1L7JA

X-ray structure of galactose mutarotase from lactococcus lactis (apo)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
338
structure length
338
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galactose mutarotase
publication title High resolution X-ray structure of galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 89
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1l7jA00
1HMUA 1I8QA 2Q1FA 1DP0A 1F9GA 1NSVA 3I3EA 1SO0A 1N7NA 1N7QA 1NS7A 3DYMA 3VD4A 3I3BA 1JZ4A 2BRPA 1MMZA 1PX4A 1RWGA 4BZEA 2JKPA 2D73A 3MUY1 3NJVA 4TTGA 1HM2A 3NJXA 1HMWA 1HM3A 1NKGA 2XSGA 3VD3A 3MUZ1 4DUWA 3Q1NA 1K1YA 2CISA 3VDCA 4DUXA 1X1IA 5A1AA 2WW3A 3OB8A 3VD5A 1NSRA 1L7JA 1JYWA 2WW2A 3A24A 3IMHA 1NSXA 3BGAA 2XHNA 3CZJA 1JZ8A 1LOHA 1MMYA 1JZ6A 3NREA 2WVXB 1MN0A 1RWCA 2WW0A 4DUVA 3T0DA 2E24A 2WZSA 3ECQA 3T2PA 2CIQA 1TXKA 1JYNA 1RW9A 1MMXA 3DCDA 1N7RA 1N7OA 1OJNA 2WDAA 1NS4A 1LURA 1NS2A 2X03A 3MV01 1W3YA 1JYXA 1F1SA 1NS0A 1X1HA 1NS8A 1K1WA 1OJOA 1NSUA 1YQ2A 1LXMA 2BRWA 2CIRA 2WVZA 1JZ7A 1L7KA 1NSZA 1NSSA 3DYPA 3OBAA 1LXKA 5E1QA 1JOVA 1F4AA 3DYOA 1K1XA 2WVXA 1HN0A 3SEPA 3T2OA 1N7PA 3VD9A 2WW1A 4AQ0A 3IAQA 3T09A 1LF6A 3T0AA 1C82A 1J0NA 1RWHA 2ZQ0A 1LF9A 1ULVA 2JKAA 3E1F1 1OJMA 1UG9A 3VD7A 1RWAA 3MWXA 1JZ2A 3VDAA 1HN1A 2JKEA 1PX3A 3DECA 4BZGA 1JYVA 1SNZA 3T2QA 1J0MA 2ZXQA 3T08A 2BRVX 4RNLA 4BZFA 1Z45A 1X1JA 3VDBA 1MMUA 1YGAA 2HTAA 2WCOA 1F4HA 1NSMA 3K25A 3I3DA 2HTBA 1RWFA 3J7HA 2E22A 1CB8A 1JZ3A 4BZHA 3T0BA 3WFAA 3IAPA 1EGUA 2WVYA 1OJPA 3MV11 3OS7A 1JZ5A
chains in the Genus database with same CATH superfamily
1I8QA 1DP0A 4EV5A 1N7QA 2CWVA 1NS7A 3VD4A 1AVKA 1PX4A 3HIGA 2OOVC 3NJVA 3X3XA 3CZSA 2W0QA 3BVWA 2XSGA 1SPUA 1WMPA 3BUQA 3MUZ1 4DUWA 1K1YA 3VDCA 1X1IA 3EJTA 3OB8A 2OOVA 3DX3A 2CWUA 3EJPA 3A24A 3IMHA 3RRSA 2WO0A 1H54A 3AMOA 4K35A 1JZ8A 1JZ6A 4FNTA 3W7TA 1IVUA 4MMIA 1OJNA 1NS4A 3D4YA 2X03A 