3BLCA

Crystal structure of the periplasmic domain of the escherichia coli yidc
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
290
structure length
280
Chain Sequence
QGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLTFRGAAYSTPDAAYAAYAFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLLVPRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone,protein transport
molecule keywords Inner membrane protein oxaA
publication title Crystal Structure of the Major Periplasmic Domain of the Bacterial Membrane Protein Assembly Facilitator YidC.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 56
structure length 280
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.90 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3blcA00
3BS6A 3WVFA 3BLCA
chains in the Genus database with same CATH superfamily
1K1YA 3DX4A 1K1WA 3MI6A 3MUZ1 2WDAA 3VDAA 1W6CA 2Y73A 1TQTA 2CWTA 1OACA 2CQSA 5KBPA 1KSIA 3S4CA 3A24A 4K3AA 2CG0A 1NS0A 1RWAA 2WVYA 1JZ3A 1RWFA 2EABA 3X3YA 3DCDA 3VD7A 1TQWA 1LXMA 1RWGA 1IVXA 1OJOA 2F7PA 1OJMA 3T0DA 2E22A 1LURA 1PS3A 1HXKA 1HN0A 2OOVA 2JKAA 3ALAA 3SEPA 1YQ2A 3WA2X 1AVKA 1LOHA 2BRVX 2HTAA 1TQSA 2E24A 3BVVA 1N7OA 4FNSA 2CISA 3SX1A 2CFKA 3MUY1 3W7XA 2F1AA 1HMWA 1N9EA 3E80A 3BVXA 2ALWA 3X42A 1LF9A 2WVXA 3MV01 3T2OA 3W7UA 1UI8A 2CFGA 1J0MA 1JYNA 3VSNA 3BGAA 1V7XA 1NKGA 3J7HA 3TY1A 2XSGA 2OQEC 1IVUA 3T0UA 1WMNA 2YFNA 3I3DA 3W7TA 1QWNA 2CWUA 4RNLA 1SNZA 3LOYA 2BRPA 3AMOA 1MMUA 1EGUA 2E2UA 1NS7A 2XN1A 2E2VA 1IQXA 1DP0A 1MN0A 3D3IA 1NSSA 1LXKA 1NS2A 4KTPA 1UG9A 2WW3A 1K1XA 2XHNA 3BUIA 3DDGA 4FNQA 2WYIA 3X40A 3RRSA 2WW2A 4BZHA 2CG1A 3ECQA 2F7QA 1LVNA 4OK2A 1HWWA 2JKPA 3DX3A 4DUVA 1SIHA 3PGBA 3I3EA 3I3BA 4NEIA 1H54A 1TQUA 3BLBA 1W3YA 3DX2A 2BRWA 1IU7A 1TXKA 3NREA 3BUQA 3WVFA 1SIIA 3VSMA 1L7KA 3D52A 3BUPA 3DX0A 3W7WA 3BVTA 3OS7A 3AMOB 2E2TA 2D73A 1PX3A 3QFYA 1X1IA 1SO0A 3AFLA 3DYPA 1IQYA 3CZSA 3T08A 1F9GA 2WVZA 5JMDA 4FNUA 1D6UA 3S4AA 1AV4A 3T2PA 4OJZA 4EV2A 4KFEA 3E1F1 1IVWA 4BTWA 1NS8A 1RWHA 1R34A 3X3XA 4KFFA 1W5ZA 1O7DD 2ZL8A 3BUDA 2F1BA 3DYOA 3KN4A 3OBAA 4FNTA 3VD5A 3BVWA 3IMHA 3VD3A 1QWUA 2YFOA 1NS4A 2CFDA 3D50A 1HN1A 4KTRA 1HM2A 