1L7JA

X-ray structure of galactose mutarotase from lactococcus lactis (apo)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
338
structure length
338
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution X-ray structure of galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords galactose mutarotase
total genus 89
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1l7jA00
2XSGA 5E1QA 3I3EA 1K1WA 1MMUA 2E24A 1J0NA 3MUZ1 1OJNA 2ZXQA 3OBAA 1JZ5A 1JYVA 1EGUA 4BZEA 3IMHA 3VD5A 3VD4A 2Q1FA 1NSMA 1N7RA 1X1IA 2BRWA 1NSVA 1NS8A 3ECQA 3Q1NA 1L7KA 1LF9A 4DUXA 1DP0A 2CIQA 3DYMA 1C82A 4AQ0A 2WCOA 3A24A 1X1HA 1JZ3A 1W3YA 3I3DA 3T0AA 3MV01 1LF6A 3CZJA 1Z45A 1NS2A 1YQ2A 2WW0A 1NSZA 1X1JA 3I3BA 1NKGA 1RW9A 2WW2A 1RWCA 3DECA 3NREA 1L7JA 3VDBA 2D73A 1NSRA 2WVYA 1NS7A 2WW1A 1JYXA 4BZGA 1PX4A 2CIRA 1RWGA 1JYWA 1NSSA 1RWHA 4BZHA 3VDCA 1JZ4A 1JZ2A 1OJMA 3DYOA 1HM3A 2WVZA 3VD7A 1UG9A 3DYPA 3T0BA 3J7HA 1YGAA 2E22A 3MV11 3WFAA 3T0DA 3IAPA 2ZQ0A 1SNZA 1I8QA 3NJVA 1JOVA 1OJOA 1MMYA 2WVXB 1JZ7A 1HMUA 2WZSA 3VD3A 3T2PA 1NS0A 1HN0A 2BRVX 5A1AA 2WDAA 1F9GA 3MUY1 3NJXA 1F4AA 1MN0A 3DCDA 1NS4A 3VDAA 4DUWA 4BZFA 1LXMA 1TXKA 1LOHA 2HTAA 3VD9A 1RWFA 1F4HA 1K1YA 1K1XA 3T08A 2WW3A 3K25A 2JKEA 3OS7A 4RNLA 2X03A 1LURA 1JZ8A 1NSUA 2HTBA 2JKAA 3SEPA 4DUVA 3OB8A 1LXKA 1JZ6A 2XHNA 1HN1A 2BRPA 3E1F1 3T2QA 1NSXA 3T09A 1MMXA 1CB8A 1F1SA 1ULVA 1N7QA 1N7NA 1PX3A 1SO0A 3BGAA 1RWAA 3IAQA 2WVXA 1J0MA 1N7OA 1HM2A 3MWXA 2JKPA 3T2OA 1OJPA 2CISA 1MMZA 1JYNA 1N7PA 4TTGA 1HMWA
chains in the Genus database with same CATH superfamily
1J0NA 3SX1A 3BVXA 1UI8A 1JZ5A 1EKMA 3E7JA 2BRWA 2F1BA 2E2UA 1QWNA 1NS8A 3Q1NA 3BVUA 2C10A 4DUXA 2CIQA 4AQ0A 1W4NA 3MV01 1NSZA 3HIGA 1NKGA 3W7UA 3AMOB 2OOVC 1IQYA 4BTWA 2D73A 1NS7A 1V7XA 2EAEA 2WW1A 3BLBA 2FUQA 4BZGA 1PX4A 1W6GA 2ALWA 4NEIA 4EV2A 1RWHA 3N9HA 2CFGA 3ACTA 3VDCA 3HIIA 1OJMA 3K5TA 3VD7A 