3VSNA 5JMFA 1X1HA 1NS8A 3ALAA 3BUIA 1NSUA 1YQ2A 2CIRA 1IVXA 1L7KA 3DDFA 1JOVA 1F4AA 1SIIA 1HN0A 3SEPA 3T2OA 1N7PA 1UI7A 2OW7A 2CFDA 3WIRA 1DYUA 1RWHA 2ZQ0A 3NBJA 1R33A 3E1F1 3DX4A 3MWXA 3D4ZA 2JKEA 4FNPA 3DECA 1JYVA 3T2QA 2ZXQA 5GW7A 4RNLA 1AVLA 2CG0A 1MMUA 2EADA 3KIIA 1RWFA 3BUBA 1QALA 2E22A 2C10A 3K5TA 1W6GA 2F7OA 2PNCA 3MV11 2F7PA 1UI8A 1JZ5A 3QFZA 1IVWA 1NSVA 2FYVA 3I3EA 1N7NA 2CG1A 2CWTA 1W2ZA 2F7QA 3BVXA 3X40A 4J5TA 1W4NA 3W7XA 4OK2A 4NEIA 4OJZA 1NKGA 2WYIA 3AFLA 1RJOA 2YFOA 3LVTA 1NSRA 4KTPA 4FNQA 1NSXA 1HTYA 3X3ZA 3A0OA 3CZJA 1LOHA 3NREA 1MN0A 2WZSA 3PGBA 2FUTA 1QWUA 3D52A 1RW9A 4UFCA 1LURA 3MV01 3HI7A 1NS0A 2CFGA 2YFNA 1N9EA 1LXMA 1JZ7A 1NSZA 3X3YA 3MPHA 3ACSA 5E1QA 2WOFA 4FNVA 1TU5A 1TQVA 1QX1A 3WA3A 1US1A 2WW1A 3IAQA 3T0AA 1C82A 3S4AA 3ACTA 4KFFA 2ZL8A 1HN1A 2XN1A 1V7VA 2CFLA 2F1BA 4BTYA 2FUQA 1SNZA 3QFYA 3EJUA 3T08A 2BRVX 5JMDA 4KFDA 2ALWA 1QAFA 1NSMA 1D6ZA 3RSYA 3J7HA 3EJRA 1CB8A 1D6YA 1WMNA 2CFWA 2EABA 3LOYA 1HMUA 3QDEA 1F9GA 3DX1A 3BVTA 1JZ4A 4OK4A 1RWGA 3AFJA 3MUY1 4FNRA 4TTGA 3NJXA 1HMWA 2CISA 5A1AA 3W7WA 2WW3A 3VD5A 1L7JA 2WW2A 2F7RA 3BGAA 2XHNA 2D1WA 2CQSA 1MMYA 2WVXB 2WW0A 4DUVA 3T0DA 2WOHA 3ECQA 3DX2A 3NBBA 1TXKA 1WMOA 1JYNA 1IQYA 3W7UA 1TQUA 1N7RA 3CZNA 3EJQA 1EKMA 1O7DD 3HIIA 1IVVA 1W3YA 1JYXA 1IU7A 1F1SA 3QG0A 1K1WA 2CQTA 1OJOA 3BLBA 3E7JA 2EAEA 2WVZA 1NSSA 3DYPA 1W5ZA 1A2VA 2OQEC 2WVXA 3EJSA 3VD9A 3T09A 3X41A 1LF6A 1W6CA 4BTXA 2OW6A 4MMHA 5CA3A 3T0UA 4FNSA 1JZ2A 1JRQA 2E2TA 3WVFA 2C11A 1KSIA 3D51A 1V7XA 2WYHA 1QWNA 4BZFA 1X1JA 3VDBA 1PS3A 3WA2X 1YGAA 2BT3A 2CFKA 3TY1A 2WCOA 1F4HA 2HTBA 1TQWA 3WIQA 4BZHA 1RKYA 3WFAA 3X42A 1QAKA 3OS7A 2F1AA 2Q1FA 3SX1A 1SO0A 3MI6A 3DYMA 3I3BA 2RDYA 2BRPA 2E2UA 1MMZA 4BZEA 2JKPA 2D73A 4FNUA 1HM2A 5KBPA 1HM3A 3DX0A 3VD3A 1HXKA 3Q1NA 4DUXA 3N9HA 2XN0A 3SXXA 1JYWA 2Y73A 3BVVA 2EACA 1RWCA 2E24A 3T2PA 2CIQA 3KN4A 3S4CA 1MMXA 2E2VA 