1L7JA

X-ray structure of galactose mutarotase from lactococcus lactis (apo)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
338
structure length
338
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords galactose mutarotase
publication title High resolution X-ray structure of galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 89
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1l7jA00
1N7OA 1NS4A 1OJMA 1K1YA 5A1AA 3E1F1 3DCDA 1NS7A 3T0DA 3WFAA 3OB8A 1YQ2A 1PX3A 1W3YA 1HN1A 2CISA 1NSMA 2ZXQA 3MV11 3VDBA 2WW3A 1J0MA 1RWAA 2D73A 3OBAA 3IAPA 1JZ7A 3T2OA 1F4AA 2XHNA 1LURA 2ZQ0A 1JOVA 1OJOA 4DUXA 1L7JA 3VDAA 2E24A 1RWGA 3IMHA 2BRWA 1NKGA 3I3EA 3ECQA 3NJVA 4BZGA 1NSZA 3DYMA 3VD7A 1I8QA 1LF6A 2BRVX 1ULVA 2X03A 4BZHA 2WZSA 1HM2A 1RW9A 4AQ0A 1YGAA 3NJXA 1N7QA 3VD5A 4BZEA 1LOHA 2HTBA 1X1HA 3K25A 1NSUA 3NREA 1HMWA 4DUWA 1NSVA 2WVYA 3SEPA 1CB8A 1L7KA 3MWXA 3MUZ1 1HN0A 1RWHA 2E22A 2WVXA 2JKAA 1Z45A 1NS8A 4DUVA 4RNLA 3Q1NA 1PX4A 2WCOA 3VD9A 3T2QA 3VD4A 2JKPA 4BZFA 1J0NA 1JZ8A 1N7RA 1C82A 1N7PA 1JYNA 1LXKA 1JYVA 1LXMA 3DECA 3MUY1 1NS0A 3I3BA 1JZ5A 3OS7A 1K1XA 1LF9A 1X1IA 2Q1FA 2BRPA 1UG9A 3CZJA 1JZ6A 2CIRA 2CIQA 4TTGA 5E1QA 2WW1A 2JKEA 1OJPA 1N7NA 3T08A 1NSXA 3BGAA 3DYPA 1MMXA 2HTAA 1JZ3A 1F1SA 1HM3A 1MMUA 2XSGA 3VD3A 3VDCA 1K1WA 1NSSA 1DP0A 3T09A 1SO0A 1JYXA 1JZ2A 1RWFA 1SNZA 3I3DA 1TXKA 2WVXB 3A24A 3T0BA 1RWCA 3MV01 3T0AA 1JYWA 1EGUA 1MMZA 1OJNA 2WVZA 1HMUA 2WW2A 1F9GA 1MN0A 3IAQA 1NSRA 3T2PA 2WDAA 1NS2A 1F4HA 3DYOA 3J7HA 1MMYA 1JZ4A 1X1JA 2WW0A
chains in the Genus database with same CATH superfamily
5A1AA 3ACSA 3DX3A 1V7VA 3T0DA 3TY1A 3OB8A 3WA2X 1YQ2A 3MI6A 2WOFA 2CISA 1KSIA 1RKYA 1SIIA 3NBBA 3X41A 1F4AA 2FUQA 3BUBA 1HWWA 3AFLA 3EJSA 1AVKA 3EJQA 4KTRA 1LVNA 1RW9A 3NJXA 1N7QA 1TQSA 1X1HA 2F1BA 1W2ZA 2WVYA 3EJPA 1CB8A 3MWXA 2E22A 4MMIA 4EV2A 3T0UA 4RNLA 3Q1NA 3T2QA 3VD4A 1JZ8A 