  3I3E A;  1HMU A;  4DUV A;  1K1Y A;  3T09 A;  2FUQ A;  1Z45 A;  3VD3 A;  2WW0 A;  1CB8 A;  4J5T A;  3VD5 A;  1LF6 A;  1RWG A;  1UG9 A;  4RNL A;  1HN1 A;  1JYV A;  2BRV X;  3TY1 A;  1NSS A;  3NJX A;  3OBA A;  4FNV A;  1MMU A;  3CZJ A;  1MMX A;  3VD4 A;  2WVY A;  1X1H A;  2FUT A;  4BZH A;  1LOH A;  3J7H A;  2E22 A;  3T2P A;  3WVF A;  1F4A A;  1JZ2 A;  1HM2 A;  1OJM A;  1ULV A;  3BS6 A;  3I3D A;  1JZ6 A;  3K25 A;  3OS7 A;  1MMY A;  3T0D A;  1K1X A;  3MWX A;  1RW9 A;  1JZ3 A;  1N7Q A;  3Q1N A;  1N7P A;  1EGU A;  2XSG A;  2BRW A;  1LXM A;  3WFA A;  1F4H A;  1I8Q A;  4DUX A;  1X1I A;  3BGA A;  3MV1 1;  1JOV A;  1W3Y A;  2X03 A;  3MV0 1;  2WVX A;  1NS7 A;  3A0O A;  3T08 A;  3OB8 A;  1SO0 A;  3DYO A;  1JYX A;  1YQ2 A;  2HTA A;  3BLC A;  3T0B A;  2CIR A;  2WW3 A;  3DEC A;  3ECQ A;  1JZ4 A;  1F9G A;  1HM3 A;  1TXK A;  2WVZ A;  2XHN A;  3A24 A;  1OJN A;  1JZ8 A;  1NS2 A;  3DCD A;  1MN0 A;  5JMD A;  1L7J A;  5A1A A;  2WZS A;  3NRE A;  3T2Q A;  1NS8 A;  1N7R A;  1X1J A;  1LF9 A;  1RWA A;  3DYM A;  3VSM A;  2WCO A;  3E1F 1;  1NSZ A;  2D73 A;  2WVX B;  3IAP A;  1PX4 A;  3SEP A;  3VD9 A;  3MUZ 1;  2WW1 A;  1C82 A;  1L7K A;  3MUY 1;  1K1W A;  1NSX A;  3DYP A;  4BZG A;  4TTG A;  1SNZ A;  1F1S A;  4BZE A;  2Q1F A;  4AQ0 A;  2CIQ A;  3VDA A;  3T2O A;  1JYW A;  1YGA A;  1OJO A;  2JKA A;  4MMH A;  1LUR A;  4OK4 A;  1J0N A;  3T0A A;  1NSV A;  4DUW A;  1N7N A;  1RWH A;  1HMW A;  2ZXQ A;  1J0M A;  1NSM A;  4BZF A;  4OJZ A;  1HN0 A;  3IAQ A;  1RWF A;  1NS0 A;  2HTB A;  1LXK A;  1PX3 A;  1JZ5 A;  3NJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...