3BLCA

Crystal structure of the periplasmic domain of the escherichia coli yidc
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
290
structure length
280
Chain Sequence
QGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLTFRGAAYSTPDAAYAAYAFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLLVPRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inner membrane protein oxaA
publication title Crystal Structure of the Major Periplasmic Domain of the Bacterial Membrane Protein Assembly Facilitator YidC.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone,protein transport
total genus 56
structure length 280
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.90 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3blcA00
3BLCA 3BS6A 3WVFA
chains in the Genus database with same CATH superfamily
2JKAA 2JKPA 3OB8A 3BUIA 3VDAA 1W2ZA 3VD5A 1JZ4A 3WIQA 1RWCA 2CQSA 3DX4A 3D52A 2CISA 2CWTA 3RSYA 2OW6A 1RW9A 2WO0A 3ECQA 2WW0A 5KBPA 3D4YA 3BLBA 2EADA 3BVVA 1N9EA 2OQEC 2E2UA 3E7JA 3EJSA 1RWHA 2WVXB 2F7PA 3D4ZA 3E80A 3VDCA 3A0OA 3D51A 4KFFA 3T2QA 1RKYA 2WVYA 3Q1NA 2PNCA 1OJMA 1OJNA 2XN2A 1JRQA 4FNTA 4K35A 3K5TA 1US1A 1TQTA 1NSVA 1UI7A 3J7HA 1HN1A 1NSXA 1K1XA 1AVKA 2C11A 3WFAA 1WMNA 1C82A 3QFZA 2XN0A 1KSIA 1W6CA 2WOFA 1LF9A 1PX4A 3W7XA 2E22A 3BUBA 3KN4A 1HM3A 2BT3A 2WGQA 1LVNA 3LOYA 3BUQA 3NBBA 1QX1A 3DYPA 3VD4A 3NBJA 2CG0A 3TY1A 3VDBA 2D73A 3I3BA 1NSSA 3T0DA 2F18A 1TQUA 1JYXA 5E1QA 4AQ0A 1V7XA 4DUXA 2WZSA 3EJRA 5CA3A 1N7RA 1PU4A 3X3YA 4FNUA 3OBAA 2CFGA 1EGUA 1LOHA 4BTXA 3EJQA 3DDFA 3X40A 1K1WA 1UG9A 1EKMA 1JOVA 1PS3A 4BZHA 2WYHA 1YGAA 2YX9A 1OACA 4EV5A 1W4NA 3BVWA 2OW7A 1OJPA 1SO0A 4FNSA 1MN0A 2CQTA 4BTYA 3MUY1 4K3AA 2HTAA 1IVVA 1JZ7A 1J0NA 3AMOB 2CWVA 1OJOA 2WCOA 3T0BA 1DYUA 3WA3A 3X3XA 4KFDA 1QAFA 3ALAA 3ACSA 4FNVA 1MMYA 3VD3A 3N9HA 3DX2A 1SPUA 1SNZA 3S4AA 3KIIA 2F1BA 4OJZA 2X03A 2WVXA 3DCDA 3X42A 1X1IA 3X3ZA 3W7SA 4DUVA 1N7OA 1K1YA 1HXKA 3SX1A 3D50A 3W7TA 2CIQA 1J0MA 3MUZ1 3DX1A 1CB8A 4BZEA 3W7UA 3T0UA 2CIRA 2XN1A 1IQYA 4BZGA 1W5ZA 3QFYA 1MMZA 2ZXQA 2E2VA 3HI7A 1IQXA 2XHNA 1RWFA 1L7JA 1NS4A 2YFOA 2WW1A 1MMUA 1NSZA 2WOHA 2ZL8A 4TTGA 1TQWA 3BUDA 1W7CA 4KFEA 3HIIA 1AVLA 1N7PA 3DX3A 3BVTA 1IU7A 1ULVA 3VD9A 2WDAA 1HN0A 1V7WA 3T2PA 4DUWA 4OK2A 3X41A 2FUQA 3RRSA 2E2TA 3HIGA 1MMXA 