1N7RA 2E2VA 1JYNA 1LXMA 1TU5A 3DECA 1JZ6A 3CZJA 4TTGA 4OJZA 1IVWA 2WYHA 5E1QA 3SXXA 2HTAA 1JZ3A 1MMUA 1W7CA 1K1WA 4KFEA 3QFZA 3T09A 1SO0A 2CWVA 1JYXA 2WYIA 2CFGA 3T0BA 1A2VA 2WVZA 1JRQA 3KIIA 1PS3A 3BUDA 2WDAA 1F4HA 3ALAA 2CQSA 1JZ4A 1X1JA 2Y74A 5JMFA 2WW0A 1UI8A 3W7TA 4MMHA 1TQWA 3S4DA 3DX0A 1K1YA 3A0OA 2CQTA 2C11A 3E80A 3BVWA 2YFOA 1HN1A 1NSMA 2XN0A 3VDBA 3CZSA 2D73A 4BTYA 1JOVA 1OJOA 4DUXA 1L7JA 2BRWA 2F7QA 3AFJA 4BZGA 1LF6A 3W7SA 3KN4A 1ULVA 2X03A 2WZSA 1QWUA 2EABA 4BZEA 3K25A 1NSUA 4FNQA 2OQEC 1W6CA 4EV5A 4J5TA 3BVVA 1HN0A 2FUTA 3DDFA 2JKAA 3SX1A 3X3YA 1R34A 1HTYA 1NS8A 3DX2A 2CWTA 1PX4A 2JKPA 1J0NA 4FNTA 3WIQA 3MUY1 1NS0A 2YX9A 2ZL8A 1V7XA 1LF9A 2WOHA 2BRPA 1UG9A 2CIRA 1R33A 2RDYA 1WMPA 1OJPA 1N7NA 3BUIA 4FNSA 1MMXA 1W4NA 1WMNA 1US1A 3N9HA 3MPHA 3VD3A 3VDCA 3BLBA 1TQTA 1PU4A 2CG0A 4OK2A 1TXKA 2WVXB 3D52A 1UI7A 1W5ZA 3MV01 3CZNA 3WA3A 1MMZA 1OJNA 3BUPA 1F9GA 3IAQA 5CA3A 3T2PA 1NS2A 3DYOA 1MMYA 1V7WA 1TQUA 3LOYA 4KTPA 1N7OA 1NS4A 3WVFA 2D1WA 3E1F1 3DCDA 1NS7A 2CFDA 1N9EA 1W3YA 3PGBA 3EJRA 3X3XA 3QG0A 2WW3A 3OBAA 1JZ7A 3T2OA 1LURA 3VDAA 1RWGA 3IMHA 4FNPA 3ECQA 3NJVA 1NSZA 3VD7A 1O7DD 1I8QA 2PNCA 3AMOB 4BTXA 4AQ0A 1IQYA 1H54A 2WO0A 1YGAA 2F18A 4FNUA 1AV4A 4FNRA 1EKMA 1HMWA 2OOVC 3W7UA 3MUZ1 2CFWA 1RWHA 1IU7A 1IVUA 2WVXA 1QALA 2WCOA 4UFCA 3DDGA 4BZFA 1LXKA 1JYVA 3HI7A 2OOVA 3I3BA 2Y73A 1K1XA 1X1IA 5KBPA 4K35A 3X40A 1RJOA 2ALWA 4BTWA 3T08A 1NSXA 3DYPA 2F7PA 3RSYA 2XSGA 3S4CA 1HXKA 3S4BA 2E2UA 1QWNA 1NSSA 1DP0A 1JZ2A 1QX1A 3QFYA 1IVVA 2OQEA 4KFFA 1RWCA 2WW2A 4NEIA 3D4YA 3VSMA 1NSRA 3AMOA 2E2TA 2F7RA 3BUQA 4FNVA 2CG1A 3EJTA 1OJMA 1WMOA 3WFAA 3BVUA 1IQXA 1PX3A 4KFDA 3MV11 2ZXQA 3EJUA 2FYVA 2EAEA 1J0MA 1SPUA 1RWAA 3IAPA 2BT3A 2EADA 2XHNA 2ZQ0A 2F1AA 2E24A 1QAKA 3VSNA 3DX1A 3DX4A 3NBJA 1NKGA 2XN1A 3I3EA 2F7OA 3DYMA 1TQVA 2WGQA 2W0QA 1OACA 2BRVX 3WIRA 1D6ZA 4BZHA 1HM2A 2XN2A 3QDEA 3VD5A 3D51A 