3BS6A 1EKMA 1N7PA 3QFZA 2CIQA 3WA3A 1W4NA 3N9HA 1JYWA 1Z45A 1V7VA 1QX1A 1NSZA 2EACA 2ZXQA 3W7SA 3T0AA 4TTGA 4K35A 1HMUA 3NJVA 1F4HA 2X03A 3KIIA 4KFDA 1D6ZA 2OOVC 1OJNA 3EJUA 3OB8A 1HM3A 1A2VA 1QAFA 3MPHA 2WOHA 1NSRA 3HIIA 4DUXA 2CQTA 3ACSA 2FUQA 4BTXA 3Q1NA 3EJTA 1W6GA 2WGQA 2ZQ0A 1TQVA 3X3ZA 1L7JA 1RJOA 3LVTA 4BTYA 1F4AA 5CA3A 1MMZA 2OW6A 1DYUA 3X41A 1QAKA 3EJQA 2F7OA 3CZJA 3IAQA 2Y74A 2EADA 5A1AA 3T2QA 3D4YA 1JZ5A 1UI7A 2FUTA 3CZNA 5GW7A 4OK4A 3DECA 3SXXA 2C11A 3WIRA 5E1QA 1WMOA 1SPUA 1MMYA 1ULVA 4BZGA 1NSVA 1JZ7A 4AQ0A 2WYHA 4BZFA 3DYMA 3EJRA 2WZSA 1JRQA 2F7RA 2OQEA 3NJXA 2HTBA 2C10A 3A0OA 1X1HA 2WW0A 3QG0A 3DDFA 1YGAA 3D51A 2FYVA 1NSMA 2PNCA 3BUBA 3T0BA 3WIQA 3E7JA 3EJPA 1F1SA 3NBBA 1J0NA 2WW1A 1RKYA 1JOVA 2WO0A 3IAPA 3MWXA 3CV5A 3K25A 2XN2A 2CWVA 2WCOA 1V7WA 2D1WA 4UFCA 1JZ2A 1RWCA 3BLCA 2CFLA 1WMPA 3DX1A 4EV5A 1QALA 1JYVA 1PU4A 1MMXA 5JMFA 3WFAA 2WOFA 1N7RA 3ACTA 3K5TA 3MV11 1JZ4A 3BVUA 1JZ8A 4MMHA 3S4DA 1D6YA 1US1A 3QDEA 1LF6A 1CB8A 3VD9A 1PX4A 1R33A 1W7CA 4FNVA 1RW9A 1IVVA 2OW7A 1N7QA 1C82A 3NBJA 4BZEA 3HIGA 4J5TA 4DUWA 3VDCA 2CFWA 1NSUA 1TU5A 2YX9A 3S4BA 2RDYA 4FNRA 4MMIA 2F18A 2XN0A 1N7NA 1I8QA 1JYXA 2W0QA 2WVXB 1OJPA 1AVLA 2Q1FA 2EAEA 3HI7A 3EJSA 3VD4A 1HTYA 1NSXA 2JKEA 1JZ6A 1W2ZA 3VDBA 2CIRA 1X1JA 3RSYA 2BT3A 4FNPA 3D4ZA 3T09A 3AFJA
chains in the Genus database with same CATH topology
1K1YA 1HN1A 4RNLA 3NJXA 2HTBA 1HM2A 1SNZA 2BRPA 1K1WA 3A0OA 3BS6A 1X1HA 2WW0A 3MUZ1 1YGAA 1N7PA 2WDAA 2CIQA 3VDAA 1MMUA 1EGUA 1NS7A 1NSMA 1JYWA 1DP0A 3T0BA 1MN0A 1Z45A 1NSSA 1LXKA 1NS2A 3A24A 1UG9A 2WW3A 3E7JA 1NSZA 2ZXQA 1NS0A 1K1XA 2XHNA 3T0AA 1F1SA 4TTGA 1J0NA 1HMUA 2WW1A 3NJVA 1JOVA 1RWAA 2WVYA 2WW2A 3IAPA 3MWXA 1RWFA 4BZHA 1JZ3A 3DCDA 1F4HA 3ECQA 3K25A 3VD7A 2X03A 1LXMA 1RWGA 2WCOA 4OK2A 2JKPA 1OJNA 4DUVA 1JZ2A 3OB8A 1RWCA 3BLCA 3I3EA 1HM3A 3I3BA 4NEIA 1OJOA 1JYVA 1W3YA 4DUXA 1NSRA 1OJMA 3T0DA 2E22A 1MMXA 1LURA 2BRWA 5JMFA 1TXKA 3WFAA 1HN0A 2FUQA 2JKAA 3Q1NA 3NREA 1N7RA 3SEPA 3WVFA 3VSMA 1L7KA 2ZQ0A 1YQ2A 3MV11 1JZ4A 1LOHA 2BRVX 2HTAA 1L7JA 2E24A 3OS7A 1JZ8A 1F4AA 4MMHA 1N7OA 2D73A 1PX3A 2CISA 1X1IA 3MUY1 1SO0A 1MMZA 1HMWA 1LF6A 1CB8A 3E80A 3VD9A 1PX4A 