3DCDA 1N7OA 2WDAA 1NS2A 3BVUA 3S4BA 3VSMA 2WGQA 1TQSA 1V7WA 3W7SA 1R34A 3D50A 2BRWA 1LVNA 4EV2A 3OBAA 1LXKA 3DYOA 1K1XA 3BS6A 1AV4A 3BUDA 1D6UA 2YX9A 4AQ0A 1SIHA 4KTRA 3E80A 1J0NA 1LF9A 1ULVA 2JKAA 1IQXA 1PU4A 1OJMA 1UG9A 1TQTA 1RWAA 3D3IA 3VD7A 2XN2A 3VDAA 3DDGA 1PX3A 1HWWA 4BZGA 3BLCA 4K3AA 1J0MA 1W7CA 4BTWA 2F18A 3BUPA 1Z45A 3CV5A 2HTAA 3K25A 3I3DA 2OQEA 3S4DA 1JZ3A 3T0BA 3IAPA 1EGUA 2WVYA 1OJPA 4KFEA 3AMOB 2Y74A 1OACA
chains in the Genus database with same CATH topology
1HMUA 1I8QA 2Q1FA 1DP0A 1F9GA 1NSVA 3I3EA 1SO0A 1N7NA 1N7QA 1NS7A 3DYMA 3VD4A 3I3BA 1JZ4A 2BRPA 1MMZA 1PX4A 1RWGA 4OK4A 4BZEA 2JKPA 2D73A 3MUY1 3NJVA 4J5TA 4TTGA 4OK2A 1HM2A 4NEIA 3NJXA 4OJZA 1HMWA 1HM3A 1NKGA 2XSGA 3VD3A 3MUZ1 4DUWA 3Q1NA 1K1YA 2CISA 3VDCA 4DUXA 1X1IA 3AFLA 5A1AA 2WW3A 3OB8A 3VD5A 1NSRA 1L7JA 1JYWA 2WW2A 3A24A 3IMHA 1NSXA 3BGAA 3A0OA 2XHNA 3CZJA 1JZ8A 1LOHA 1MMYA 1JZ6A 3NREA 2WVXB 1MN0A 1RWCA 2WW0A 4DUVA 3T0DA 2E24A 2WZSA 3ECQA 3T2PA 2FUTA 2CIQA 1TXKA 1JYNA 1RW9A 1MMXA 3DCDA 1N7RA 1N7OA 4MMIA 1OJNA 2WDAA 1NS4A 1LURA 1NS2A 2X03A 3VSMA 3MV01 1W3YA 1JYXA 3VSNA 1F1SA 1NS0A 5JMFA 1X1HA 1NS8A 1K1WA 1OJOA 3E7JA 1NSUA 1YQ2A 1LXMA 2BRWA 2CIRA 2WVZA 1JZ7A 1L7KA 1NSZA 1NSSA 3DYPA 3OBAA 1LXKA 5E1QA 4FNVA 1JOVA 1F4AA 3DYOA 1K1XA 2WVXA 3BS6A 1HN0A 3SEPA 3T2OA 1N7PA 3VD9A 2WW1A 4AQ0A 3IAQA 3T09A 1LF6A 3T0AA 1C82A 3E80A 1J0NA 1RWHA 2ZQ0A 4MMHA 1LF9A 1ULVA 2JKAA 3E1F1 1OJMA 1UG9A 3VD7A 1RWAA 3MWXA 1JZ2A 3VDAA 1HN1A 2JKEA 1PX3A 3DECA 4BZGA 3BLCA 1JYVA 3WVFA 2FUQA 1SNZA 3T2QA 1J0MA 2ZXQA 3T08A 2BRVX 4RNLA 4BZFA 1Z45A 1X1JA 5JMDA 3VDBA 1MMUA 1YGAA 3TY1A 2HTAA 2WCOA 1F4HA 1NSMA 3K25A 3I3DA 2HTBA 1RWFA 3J7HA 2E22A 1CB8A 1JZ3A 4BZHA 3T0BA 3WFAA 3IAPA 1EGUA 2WVYA 1OJPA 3MV11 3OS7A 1JZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMU A;  1I8Q A;  2Q1F A;  1DP0 A;  1F9G A;  1NSV A;  3I3E A;  1SO0 A;  1N7N A;  1N7Q A;  