1LOHA 2HTBA 3HIIA 2C10A 3NREA 1D6YA 3E7JA 4K3AA 4DUWA 1NSVA 3SEPA 1L7KA 3X3ZA 4OK4A 2CFKA 3BS6A 1Z45A 2CWUA 4DUVA 3VD9A 1IVXA 1N7PA 1C82A 5JMDA 3CV5A 1JZ5A 1QAFA 3OS7A 2Q1FA 2YFNA 3ACTA 2CIQA 3D3IA 3W7WA 1AVLA 2OW6A 5GW7A 2WW1A 1DYUA 2JKEA 3X42A 2EACA 3BVXA 3D4ZA 3BGAA 3W7XA 1F1SA 1HM3A 3BVTA 3HIGA 1SIHA 3D50A 3LVTA 2CFLA 1W6GA 1RWFA 1SNZA 3I3DA 3A24A 1JYWA 3T0AA 1EGUA 3K5TA 1HMUA 1D6UA 2OW7A 1MN0A 3J7HA 3BLCA 3RRSA 3S4AA
chains in the Genus database with same CATH topology
1N7OA 1NS4A 1OJMA 3WVFA 1K1YA 5A1AA 3A0OA 3E1F1 3DCDA 1NS7A 3E80A 3T0DA 3WFAA 3TY1A 3OB8A 1YQ2A 1PX3A 1W3YA 1HN1A 2CISA 1NSMA 2ZXQA 3MV11 3VDBA 2WW3A 1J0MA 1RWAA 2D73A 3OBAA 3IAPA 1JZ7A 3T2OA 1F4AA 2XHNA 1LURA 2ZQ0A 1JOVA 1OJOA 4DUXA 2FUQA 1L7JA 3VDAA 2E24A 1RWGA 3IMHA 2BRWA 3VSNA 1NKGA 3I3EA 3ECQA 3NJVA 4BZGA 1NSZA 3AFLA 3DYMA 3VD7A 1I8QA 1LF6A 2BRVX 1ULVA 2X03A 4BZHA 2WZSA 1HM2A 1RW9A 4AQ0A 1YGAA 3NJXA 1N7QA 3VD5A 4BZEA 1LOHA 2HTBA 1X1HA 3K25A 1NSUA 3NREA 1HMWA 3E7JA 4DUWA 4J5TA 1NSVA 2WVYA 3SEPA 1CB8A 1L7KA 3MWXA 3MUZ1 1HN0A 1RWHA 2E22A 2FUTA 2JKAA 2WVXA 4MMIA 3BS6A 4OK4A 1Z45A 1NS8A 4DUVA 4RNLA 3Q1NA 1PX4A 2WCOA 3VD9A 3T2QA 3VD4A 2JKPA 4BZFA 1J0NA 1JZ8A 1N7RA 1C82A 1N7PA 1JYNA 5JMDA 1LXKA 1JYVA 1LXMA 3DECA 3MUY1 1NS0A 3I3BA 1JZ5A 3OS7A 1K1XA 1LF9A 1X1IA 2Q1FA 2BRPA 1UG9A 3CZJA 1JZ6A 2CIRA 2CIQA 4TTGA 4OJZA 5E1QA 2WW1A 2JKEA 1OJPA 1N7NA 3T08A 1NSXA 3BGAA 3DYPA 1MMXA 2HTAA 1JZ3A 1F1SA 1HM3A 1MMUA 2XSGA 3VD3A 3VDCA 1K1WA 1NSSA 1DP0A 3T09A 1SO0A 1JYXA 1JZ2A 4OK2A 1RWFA 1SNZA 3I3DA 1TXKA 2WVXB 3A24A 3T0BA 1RWCA 3MV01 3T0AA 1JYWA 1EGUA 1MMZA 1OJNA 2WVZA 1HMUA 2WW2A 1F9GA 1MN0A 3IAQA 4NEIA 1NSRA 3VSMA 3T2PA 2WDAA 1NS2A 1F4HA 3DYOA 3J7HA 1MMYA 1JZ4A 1X1JA 3BLCA 5JMFA 2WW0A 4FNVA 4MMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7O A;  1NS4 A;  1OJM A;  1K1Y A;  5A1A A;  3E1F 1;  3DCD A;  1NS7 A;  3T0D A;  3WFA A;  