3DX4A 1A2VA 4OK4A 3VSNA 2EACA 3T0DA 2OW7A 1V7VA 5JMDA 1WMNA 2WO0A 1JZ7A 1HMUA 3EJTA 3T2PA 1HN0A 3MUY1 1F4AA 1AV4A 3DCDA 4BZFA 2F7RA 2CFKA 4J5TA 2XN2A 2F1AA 2HTBA 3SEPA 4DUVA 3OB8A 1HN1A 2BRPA 3T09A 1ULVA 1SO0A 3IAQA 1RWAA 3BUPA 3DDGA 1QAFA 1MMZA 1N7PA 1RKYA 3EJRA 2XSGA 3D50A 3ALAA 3QFZA 1IU7A 1K1WA 2FYVA 4FNRA 3OBAA 1IVVA 1JYVA 2OOVA 3X40A 1EGUA 4BZEA 3IMHA 3VD5A 2Q1FA 2CQTA 3ECQA 4KFDA 2W0QA 2WOFA 1LF9A 3AFJA 1TQTA 1JZ3A 1X1HA 1W3YA 1HTYA 1LF6A 3CZJA 1NS2A 1D6UA 1RJOA 3DECA 1PU4A 3NREA 2F7QA 1SIIA 3S4AA 1TQUA 3BS6A 1JYXA 4OJZA 2CFLA 1RWGA 3DDFA 1JYWA 3W7WA 4KTPA 4KFFA 2C11A 3AFLA 1HM3A 3RSYA 1UG9A 3DYPA 3CZNA 5GW7A 1OACA 3WFAA 4MMHA 2YFNA 3AMOA 1SNZA 1MMYA 2WVXB 1H54A 5A1AA 2WDAA 2WOHA 4FNSA 2CFWA 3BLCA 1W5ZA 4BTXA 4KFEA 4DUWA 3VD9A 1LOHA 3T0UA 1QX1A 1K1YA 1K1XA 4K35A 1QWUA 3T08A 3K25A 2JKEA 4RNLA 2X03A 1US1A 1R33A 2XHNA 4FNPA 1CB8A 2OQEC 1WMPA 3WVFA 3W7XA 2WVXA 2RDYA 3BVTA 1WMOA 1DYUA 1OJPA 3DX0A 3D51A 2F18A 2WYHA 4TTGA 5E1QA 3I3EA 3WIQA 1MMUA 2E2TA 3MUZ1 3DX3A 3X3ZA 1IQXA 2EADA 3S4CA 1PS3A 3VD4A 2CWTA 3MPHA 1NSMA 4FNVA 1NSVA 1L7KA 1C82A 1R34A 3A24A 3I3DA 3T0AA 3SXXA 5CA3A 3X3YA 1QAKA 3QG0A 1YQ2A 3S4BA 1X1JA 3BUDA 3I3BA 3DX1A 1L7JA 1UI7A 2EABA 3TY1A 3BUBA 4EV5A 1W2ZA 3S4DA 1W7CA 2F7OA 1JZ2A 1N9EA 4MMIA 2FUTA 3T0BA 1YGAA 3PGBA 2CQSA 3CZSA 3HI7A 4BTYA 3NJVA 1V7WA 3QDEA 2YX9A 2WZSA 2CWUA 3D3IA 2BRVX 3NBBA 2D1WA 3D4YA 1F9GA 3NBJA 3KIIA 3QFYA 3LVTA 1NS4A 3VDAA 1O7DD 1TXKA 4FNTA 1RWFA 3OS7A 2CWVA 2JKAA 2CFDA 3E1F1 3T2QA 1MMXA 1W6CA 1N7NA 3X41A 2CG0A 1PX3A 3BGAA 1J0MA 1N7OA 3WA2X 1HM2A 3X3XA 3MWXA 3T2OA 3WA3A 2CISA 2BT3A 3D4ZA 2PNCA 2E24A 1TU5A 1OJNA 2E2VA 2ZXQA 1SIHA 3RRSA 2CG1A 3WIRA 1AVKA 1HWWA 2F7PA 4FNUA 4UFCA 1LVNA 1N7RA 1X1IA 2Y73A 3W7SA 1DP0A 4K3AA 3DYMA 2WCOA 3DX2A 1AVLA 2XN0A 1IVXA 1Z45A 1D6YA 2WW0A 1KSIA 3BVWA 1RW9A 2WW2A 1RWCA 1TQWA 3VDBA 4OK2A 1NSRA 2WVYA 4KTRA 2CIRA 1NSSA 