1NS7 A;  3DYM A;  3VD4 A;  3I3B A;  1JZ4 A;  2BRP A;  1MMZ A;  1PX4 A;  1RWG A;  4BZE A;  2JKP A;  2D73 A;  3MUY 1;  3NJV A;  4TTG A;  1HM2 A;  3NJX A;  1HMW A;  1HM3 A;  1NKG A;  2XSG A;  3VD3 A;  3MUZ 1;  4DUW A;  3Q1N A;  1K1Y A;  2CIS A;  3VDC A;  4DUX A;  1X1I A;  5A1A A;  2WW3 A;  3OB8 A;  3VD5 A;  1NSR A;  1L7J A;  1JYW A;  2WW2 A;  3A24 A;  3IMH A;  1NSX A;  3BGA A;  2XHN A;  3CZJ A;  1JZ8 A;  1LOH A;  1MMY A;  1JZ6 A;  3NRE A;  2WVX B;  1MN0 A;  1RWC A;  2WW0 A;  4DUV A;  3T0D A;  2E24 A;  2WZS A;  3ECQ A;  3T2P A;  2CIQ A;  1TXK A;  1JYN A;  1RW9 A;  1MMX A;  3DCD A;  1N7R A;  1N7O A;  1OJN A;  2WDA A;  1NS4 A;  1LUR A;  1NS2 A;  2X03 A;  3MV0 1;  1W3Y A;  1JYX A;  1F1S A;  1NS0 A;  1X1H A;  1NS8 A;  1K1W A;  1OJO A;  1NSU A;  1YQ2 A;  1LXM A;  2BRW A;  2CIR A;  2WVZ A;  1JZ7 A;  1L7K A;  1NSZ A;  1NSS A;  3DYP A;  3OBA A;  1LXK A;  5E1Q A;  1JOV A;  1F4A A;  3DYO A;  1K1X A;  2WVX A;  1HN0 A;  3SEP A;  3T2O A;  1N7P A;  3VD9 A;  2WW1 A;  4AQ0 A;  3IAQ A;  3T09 A;  1LF6 A;  3T0A A;  1C82 A;  1J0N A;  1RWH A;  2ZQ0 A;  1LF9 A;  1ULV A;  2JKA A;  3E1F 1;  1OJM A;  1UG9 A;  3VD7 A;  1RWA A;  3MWX A;  1JZ2 A;  3VDA A;  1HN1 A;  2JKE A;  1PX3 A;  3DEC A;  4BZG A;  1JYV A;  1SNZ A;  3T2Q A;  1J0M A;  2ZXQ A;  3T08 A;  2BRV X;  4RNL A;  4BZF A;  1Z45 A;  1X1J A;  3VDB A;  1MMU A;  1YGA A;  2HTA A;  2WCO A;  1F4H A;  1NSM A;  3K25 A;  3I3D A;  2HTB A;  1RWF A;  3J7H A;  2E22 A;  1CB8 A;  1JZ3 A;  4BZH A;  3T0B A;  3WFA A;  3IAP A;  1EGU A;  2WVY A;  1OJP A;  3MV1 1;  3OS7 A;  1JZ5 A; 
#chains in the Genus database with same CATH topology