3OB8 A;  1YQ2 A;  1PX3 A;  1W3Y A;  1HN1 A;  2CIS A;  1NSM A;  2ZXQ A;  3MV1 1;  3VDB A;  2WW3 A;  1J0M A;  1RWA A;  2D73 A;  3OBA A;  3IAP A;  1JZ7 A;  3T2O A;  1F4A A;  2XHN A;  1LUR A;  2ZQ0 A;  1JOV A;  1OJO A;  4DUX A;  1L7J A;  3VDA A;  2E24 A;  1RWG A;  3IMH A;  2BRW A;  1NKG A;  3I3E A;  3ECQ A;  3NJV A;  4BZG A;  1NSZ A;  3DYM A;  3VD7 A;  1I8Q A;  1LF6 A;  2BRV X;  1ULV A;  2X03 A;  4BZH A;  2WZS A;  1HM2 A;  1RW9 A;  4AQ0 A;  1YGA A;  3NJX A;  1N7Q A;  3VD5 A;  4BZE A;  1LOH A;  2HTB A;  1X1H A;  3K25 A;  1NSU A;  3NRE A;  1HMW A;  4DUW A;  1NSV A;  2WVY A;  3SEP A;  1CB8 A;  1L7K A;  3MWX A;  3MUZ 1;  1HN0 A;  1RWH A;  2E22 A;  2WVX A;  2JKA A;  1Z45 A;  1NS8 A;  4DUV A;  4RNL A;  3Q1N A;  1PX4 A;  2WCO A;  3VD9 A;  3T2Q A;  3VD4 A;  2JKP A;  4BZF A;  1J0N A;  1JZ8 A;  1N7R A;  1C82 A;  1N7P A;  1JYN A;  1LXK A;  1JYV A;  1LXM A;  3DEC A;  3MUY 1;  1NS0 A;  3I3B A;  1JZ5 A;  3OS7 A;  1K1X A;  1LF9 A;  1X1I A;  2Q1F A;  2BRP A;  1UG9 A;  3CZJ A;  1JZ6 A;  2CIR A;  2CIQ A;  4TTG A;  5E1Q A;  2WW1 A;  2JKE A;  1OJP A;  1N7N A;  3T08 A;  1NSX A;  3BGA A;  3DYP A;  1MMX A;  2HTA A;  1JZ3 A;  1F1S A;  1HM3 A;  1MMU A;  2XSG A;  3VD3 A;  3VDC A;  1K1W A;  1NSS A;  1DP0 A;  3T09 A;  1SO0 A;  1JYX A;  1JZ2 A;  1RWF A;  1SNZ A;  3I3D A;  1TXK A;  2WVX B;  3A24 A;  3T0B A;  1RWC A;  3MV0 1;  3T0A A;  1JYW A;  1EGU A;  1MMZ A;  1OJN A;  2WVZ A;  1HMU A;  2WW2 A;  1F9G A;  1MN0 A;  3IAQ A;  1NSR A;  3T2P A;  2WDA A;  1NS2 A;  1F4H A;  3DYO A;  3J7H A;  1MMY A;  1JZ4 A;  1X1J A;  2WW0 A; 
#chains in the Genus database with same CATH topology