3AFLA 4FNVA 1LF9A 1RW9A 2WVXA 1N7QA 1C82A 3DYPA 3MV01 3T2OA 3T08A 1F9GA 3CZJA 4BZEA 1J0MA 4J5TA 3VDCA 3VSNA 2WVZA 3IAQA 4DUWA 1JYNA 5JMDA 1NSUA 3BGAA 3T2PA 5A1AA 4OJZA 3E1F1 3T2QA 1NKGA 3J7HA 4MMIA 3TY1A 1NS8A 1JZ5A 1RWHA 1N7NA 1I8QA 1JYXA 2FUTA 2WVXB 2XSGA 1OJPA 2WZSA 4OK4A 3DECA 2Q1FA 3DYOA 3OBAA 3VD5A 5E1QA 3VD3A 3IMHA 3VD4A 1NSXA 2JKEA 1JZ6A 1MMYA 1ULVA 4BZGA 1NSVA 1JZ7A 4AQ0A 3VDBA 2CIRA 4BZFA 1X1JA 3DYMA 1NS4A 3I3DA 3T09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS6 A;  3WVF A;  3BLC A; 
#chains in the Genus database with same CATH topology
 1K1Y A;  3DX4 A;  1K1W A;  3MI6 A;  3MUZ 1;  2WDA A;  3VDA A;  1W6C A;  2Y73 A;  1TQT A;  2CWT A;  1OAC A;  2CQS A;  5KBP A;  1KSI A;  3S4C A;  3A24 A;  4K3A A;  2CG0 A;  1NS0 A;  1RWA A;  2WVY A;  1JZ3 A;  1RWF A;  2EAB A;  3X3Y A;  3DCD A;  3VD7 A;  1TQW A;  1LXM A;  1RWG A;  1IVX A;  1OJO A;  2F7P A;  1OJM A;  3T0D A;  2E22 A;  1LUR A;  1PS3 A;  1HXK A;  1HN0 A;  2OOV A;  2JKA A;  3ALA A;  3SEP A;  1YQ2 A;  3WA2 X;  1AVK A;  1LOH A;  2BRV X;  2HTA A;  1TQS A;  2E24 A;  3BVV A;  1N7O A;  4FNS A;  2CIS A;  3SX1 A;  2CFK A;  3MUY 1;  3W7X A;  2F1A A;  1HMW A;  1N9E A;  3E80 A;  3BVX A;  2ALW A;  3X42 A;  1LF9 A;  2WVX A;  3MV0 1;  3T2O A;  3W7U A;  1UI8 A;  2CFG A;  1J0M A;  1JYN A;  3VSN A;  3BGA A;  1V7X A;  1NKG A;  3J7H A;  3TY1 A;  2XSG A;  2OQE C;  1IVU A;  3T0U A;  1WMN A;  2YFN A;  3I3D A;  3W7T A;  1QWN A;  2CWU A;  4RNL A;  1SNZ A;  3LOY A;  2BRP A;  3AMO A;  1MMU A;  1EGU A;  2E2U A;  1NS7 A;  2XN1 A;  2E2V A;  1IQX A;  1DP0 A;  1MN0 A;  3D3I A;  1NSS A;  1LXK A;  1NS2 A;  4KTP A;  1UG9 A;  2WW3 A;  1K1X A;  2XHN A;  3BUI A;  3DDG A;  4FNQ A;  2WYI A;  3X40 A;  3RRS A;  2WW2 A;  4BZH A;  2CG1 A;  3ECQ A;  2F7Q A;  1LVN A;  4OK2 A;  1HWW A;  2JKP A;  3DX3 A;  4DUV A;  1SIH A;  3PGB A;  3I3E A;  3I3B A;  4NEI A;  1H54 A;  1TQU A;  3BLB A;  1W3Y A;  3DX2 A;  2BRW A;  1IU7 A;  1TXK A;  3NRE A;  3BUQ A;  3WVF A;  1SII A;  3VSM A;  1L7K A;  3D52 A;  3BUP A;  3DX0 A;  3W7W A;  3BVT A;  3OS7 A;  3AMO B;  2E2T A;  2D73 A;  1PX3 A;  3QFY A;  1X1I A;  1SO0 A;  3AFL A;  3DYP A;  1IQY A;  3CZS A;  