 1I8Q A;  1DP0 A;  4EV5 A;  1N7Q A;  2CWV A;  1NS7 A;  3VD4 A;  1AVK A;  1PX4 A;  3HIG A;  2OOV C;  3NJV A;  3X3X A;  3CZS A;  2W0Q A;  3BVW A;  2XSG A;  1SPU A;  1WMP A;  3BUQ A;  3MUZ 1;  4DUW A;  1K1Y A;  3VDC A;  1X1I A;  3EJT A;  3OB8 A;  2OOV A;  3DX3 A;  2CWU A;  3EJP A;  3A24 A;  3IMH A;  3RRS A;  2WO0 A;  1H54 A;  3AMO A;  4K35 A;  1JZ8 A;  1JZ6 A;  4FNT A;  3W7T A;  1IVU A;  4MMI A;  1OJN A;  1NS4 A;  3D4Y A;  2X03 A;  3VSN A;  5JMF A;  1X1H A;  1NS8 A;  3ALA A;  3BUI A;  1NSU A;  1YQ2 A;  2CIR A;  1IVX A;  1L7K A;  3DDF A;  1JOV A;  1F4A A;  1SII A;  1HN0 A;  3SEP A;  3T2O A;  1N7P A;  1UI7 A;  2OW7 A;  2CFD A;  3WIR A;  1DYU A;  1RWH A;  2ZQ0 A;  3NBJ A;  1R33 A;  3E1F 1;  3DX4 A;  3MWX A;  3D4Z A;  2JKE A;  4FNP A;  3DEC A;  1JYV A;  3T2Q A;  2ZXQ A;  5GW7 A;  4RNL A;  1AVL A;  2CG0 A;  1MMU A;  2EAD A;  3KII A;  1RWF A;  3BUB A;  1QAL A;  2E22 A;  2C10 A;  3K5T A;  1W6G A;  2F7O A;  2PNC A;  3MV1 1;  2F7P A;  1UI8 A;  1JZ5 A;  3QFZ A;  1IVW A;  1NSV A;  2FYV A;  3I3E A;  1N7N A;  2CG1 A;  2CWT A;  1W2Z A;  2F7Q A;  3BVX A;  3X40 A;  4J5T A;  1W4N A;  3W7X A;  4OK2 A;  4NEI A;  4OJZ A;  1NKG A;  2WYI A;  3AFL A;  1RJO A;  2YFO A;  3LVT A;  1NSR A;  4KTP A;  4FNQ A;  1NSX A;  1HTY A;  3X3Z A;  3A0O A;  3CZJ A;  1LOH A;  3NRE A;  1MN0 A;  2WZS A;  3PGB A;  2FUT A;  1QWU A;  3D52 A;  1RW9 A;  4UFC A;  1LUR A;  3MV0 1;  3HI7 A;  1NS0 A;  2CFG A;  2YFN A;  1N9E A;  1LXM A;  1JZ7 A;  1NSZ A;  3X3Y A;  3MPH A;  3ACS A;  5E1Q A;  2WOF A;  4FNV A;  1TU5 A;  1TQV A;  1QX1 A;  3WA3 A;  1US1 A;  2WW1 A;  3IAQ A;  3T0A A;  1C82 A;  3S4A A;  3ACT A;  4KFF A;  2ZL8 A;  1HN1 A;  2XN1 A;  1V7V A;  2CFL A;  2F1B A;  4BTY A;  2FUQ A;  1SNZ A;  3QFY A;  3EJU A;  3T08 A;  2BRV X;  5JMD A;  4KFD A;  2ALW A;  1QAF A;  1NSM A;  1D6Z A;  3RSY A;  3J7H A;  3EJR A;  1CB8 A;  1D6Y A;  1WMN A;  2CFW A;  2EAB A;  3LOY A;  1HMU A;  3QDE A;  1F9G A;  3DX1 A;  3BVT A;  1JZ4 A;  4OK4 A;  1RWG A;  3AFJ A;  3MUY 1;  4FNR A;  4TTG A;  3NJX A;  1HMW A;  2CIS A;  5A1A A;  3W7W A;  2WW3 A;  3VD5 A;  1L7J A;  2WW2 A;  2F7R A;  3BGA A;  2XHN A;  2D1W A;  2CQS