 5A1A A;  3ACS A;  3DX3 A;  1V7V A;  3T0D A;  3TY1 A;  3OB8 A;  3WA2 X;  1YQ2 A;  3MI6 A;  2WOF A;  2CIS A;  1KSI A;  1RKY A;  1SII A;  3NBB A;  3X41 A;  1F4A A;  2FUQ A;  3BUB A;  1HWW A;  3AFL A;  3EJS A;  1AVK A;  3EJQ A;  4KTR A;  1LVN A;  1RW9 A;  3NJX A;  1N7Q A;  1TQS A;  1X1H A;  2F1B A;  1W2Z A;  2WVY A;  3EJP A;  1CB8 A;  3MWX A;  2E22 A;  4MMI A;  4EV2 A;  3T0U A;  4RNL A;  3Q1N A;  3T2Q A;  3VD4 A;  1JZ8 A;  1N7R A;  2E2V A;  1JYN A;  1LXM A;  1TU5 A;  3DEC A;  1JZ6 A;  3CZJ A;  4TTG A;  4OJZ A;  1IVW A;  2WYH A;  5E1Q A;  3SXX A;  2HTA A;  1JZ3 A;  1MMU A;  1W7C A;  1K1W A;  4KFE A;  3QFZ A;  3T09 A;  1SO0 A;  2CWV A;  1JYX A;  2WYI A;  2CFG A;  3T0B A;  1A2V A;  2WVZ A;  1JRQ A;  3KII A;  1PS3 A;  3BUD A;  2WDA A;  1F4H A;  3ALA A;  2CQS A;  1JZ4 A;  1X1J A;  2Y74 A;  5JMF A;  2WW0 A;  1UI8 A;  3W7T A;  4MMH A;  1TQW A;  3S4D A;  3DX0 A;  1K1Y A;  3A0O A;  2CQT A;  2C11 A;  3E80 A;  3BVW A;  2YFO A;  1HN1 A;  1NSM A;  2XN0 A;  3VDB A;  3CZS A;  2D73 A;  4BTY A;  1JOV A;  1OJO A;  4DUX A;  1L7J A;  2BRW A;  2F7Q A;  3AFJ A;  4BZG A;  1LF6 A;  3W7S A;  3KN4 A;  1ULV A;  2X03 A;  2WZS A;  1QWU A;  2EAB A;  4BZE A;  3K25 A;  1NSU A;  4FNQ A;  2OQE C;  1W6C A;  4EV5 A;  4J5T A;  3BVV A;  1HN0 A;  2FUT A;  3DDF A;  2JKA A;  3SX1 A;  3X3Y A;  1R34 A;  1HTY A;  1NS8 A;  3DX2 A;  2CWT A;  1PX4 A;  2JKP A;  1J0N A;  4FNT A;  3WIQ A;  3MUY 1;  1NS0 A;  2YX9 A;  2ZL8 A;  1V7X A;  1LF9 A;  2WOH A;  2BRP A;  1UG9 A;  2CIR A;  1R33 A;  2RDY A;  1WMP A;  1OJP A;  1N7N A;  3BUI A;  4FNS A;  1MMX A;  1W4N A;  1WMN A;  1US1 A;  3N9H A;  3MPH A;  3VD3 A;  3VDC A;  3BLB A;  1TQT A;  1PU4 A;  2CG0 A;  4OK2 A;  1TXK A;  2WVX B;  3D52 A;  1UI7 A;  1W5Z A;  3MV0 1;  3CZN A;  3WA3 A;  1MMZ A;  1OJN A;  3BUP A;  1F9G A;  3IAQ A;  5CA3 A;  3T2P A;  1NS2 A;  3DYO A;  1MMY A;  1V7W A;  1TQU A;  3LOY A;  4KTP A;  1N7O A;  1NS4 A;  3WVF A;  2D1W A;  3E1F 1;  3DCD A;  1NS7 A;  2CFD A;  1N9E A;  1W3Y A;  3PGB A;  3EJR A;  3X3X A;  3QG0 A;  2WW3 A;  3OBA A;  1JZ7 A;  3T2O A;  1LUR A;  3VDA A;  1RWG A;  3IMH A;  4FNP A;  3ECQ A;  3NJV A;  1NSZ A;  