3T08 A;  1F9G A;  2WVZ A;  5JMD A;  4FNU A;  1D6U A;  3S4A A;  1AV4 A;  3T2P A;  4OJZ A;  4EV2 A;  4KFE A;  3E1F 1;  1IVW A;  4BTW A;  1NS8 A;  1RWH A;  1R34 A;  3X3X A;  4KFF A;  1W5Z A;  1O7D D;  2ZL8 A;  3BUD A;  2F1B A;  3DYO A;  3KN4 A;  3OBA A;  4FNT A;  3VD5 A;  3BVW A;  3IMH A;  3VD3 A;  1QWU A;  2YFO A;  1NS4 A;  2CFD A;  3D50 A;  1HN1 A;  4KTR A;  1HM2 A;  3BS6 A;  1EKM A;  1N7P A;  3QFZ A;  2CIQ A;  3WA3 A;  1W4N A;  3N9H A;  1JYW A;  1Z45 A;  1V7V A;  1QX1 A;  1NSZ A;  2EAC A;  2ZXQ A;  3W7S A;  3T0A A;  4TTG A;  4K35 A;  1HMU A;  3NJV A;  1F4H A;  2X03 A;  3KII A;  4KFD A;  1D6Z A;  2OOV C;  1OJN A;  3EJU A;  3OB8 A;  1HM3 A;  1A2V A;  1QAF A;  3MPH A;  2WOH A;  1NSR A;  3HII A;  4DUX A;  2CQT A;  3ACS A;  2FUQ A;  4BTX A;  3Q1N A;  3EJT A;  1W6G A;  2WGQ A;  2ZQ0 A;  1TQV A;  3X3Z A;  1L7J A;  1RJO A;  3LVT A;  4BTY A;  1F4A A;  5CA3 A;  1MMZ A;  2OW6 A;  1DYU A;  3X41 A;  1QAK A;  3EJQ A;  2F7O A;  3CZJ A;  3IAQ A;  2Y74 A;  2EAD A;  5A1A A;  3T2Q A;  3D4Y A;  1JZ5 A;  1UI7 A;  2FUT A;  3CZN A;  5GW7 A;  4OK4 A;  3DEC A;  3SXX A;  2C11 A;  3WIR A;  5E1Q A;  1WMO A;  1SPU A;  1MMY A;  1ULV A;  4BZG A;  1NSV A;  1JZ7 A;  4AQ0 A;  2WYH A;  4BZF A;  3DYM A;  3EJR A;  2WZS A;  1JRQ A;  2F7R A;  2OQE A;  3NJX A;  2HTB A;  2C10 A;  3A0O A;  1X1H A;  2WW0 A;  3QG0 A;  3DDF A;  1YGA A;  3D51 A;  2FYV A;  1NSM A;  2PNC A;  3BUB A;  3T0B A;  3WIQ A;  3E7J A;  3EJP A;  1F1S A;  3NBB A;  1J0N A;  2WW1 A;  1RKY A;  1JOV A;  2WO0 A;  3IAP A;  3MWX A;  3CV5 A;  3K25 A;  2XN2 A;  2CWV A;  2WCO A;  1V7W A;  2D1W A;  4UFC A;  1JZ2 A;  1RWC A;  3BLC A;  2CFL A;  1WMP A;  3DX1 A;  4EV5 A;  1QAL A;  1JYV A;  1PU4 A;  1MMX A;  5JMF A;  3WFA A;  2WOF A;  1N7R A;  3ACT A;  3K5T A;  3MV1 1;  1JZ4 A;  3BVU A;  1JZ8 A;  4MMH A;  3S4D A;  1D6Y A;  1US1 A;  3QDE A;  1LF6 A;  1CB8 A;  3VD9 A;  1PX4 A;  1R33 A;  1W7C A;  4FNV A;  1RW9 A;  1IVV A;  2OW7 A;  1N7Q A;  1C82 A;  3NBJ A;  4BZE A;  3HIG A;  4J5T A;  4DUW A;  3VDC A;  2CFW A;  1NSU A;  1TU5 A;  2YX9 A;  3S4B A;  2RDY A;  4FNR A;  4MMI A;  2F18 A;  2XN0 A;  1N7N A;  1I8Q A;  1JYX A;  2W0Q A;  2WVX B;  1OJP A;  1AVL A;  2Q1F A;  2EAE A;  3HI7 A;  3EJS A;  3VD4 A;  1HTY A;  1NSX A;  2JKE A;  1JZ6 A;  1W2Z A;  3VDB A;  2CIR A;  1X1J A;  3RSY A;  2BT3 A;  4FNP A;  3D4Z A;  3T09 A;  3AFJ A; 