A;  1MMY A;  2WVX B;  2WW0 A;  4DUV A;  3T0D A;  2WOH A;  3ECQ A;  3DX2 A;  3NBB A;  1TXK A;  1WMO A;  1JYN A;  1IQY A;  3W7U A;  1TQU A;  1N7R A;  3CZN A;  3EJQ A;  1EKM A;  1O7D D;  3HII A;  1IVV A;  1W3Y A;  1JYX A;  1IU7 A;  1F1S A;  3QG0 A;  1K1W A;  2CQT A;  1OJO A;  3BLB A;  3E7J A;  2EAE A;  2WVZ A;  1NSS A;  3DYP A;  1W5Z A;  1A2V A;  2OQE C;  2WVX A;  3EJS A;  3VD9 A;  3T09 A;  3X41 A;  1LF6 A;  1W6C A;  4BTX A;  2OW6 A;  4MMH A;  5CA3 A;  3T0U A;  4FNS A;  1JZ2 A;  1JRQ A;  2E2T A;  3WVF A;  2C11 A;  1KSI A;  3D51 A;  1V7X A;  2WYH A;  1QWN A;  4BZF A;  1X1J A;  3VDB A;  1PS3 A;  3WA2 X;  1YGA A;  2BT3 A;  2CFK A;  3TY1 A;  2WCO A;  1F4H A;  2HTB A;  1TQW A;  3WIQ A;  4BZH A;  1RKY A;  3WFA A;  3X42 A;  1QAK A;  3OS7 A;  2F1A A;  2Q1F A;  3SX1 A;  1SO0 A;  3MI6 A;  3DYM A;  3I3B A;  2RDY A;  2BRP A;  2E2U A;  1MMZ A;  4BZE A;  2JKP A;  2D73 A;  4FNU A;  1HM2 A;  5KBP A;  1HM3 A;  3DX0 A;  3VD3 A;  1HXK A;  3Q1N A;  4DUX A;  3N9H A;  2XN0 A;  3SXX A;  1JYW A;  2Y73 A;  3BVV A;  2EAC A;  1RWC A;  2E24 A;  3T2P A;  2CIQ A;  3KN4 A;  3S4C A;  1MMX A;  2E2V A;  3DCD A;  1N7O A;  2WDA A;  1NS2 A;  3BVU A;  3S4B A;  3VSM A;  2WGQ A;  1TQS A;  1V7W A;  3W7S A;  1R34 A;  3D50 A;  2BRW A;  1LVN A;  4EV2 A;  3OBA A;  1LXK A;  3DYO A;  1K1X A;  3BS6 A;  1AV4 A;  3BUD A;  1D6U A;  2YX9 A;  4AQ0 A;  1SIH A;  4KTR A;  3E80 A;  1J0N A;  1LF9 A;  1ULV A;  2JKA A;  1IQX A;  1PU4 A;  1OJM A;  1UG9 A;  1TQT A;  1RWA A;  3D3I A;  3VD7 A;  2XN2 A;  3VDA A;  3DDG A;  1PX3 A;  1HWW A;  4BZG A;  3BLC A;  4K3A A;  1J0M A;  1W7C A;  4BTW A;  2F18 A;  3BUP A;  1Z45 A;  3CV5 A;  2HTA A;  3K25 A;  3I3D A;  2OQE A;  3S4D A;  1JZ3 A;  3T0B A;  3IAP A;  1EGU A;  2WVY A;  1OJP A;  4KFE A;  3AMO B;  2Y74 A;  1OAC A; 
#chains in the Genus database with same CATH homology