3A0OA 3BVVA 5KBPA 4BZHA 1IVUA 1D6ZA 1JZ4A 2Y74A 1SPUA 3DYOA 1TQVA 2WVZA 1JRQA 3EJUA 3J7HA 2E22A 3MV11 3IAPA 2OQEA 3KN4A 2ZQ0A 2YFOA 2OW6A 3X42A 1I8QA 1JOVA 3BUQA 1OJOA 1TQSA 1IVWA 1HXKA 4FNQA 5JMFA 3VD3A 3W7TA 1NS0A 3BUIA 3EJPA 1QALA 3NJXA 1MN0A 3LOYA 3VSMA 1LXMA 2HTAA 3CV5A 1F4HA 3MI6A 2WW3A 2ZL8A 1LURA 2WYIA 3E80A 1NSUA 1JZ8A 3EJQA 1LXKA 1JZ6A 2XN1A 2WGQA 1NSXA 1F1SA 1N7QA 3ACSA 3D52A 2JKPA 1JYNA 3EJSA 1HMWA
chains in the Genus database with same CATH topology
2XSGA 5E1QA 3I3EA 1K1WA 1MMUA 2E24A 1J0NA 3MUZ1 1OJNA 2ZXQA 3OBAA 1JZ5A 1JYVA 1EGUA 4BZEA 3IMHA 3VD5A 3VD4A 3E7JA 2Q1FA 1NSMA 1N7RA 1X1IA 2BRWA 4FNVA 1NSVA 1NS8A 3ECQA 3Q1NA 1L7KA 1LF9A 4DUXA 1DP0A 2CIQA 3DYMA 1C82A 4AQ0A 2WCOA 3A24A 1X1HA 1JZ3A 1W3YA 3I3DA 3T0AA 3MV01 1LF6A 3CZJA 1Z45A 1NS2A 1YQ2A 2WW0A 1NSZA 1X1JA 3I3BA 1NKGA 1RW9A 2WW2A 1RWCA 3DECA 3NREA 1L7JA 4OK2A 2D73A 1NSRA 2WVYA 1NS7A 3TY1A 3VDBA 2WW1A 3BS6A 1JYXA 4BZGA 2FUQA 4OJZA 1PX4A 2CIRA 1RWGA 4NEIA 1JYWA 1NSSA 3A0OA 1RWHA 4BZHA 3VDCA 1JZ4A 3AFLA 1JZ2A 1OJMA 3DYOA 1HM3A 4MMIA 2WVZA 3VD7A 1UG9A 3DYPA 2FUTA 3T0BA 3J7HA 4OK4A 1YGAA 2E22A 3MV11 3VSNA 3WFAA 3T0DA 3IAPA 4MMHA 2ZQ0A 5JMDA 1SNZA 1I8QA 3NJVA 1JOVA 1OJOA 1MMYA 2WVXB 1JZ7A 1HMUA 2WZSA 5JMFA 3VD3A 3T2PA 1NS0A 1HN0A 2BRVX 5A1AA 2WDAA 1F9GA 3BLCA 3MUY1 3NJXA 1F4AA 1MN0A 3VSMA 3DCDA 1NS4A 3VDAA 4DUWA 4BZFA 1LXMA 1TXKA 1LOHA 2HTAA 3VD9A 1RWFA 1F4HA 1K1YA 1K1XA 3T08A 2WW3A 3K25A 2JKEA 3OS7A 4J5TA 4RNLA 2X03A 1LURA 1JZ8A 3E80A 1NSUA 2HTBA 2JKAA 3SEPA 4DUVA 3OB8A 1LXKA 1JZ6A 2XHNA 1HN1A 2BRPA 3E1F1 3T2QA 1NSXA 3T09A 1MMXA 1CB8A 1F1SA 1ULVA 3WVFA 1N7QA 1N7NA 1PX3A 1SO0A 3BGAA 1RWAA 3IAQA 2WVXA 1J0MA 1N7OA 1HM2A 3MWXA 2JKPA 3T2OA 1OJPA 2CISA 1MMZA 1JYNA 1N7PA 4TTGA 1HMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSG A;  5E1Q A;  3I3E A;  1K1W A;  1MMU A;  2E24 A;  1J0N A;  3MUZ 1;  1OJN A;  2ZXQ A;  3OBA A;  