#chains in the Genus database with same CATH homology
 1K1Y A;  1HN1 A;  4RNL A;  3NJX A;  2HTB A;  1HM2 A;  1SNZ A;  2BRP A;  1K1W A;  3A0O A;  3BS6 A;  1X1H A;  2WW0 A;  3MUZ 1;  1YGA A;  1N7P A;  2WDA A;  2CIQ A;  3VDA A;  1MMU A;  1EGU A;  1NS7 A;  1NSM A;  1JYW A;  1DP0 A;  3T0B A;  1MN0 A;  1Z45 A;  1NSS A;  1LXK A;  1NS2 A;  3A24 A;  1UG9 A;  2WW3 A;  3E7J A;  1NSZ A;  2ZXQ A;  1NS0 A;  1K1X A;  2XHN A;  3T0A A;  1F1S A;  4TTG A;  1J0N A;  1HMU A;  2WW1 A;  3NJV A;  1JOV A;  1RWA A;  2WVY A;  2WW2 A;  3IAP A;  3MWX A;  1RWF A;  4BZH A;  1JZ3 A;  3DCD A;  1F4H A;  3ECQ A;  3K25 A;  3VD7 A;  2X03 A;  1LXM A;  1RWG A;  2WCO A;  4OK2 A;  2JKP A;  1OJN A;  4DUV A;  1JZ2 A;  3OB8 A;  1RWC A;  3BLC A;  3I3E A;  1HM3 A;  3I3B A;  4NEI A;  1OJO A;  1JYV A;  1W3Y A;  4DUX A;  1NSR A;  1OJM A;  3T0D A;  2E22 A;  1MMX A;  1LUR A;  2BRW A;  5JMF A;  1TXK A;  3WFA A;  1HN0 A;  2FUQ A;  2JKA A;  3Q1N A;  3NRE A;  1N7R A;  3SEP A;  3WVF A;  3VSM A;  1L7K A;  2ZQ0 A;  1YQ2 A;  3MV1 1;  1JZ4 A;  1LOH A;  2BRV X;  2HTA A;  1L7J A;  2E24 A;  3OS7 A;  1JZ8 A;  1F4A A;  4MMH A;  1N7O A;  2D73 A;  1PX3 A;  2CIS A;  1X1I A;  3MUY 1;  1SO0 A;  1MMZ A;  1HMW A;  1LF6 A;  1CB8 A;  3E80 A;  3VD9 A;  1PX4 A;  3AFL A;  4FNV A;  1LF9 A;  1RW9 A;  2WVX A;  1N7Q A;  1C82 A;  3DYP A;  3MV0 1;  3T2O A;  3T08 A;  1F9G A;  3CZJ A;  4BZE A;  1J0M A;  4J5T A;  3VDC A;  3VSN A;  2WVZ A;  3IAQ A;  4DUW A;  1JYN A;  5JMD A;  1NSU A;  3BGA A;  3T2P A;  5A1A A;  4OJZ A;  3E1F 1;  3T2Q A;  1NKG A;  3J7H A;  4MMI A;  3TY1 A;  1NS8 A;  1JZ5 A;  1RWH A;  1N7N A;  1I8Q A;  1JYX A;  2FUT A;  2WVX B;  2XSG A;  1OJP A;  2WZS A;  4OK4 A;  3DEC A;  2Q1F A;  3DYO A;  3OBA A;  3VD5 A;  5E1Q A;  3VD3 A;  3IMH A;  3VD4 A;  1NSX A;  2JKE A;  1JZ6 A;  1MMY A;  1ULV A;  4BZG A;  1NSV A;  1JZ7 A;  4AQ0 A;  3VDB A;  2CIR A;  4BZF A;  1X1J A;  3DYM A;  1NS4 A;  3I3D A;  3T09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...