 1HMU A;  1I8Q A;  2Q1F A;  1DP0 A;  1F9G A;  1NSV A;  3I3E A;  1SO0 A;  1N7N A;  1N7Q A;  1NS7 A;  3DYM A;  3VD4 A;  3I3B A;  1JZ4 A;  2BRP A;  1MMZ A;  1PX4 A;  1RWG A;  4OK4 A;  4BZE A;  2JKP A;  2D73 A;  3MUY 1;  3NJV A;  4J5T A;  4TTG A;  4OK2 A;  1HM2 A;  4NEI A;  3NJX A;  4OJZ A;  1HMW A;  1HM3 A;  1NKG A;  2XSG A;  3VD3 A;  3MUZ 1;  4DUW A;  3Q1N A;  1K1Y A;  2CIS A;  3VDC A;  4DUX A;  1X1I A;  3AFL A;  5A1A A;  2WW3 A;  3OB8 A;  3VD5 A;  1NSR A;  1L7J A;  1JYW A;  2WW2 A;  3A24 A;  3IMH A;  1NSX A;  3BGA A;  3A0O A;  2XHN A;  3CZJ A;  1JZ8 A;  1LOH A;  1MMY A;  1JZ6 A;  3NRE A;  2WVX B;  1MN0 A;  1RWC A;  2WW0 A;  4DUV A;  3T0D A;  2E24 A;  2WZS A;  3ECQ A;  3T2P A;  2FUT A;  2CIQ A;  1TXK A;  1JYN A;  1RW9 A;  1MMX A;  3DCD A;  1N7R A;  1N7O A;  4MMI A;  1OJN A;  2WDA A;  1NS4 A;  1LUR A;  1NS2 A;  2X03 A;  3VSM A;  3MV0 1;  1W3Y A;  1JYX A;  3VSN A;  1F1S A;  1NS0 A;  5JMF A;  1X1H A;  1NS8 A;  1K1W A;  1OJO A;  3E7J A;  1NSU A;  1YQ2 A;  1LXM A;  2BRW A;  2CIR A;  2WVZ A;  1JZ7 A;  1L7K A;  1NSZ A;  1NSS A;  3DYP A;  3OBA A;  1LXK A;  5E1Q A;  4FNV A;  1JOV A;  1F4A A;  3DYO A;  1K1X A;  2WVX A;  3BS6 A;  1HN0 A;  3SEP A;  3T2O A;  1N7P A;  3VD9 A;  2WW1 A;  4AQ0 A;  3IAQ A;  3T09 A;  1LF6 A;  3T0A A;  1C82 A;  3E80 A;  1J0N A;  1RWH A;  2ZQ0 A;  4MMH A;  1LF9 A;  1ULV A;  2JKA A;  3E1F 1;  1OJM A;  1UG9 A;  3VD7 A;  1RWA A;  3MWX A;  1JZ2 A;  3VDA A;  1HN1 A;  2JKE A;  1PX3 A;  3DEC A;  4BZG A;  3BLC A;  1JYV A;  3WVF A;  2FUQ A;  1SNZ A;  3T2Q A;  1J0M A;  2ZXQ A;  3T08 A;  2BRV X;  4RNL A;  4BZF A;  1Z45 A;  1X1J A;  5JMD A;  3VDB A;  1MMU A;  1YGA A;  3TY1 A;  2HTA A;  2WCO A;  1F4H A;  1NSM A;  3K25 A;  3I3D A;  2HTB A;  1RWF A;  3J7H A;  2E22 A;  1CB8 A;  1JZ3 A;  4BZH A;  3T0B A;  3WFA A;  3IAP A;  1EGU A;  2WVY A;  1OJP A;  3MV1 1;  3OS7 A;  1JZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...