1JZ5 A;  1JYV A;  1EGU A;  4BZE A;  3IMH A;  3VD5 A;  3VD4 A;  2Q1F A;  1NSM A;  1N7R A;  1X1I A;  2BRW A;  1NSV A;  1NS8 A;  3ECQ A;  3Q1N A;  1L7K A;  1LF9 A;  4DUX A;  1DP0 A;  2CIQ A;  3DYM A;  1C82 A;  4AQ0 A;  2WCO A;  3A24 A;  1X1H A;  1JZ3 A;  1W3Y A;  3I3D A;  3T0A A;  3MV0 1;  1LF6 A;  3CZJ A;  1Z45 A;  1NS2 A;  1YQ2 A;  2WW0 A;  1NSZ A;  1X1J A;  3I3B A;  1NKG A;  1RW9 A;  2WW2 A;  1RWC A;  3DEC A;  3NRE A;  1L7J A;  3VDB A;  2D73 A;  1NSR A;  2WVY A;  1NS7 A;  2WW1 A;  1JYX A;  4BZG A;  1PX4 A;  2CIR A;  1RWG A;  1JYW A;  1NSS A;  1RWH A;  4BZH A;  3VDC A;  1JZ4 A;  1JZ2 A;  1OJM A;  3DYO A;  1HM3 A;  2WVZ A;  3VD7 A;  1UG9 A;  3DYP A;  3T0B A;  3J7H A;  1YGA A;  2E22 A;  3MV1 1;  3WFA A;  3T0D A;  3IAP A;  2ZQ0 A;  1SNZ A;  1I8Q A;  3NJV A;  1JOV A;  1OJO A;  1MMY A;  2WVX B;  1JZ7 A;  1HMU A;  2WZS A;  3VD3 A;  3T2P A;  1NS0 A;  1HN0 A;  2BRV X;  5A1A A;  2WDA A;  1F9G A;  3MUY 1;  3NJX A;  1F4A A;  1MN0 A;  3DCD A;  1NS4 A;  3VDA A;  4DUW A;  4BZF A;  1LXM A;  1TXK A;  1LOH A;  2HTA A;  3VD9 A;  1RWF A;  1F4H A;  1K1Y A;  1K1X A;  3T08 A;  2WW3 A;  3K25 A;  2JKE A;  3OS7 A;  4RNL A;  2X03 A;  1LUR A;  1JZ8 A;  1NSU A;  2HTB A;  2JKA A;  3SEP A;  4DUV A;  3OB8 A;  1LXK A;  1JZ6 A;  2XHN A;  1HN1 A;  2BRP A;  3E1F 1;  3T2Q A;  1NSX A;  3T09 A;  1MMX A;  1CB8 A;  1F1S A;  1ULV A;  1N7Q A;  1N7N A;  1PX3 A;  1SO0 A;  3BGA A;  1RWA A;  3IAQ A;  2WVX A;  1J0M A;  1N7O A;  1HM2 A;  3MWX A;  2JKP A;  3T2O A;  1OJP A;  2CIS A;  1MMZ A;  1JYN A;  1N7P A;  4TTG A;  1HMW A; 
#chains in the Genus database with same CATH topology