3VD7 A;  1O7D D;  1I8Q A;  2PNC A;  3AMO B;  4BTX A;  4AQ0 A;  1IQY A;  1H54 A;  2WO0 A;  1YGA A;  2F18 A;  4FNU A;  1AV4 A;  4FNR A;  1EKM A;  1HMW A;  2OOV C;  3W7U A;  3MUZ 1;  2CFW A;  1RWH A;  1IU7 A;  1IVU A;  2WVX A;  1QAL A;  2WCO A;  4UFC A;  3DDG A;  4BZF A;  1LXK A;  1JYV A;  3HI7 A;  2OOV A;  3I3B A;  2Y73 A;  1K1X A;  1X1I A;  5KBP A;  4K35 A;  3X40 A;  1RJO A;  2ALW A;  4BTW A;  3T08 A;  1NSX A;  3DYP A;  2F7P A;  3RSY A;  2XSG A;  3S4C A;  1HXK A;  3S4B A;  2E2U A;  1QWN A;  1NSS A;  1DP0 A;  1JZ2 A;  1QX1 A;  3QFY A;  1IVV A;  2OQE A;  4KFF A;  1RWC A;  2WW2 A;  4NEI A;  3D4Y A;  3VSM A;  1NSR A;  3AMO A;  2E2T A;  2F7R A;  3BUQ A;  4FNV A;  2CG1 A;  3EJT A;  1OJM A;  1WMO A;  3WFA A;  3BVU A;  1IQX A;  1PX3 A;  4KFD A;  3MV1 1;  2ZXQ A;  3EJU A;  2FYV A;  2EAE A;  1J0M A;  1SPU A;  1RWA A;  3IAP A;  2BT3 A;  2EAD A;  2XHN A;  2ZQ0 A;  2F1A A;  2E24 A;  1QAK A;  3VSN A;  3DX1 A;  3DX4 A;  3NBJ A;  1NKG A;  2XN1 A;  3I3E A;  2F7O A;  3DYM A;  1TQV A;  2WGQ A;  2W0Q A;  1OAC A;  2BRV X;  3WIR A;  1D6Z A;  4BZH A;  1HM2 A;  2XN2 A;  3QDE A;  3VD5 A;  3D51 A;  1LOH A;  2HTB A;  3HII A;  2C10 A;  3NRE A;  1D6Y A;  3E7J A;  4K3A A;  4DUW A;  1NSV A;  3SEP A;  1L7K A;  3X3Z A;  4OK4 A;  2CFK A;  3BS6 A;  1Z45 A;  2CWU A;  4DUV A;  3VD9 A;  1IVX A;  1N7P A;  1C82 A;  5JMD A;  3CV5 A;  1JZ5 A;  1QAF A;  3OS7 A;  2Q1F A;  2YFN A;  3ACT A;  2CIQ A;  3D3I A;  3W7W A;  1AVL A;  2OW6 A;  5GW7 A;  2WW1 A;  1DYU A;  2JKE A;  3X42 A;  2EAC A;  3BVX A;  3D4Z A;  3BGA A;  3W7X A;  1F1S A;  1HM3 A;  3BVT A;  3HIG A;  1SIH A;  3D50 A;  3LVT A;  2CFL A;  1W6G A;  1RWF A;  1SNZ A;  3I3D A;  3A24 A;  1JYW A;  3T0A A;  1EGU A;  3K5T A;  1HMU A;  1D6U A;  2OW7 A;  1MN0 A;  3J7H A;  3BLC A;  3RRS A;  3S4A A; 
#chains in the Genus database with same CATH homology