 1J0N A;  3SX1 A;  3BVX A;  1UI8 A;  1JZ5 A;  1EKM A;  3E7J A;  2BRW A;  2F1B A;  2E2U A;  1QWN A;  1NS8 A;  3Q1N A;  3BVU A;  2C10 A;  4DUX A;  2CIQ A;  4AQ0 A;  1W4N A;  3MV0 1;  1NSZ A;  3HIG A;  1NKG A;  3W7U A;  3AMO B;  2OOV C;  1IQY A;  4BTW A;  2D73 A;  1NS7 A;  1V7X A;  2EAE A;  2WW1 A;  3BLB A;  2FUQ A;  4BZG A;  1PX4 A;  1W6G A;  2ALW A;  4NEI A;  4EV2 A;  1RWH A;  3N9H A;  2CFG A;  3ACT A;  3VDC A;  3HII A;  1OJM A;  3K5T A;  3VD7 A;  3DX4 A;  1A2V A;  4OK4 A;  3VSN A;  2EAC A;  3T0D A;  2OW7 A;  1V7V A;  5JMD A;  1WMN A;  2WO0 A;  1JZ7 A;  1HMU A;  3EJT A;  3T2P A;  1HN0 A;  3MUY 1;  1F4A A;  1AV4 A;  3DCD A;  4BZF A;  2F7R A;  2CFK A;  4J5T A;  2XN2 A;  2F1A A;  2HTB A;  3SEP A;  4DUV A;  3OB8 A;  1HN1 A;  2BRP A;  3T09 A;  1ULV A;  1SO0 A;  3IAQ A;  1RWA A;  3BUP A;  3DDG A;  1QAF A;  1MMZ A;  1N7P A;  1RKY A;  3EJR A;  2XSG A;  3D50 A;  3ALA A;  3QFZ A;  1IU7 A;  1K1W A;  2FYV A;  4FNR A;  3OBA A;  1IVV A;  1JYV A;  2OOV A;  3X40 A;  1EGU A;  4BZE A;  3IMH A;  3VD5 A;  2Q1F A;  2CQT A;  3ECQ A;  4KFD A;  2W0Q A;  2WOF A;  1LF9 A;  3AFJ A;  1TQT A;  1JZ3 A;  1X1H A;  1W3Y A;  1HTY A;  1LF6 A;  3CZJ A;  1NS2 A;  1D6U A;  1RJO A;  3DEC A;  1PU4 A;  3NRE A;  2F7Q A;  1SII A;  3S4A A;  1TQU A;  3BS6 A;  1JYX A;  4OJZ A;  2CFL A;  1RWG A;  3DDF A;  1JYW A;  3W7W A;  4KTP A;  4KFF A;  2C11 A;  3AFL A;  1HM3 A;  3RSY A;  1UG9 A;  3DYP A;  3CZN A;  5GW7 A;  1OAC A;  3WFA A;  4MMH A;  2YFN A;  3AMO A;  1SNZ A;  1MMY A;  2WVX B;  1H54 A;  5A1A A;  2WDA A;  2WOH A;  4FNS A;  2CFW A;  3BLC A;  1W5Z A;  4BTX A;  4KFE A;  4DUW A;  3VD9 A;  1LOH A;  3T0U A;  1QX1 A;  1K1Y A;  1K1X A;  4K35 A;  1QWU A;  3T08 A;  3K25 A;  2JKE A;  4RNL A;  2X03 A;  1US1 A;  1R33 A;  2XHN A;  4FNP A;  1CB8 A;  2OQE C;  1WMP A;  3WVF A;  3W7X A;  2WVX A;  2RDY A;  3BVT A;  1WMO A;  1DYU A;  1OJP A;  3DX0 A;  3D51 A;  2F18 A;  2WYH A;  4TTG A;  5E1Q A;  3I3E A;  3WIQ A;  1MMU A;  2E2T A;  3MUZ 1;  3DX3 A;  3X3Z A;  1IQX A;  2EAD A;  3S4C A;  1PS3 A;  3VD4 A;  2CWT A;  3MPH A;  1NSM A;  4FNV A;  1NSV A;  1L7K A;  1C82 A;  1R34 A;  3A24 A;  3I3D A;  3T0A A;  3SXX A;  5CA3 A;  3X3Y A;  1QAK A;  3QG0 A;  1YQ2 A;  3S4B A;  1X1J A;  3BUD A;  3I3B A;  3DX1 A;  1L7J A;  1UI7 A;  2EAB A;  3TY1 A;  3BUB A;  4EV5 A;  1W2Z A;  3S4D A;  1W7C A;  2F7O A;  1JZ2 A;  1N9E A;  4MMI A;  2FUT A;  3T0B A;  1YGA A;  3PGB A;  2CQS A;  3CZS A;  3HI7 A;  4BTY A;  3NJV A;  1V7W A;  3QDE A;  2YX9 A;  2WZS A;  2CWU A;  3D3I A;  2BRV X;  3NBB A;  2D1W A;  3D4Y A;  1F9G A;  3NBJ A;  3KII A;  3QFY A;  3LVT A;  1NS4 A;  3VDA A;  1O7D D;  1TXK A;  4FNT A;  1RWF A;  3OS7 A;  2CWV A;  2JKA A;  2CFD A;  3E1F 1;  3T2Q A;  1MMX A;  1W6C A;  1N7N A;  3X41 A;  2CG0 A;  1PX3 A;  3BGA A;  1J0M A;  1N7O A;  3WA2 X;  1HM2 A;  3X3X A;  3MWX A;  3T2O A;  3WA3 A;  2CIS A;  2BT3 A;  3D4Z A;  2PNC A;  2E24 A;  1TU5 A;  1OJN A;  2E2V A;  2ZXQ A;  1SIH A;  3RRS A;  2CG1 A;  3WIR A;  1AVK A;  1HWW A;  2F7P A;  4FNU A;  4UFC A;  1LVN A;  1N7R A;  1X1I A;  2Y73 A;  3W7S A;  1DP0 A;  4K3A A;  3DYM A;  2WCO A;  3DX2 A;  1AVL A;  2XN0 A;  1IVX A;  1Z45 A;  1D6Y A;  2WW0 A;  1KSI A;  3BVW A;  1RW9 A;  2WW2 A;  1RWC A;  1TQW A;  3VDB A;  4OK2 A;  1NSR A;  2WVY A;  4KTR A;  2CIR A;  1NSS A;  3A0O A;  3BVV A;  5KBP A;  4BZH A;  1IVU A;  1D6Z A;  1JZ4 A;  2Y74 A;  1SPU A;  3DYO A;  1TQV A;  2WVZ A;  1JRQ A;  3EJU A;  3J7H A;  2E22 A;  3MV1 1;  3IAP A;  2OQE A;  3KN4 A;  2ZQ0 A;  2YFO A;  2OW6 A;  3X42 A;  1I8Q A;  1JOV A;  3BUQ A;  1OJO A;  1TQS A;  1IVW A;  1HXK A;  4FNQ A;  5JMF A;  3VD3 A;  3W7T A;  1NS0 A;  3BUI A;  3EJP A;  1QAL A;  3NJX A;  1MN0 A;  3LOY A;  3VSM A;  1LXM A;  2HTA A;  3CV5 A;  1F4H A;  3MI6 A;  2WW3 A;  2ZL8 A;  1LUR A;  2WYI A;  3E80 A;  1NSU A;  1JZ8 A;  3EJQ A;  1LXK A;  1JZ6 A;  2XN1 A;  2WGQ A;  1NSX A;  1F1S A;  1N7Q A;  3ACS A;  3D52 A;  2JKP A;  1JYN A;  3EJS A;  1HMW A; 
#chains in the Genus database with same CATH homology