 1N7O A;  1NS4 A;  1OJM A;  3WVF A;  1K1Y A;  5A1A A;  3A0O A;  3E1F 1;  3DCD A;  1NS7 A;  3E80 A;  3T0D A;  3WFA A;  3TY1 A;  3OB8 A;  1YQ2 A;  1PX3 A;  1W3Y A;  1HN1 A;  2CIS A;  1NSM A;  2ZXQ A;  3MV1 1;  3VDB A;  2WW3 A;  1J0M A;  1RWA A;  2D73 A;  3OBA A;  3IAP A;  1JZ7 A;  3T2O A;  1F4A A;  2XHN A;  1LUR A;  2ZQ0 A;  1JOV A;  1OJO A;  4DUX A;  2FUQ A;  1L7J A;  3VDA A;  2E24 A;  1RWG A;  3IMH A;  2BRW A;  3VSN A;  1NKG A;  3I3E A;  3ECQ A;  3NJV A;  4BZG A;  1NSZ A;  3AFL A;  3DYM A;  3VD7 A;  1I8Q A;  1LF6 A;  2BRV X;  1ULV A;  2X03 A;  4BZH A;  2WZS A;  1HM2 A;  1RW9 A;  4AQ0 A;  1YGA A;  3NJX A;  1N7Q A;  3VD5 A;  4BZE A;  1LOH A;  2HTB A;  1X1H A;  3K25 A;  1NSU A;  3NRE A;  1HMW A;  3E7J A;  4DUW A;  4J5T A;  1NSV A;  2WVY A;  3SEP A;  1CB8 A;  1L7K A;  3MWX A;  3MUZ 1;  1HN0 A;  1RWH A;  2E22 A;  2FUT A;  2JKA A;  2WVX A;  4MMI A;  3BS6 A;  4OK4 A;  1Z45 A;  1NS8 A;  4DUV A;  4RNL A;  3Q1N A;  1PX4 A;  2WCO A;  3VD9 A;  3T2Q A;  3VD4 A;  2JKP A;  4BZF A;  1J0N A;  1JZ8 A;  1N7R A;  1C82 A;  1N7P A;  1JYN A;  5JMD A;  1LXK A;  1JYV A;  1LXM A;  3DEC A;  3MUY 1;  1NS0 A;  3I3B A;  1JZ5 A;  3OS7 A;  1K1X A;  1LF9 A;  1X1I A;  2Q1F A;  2BRP A;  1UG9 A;  3CZJ A;  1JZ6 A;  2CIR A;  2CIQ A;  4TTG A;  4OJZ A;  5E1Q A;  2WW1 A;  2JKE A;  1OJP A;  1N7N A;  3T08 A;  1NSX A;  3BGA A;  3DYP A;  1MMX A;  2HTA A;  1JZ3 A;  1F1S A;  1HM3 A;  1MMU A;  2XSG A;  3VD3 A;  3VDC A;  1K1W A;  1NSS A;  1DP0 A;  3T09 A;  1SO0 A;  1JYX A;  1JZ2 A;  4OK2 A;  1RWF A;  1SNZ A;  3I3D A;  1TXK A;  2WVX B;  3A24 A;  3T0B A;  1RWC A;  3MV0 1;  3T0A A;  1JYW A;  1EGU A;  1MMZ A;  1OJN A;  2WVZ A;  1HMU A;  2WW2 A;  1F9G A;  1MN0 A;  3IAQ A;  4NEI A;  1NSR A;  3VSM A;  3T2P A;  2WDA A;  1NS2 A;  1F4H A;  3DYO A;  3J7H A;  1MMY A;  1JZ4 A;  1X1J A;  3BLC A;  5JMF A;  2WW0 A;  4FNV A;  4MMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...