 2XSG A;  5E1Q A;  3I3E A;  1K1W A;  1MMU A;  2E24 A;  1J0N A;  3MUZ 1;  1OJN A;  2ZXQ A;  3OBA A;  1JZ5 A;  1JYV A;  1EGU A;  4BZE A;  3IMH A;  3VD5 A;  3VD4 A;  3E7J A;  2Q1F A;  1NSM A;  1N7R A;  1X1I A;  2BRW A;  4FNV A;  1NSV A;  1NS8 A;  3ECQ A;  3Q1N A;  1L7K A;  1LF9 A;  4DUX A;  1DP0 A;  2CIQ A;  3DYM A;  1C82 A;  4AQ0 A;  2WCO A;  3A24 A;  1X1H A;  1JZ3 A;  1W3Y A;  3I3D A;  3T0A A;  3MV0 1;  1LF6 A;  3CZJ A;  1Z45 A;  1NS2 A;  1YQ2 A;  2WW0 A;  1NSZ A;  1X1J A;  3I3B A;  1NKG A;  1RW9 A;  2WW2 A;  1RWC A;  3DEC A;  3NRE A;  1L7J A;  4OK2 A;  2D73 A;  1NSR A;  2WVY A;  1NS7 A;  3TY1 A;  3VDB A;  2WW1 A;  3BS6 A;  1JYX A;  4BZG A;  2FUQ A;  4OJZ A;  1PX4 A;  2CIR A;  1RWG A;  4NEI A;  1JYW A;  1NSS A;  3A0O A;  1RWH A;  4BZH A;  3VDC A;  1JZ4 A;  3AFL A;  1JZ2 A;  1OJM A;  3DYO A;  1HM3 A;  4MMI A;  2WVZ A;  3VD7 A;  1UG9 A;  3DYP A;  2FUT A;  3T0B A;  3J7H A;  4OK4 A;  1YGA A;  2E22 A;  3MV1 1;  3VSN A;  3WFA A;  3T0D A;  3IAP A;  4MMH A;  2ZQ0 A;  5JMD A;  1SNZ A;  1I8Q A;  3NJV A;  1JOV A;  1OJO A;  1MMY A;  2WVX B;  1JZ7 A;  1HMU A;  2WZS A;  5JMF A;  3VD3 A;  3T2P A;  1NS0 A;  1HN0 A;  2BRV X;  5A1A A;  2WDA A;  1F9G A;  3BLC A;  3MUY 1;  3NJX A;  1F4A A;  1MN0 A;  3VSM A;  3DCD A;  1NS4 A;  3VDA A;  4DUW A;  4BZF A;  1LXM A;  1TXK A;  1LOH A;  2HTA A;  3VD9 A;  1RWF A;  1F4H A;  1K1Y A;  1K1X A;  3T08 A;  2WW3 A;  3K25 A;  2JKE A;  3OS7 A;  4J5T A;  4RNL A;  2X03 A;  1LUR A;  1JZ8 A;  3E80 A;  1NSU A;  2HTB A;  2JKA A;  3SEP A;  4DUV A;  3OB8 A;  1LXK A;  1JZ6 A;  2XHN A;  1HN1 A;  2BRP A;  3E1F 1;  3T2Q A;  1NSX A;  3T09 A;  1MMX A;  1CB8 A;  1F1S A;  1ULV A;  3WVF A;  1N7Q A;  1N7N A;  1PX3 A;  1SO0 A;  3BGA A;  1RWA A;  3IAQ A;  2WVX A;  1J0M A;  1N7O A;  1HM2 A;  3MWX A;  2JKP A;  3T2O A;  1OJP A;  2CIS A;  1MMZ A;  1JYN A;  1N7P A;  4TTG A;  1HMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...