1SIIA 1IVWA 2EAEA 3SXXA 1LF6A 3I3DA 1F4HA 4FNPA 1X1HA 2XSGA 5JMDA 3T2OA 1TQVA 2E24A 4J5TA 3MPHA 3BVXA 3SEPA 1F1SA 1PX3A 1NSRA 3DYOA 3MV01 1YQ2A 2BRPA 2CFWA 2F7RA 3NREA 3DDGA 4OK4A 3WIRA 1TQSA 3MI6A 2HTBA 3AMOA 3BS6A 1W3YA 1IVXA 3EJPA 2CG1A 3NJXA 3CV5A 3S4CA 1H54A 1HM2A 1WMPA 3CZNA 1O7DD 2Y73A 1NS2A 1V7VA 4BTWA 3T09A 3I3EA 3QDEA 1NS8A 1F4AA 4UFCA 1QWNA 1SIHA 2F1AA 3S4BA 1JZ2A 3VSNA 1N7QA 1NKGA 1JZ6A 2C10A 1LXMA 2ZQ0A 1D6YA 3MWXA 4KTPA 5JMFA 1NSMA 3QG0A 3LVTA 1HMUA 4EV2A 2F7OA 2WW3A 2EABA 1RWGA 2OQEA 3NJVA 3K25A 3CZSA 2FUTA 1W6GA 1RWAA 1TXKA 2JKEA 2FYVA 4BZFA 1IVUA 1AV4A 1HWWA 2CWUA 3WVFA 3BVUA 1A2VA 3VD7A 3W7WA 1N7NA 3OS7A 2BRWA 3PGBA 1JZ5A 1X1JA 5A1AA 4MMIA 1HMWA 1F9GA 2WVZA 3AFJA 3T08A 1DP0A 1QALA 2CFLA 2OOVC 1JYWA 3DX0A 3IAPA 3MV11 2D1WA 3IAQA 2ALWA 2OOVA 2CFKA 3D3IA 1JZ3A 1QAKA 3CZJA 4FNRA 2EACA 2RDYA 1I8QA 3WA2X 4MMHA 4RNLA 1D6UA 1R34A 2YFNA 1JYVA 1LURA 1D6ZA 1NS7A 1TU5A 1R33A 3BGAA 5GW7A 1JZ8A 4NEIA 2CFDA 3E1F1 1UI8A 3AFLA 3VSMA 2Y74A 3IMHA 3EJTA 1RJOA 1WMOA 4FNQA 3T0AA 1LXKA 3BUPA 1HTYA 3EJUA 1Z45A 1NS0A 4KTRA 2Q1FA 2BRVX 3DYMA 1L7KA 2WYIA 1NSUA 1QWUA 3DECA 2WW2A 3S4DA 3A24A 3ACTA 2F7QA 1JYNA 2W0QA 3BLCA
chains in the Genus database with same CATH topology
1HMUA 1LOHA 2JKAA 2JKPA 2WW3A 3OB8A 1N7PA 1K1WA 1RWGA 3NJVA 1UG9A 3VDAA 3K25A 3VD5A 1ULVA 1JOVA 3VD9A 4BZHA 2WDAA 1HN0A 1JZ4A 3T2PA 2FUTA 1RWCA 4DUWA 4OK2A 1YGAA 1RWAA 1TXKA 2JKEA 4BZFA 2CISA 1RW9A 3ECQA 2FUQA 1OJPA 1SO0A 3WVFA 1MN0A 3VD7A 1N7NA 2WW0A 3MUY1 2HTAA 3OS7A 2BRWA 1JZ5A 1JZ7A 1X1JA 1J0NA 1MMXA 5A1AA 4MMIA 1HMWA 1F9GA 2WVZA 3E7JA 3T08A 1OJOA 1RWHA 2WVXB 3E80A 2WCOA 3T0BA 1DP0A 3VDCA 3A0OA 1LF6A 3T2QA 3I3DA 1JYWA 3IAPA 3MV11 1F4HA 2WVYA 3Q1NA 1X1HA 2XSGA 5JMDA 3IAQA 3T2OA 1OJMA 2E24A 1OJNA 1JZ3A 4J5TA 4FNVA 1MMYA 3SEPA 1F1SA 3CZJA 1PX3A 3VD3A 1I8QA 1NSRA 4MMHA 4RNLA 3DYOA 1NSVA 3J7HA 1HN1A 3MV01 1YQ2A 1JYVA 1NSXA 1LURA 1K1XA 1SNZA 2BRPA 1NS7A 3NREA 3WFAA 4OK4A 1C82A 3BGAA 1JZ8A 2HTBA 3BS6A 4NEIA 4OJZA 2X03A 2WVXA 3DCDA 1W3YA 1LF9A 1PX4A 3E1F1 1X1IA 2E22A 3VSMA 3AFLA 1HM3A 3NJXA 3IMHA 4DUVA 1N7OA 1K1YA 1HM2A 3T0AA 1LXKA 3DYPA 1NS2A 2CIQA 1J0MA 3VD4A 3MUZ1 3TY1A 3T09A 3VDBA 1CB8A 1Z45A 1NS0A 3I3EA 4BZEA 1NS8A 2CIRA 2Q1FA 1F4AA 2BRVX 3DYMA 1L7KA 4BZGA 2D73A 1NSUA 3I3BA 1MMZA 3DECA 1NSSA 2ZXQA 1JZ2A 3VSNA 1N7QA 2WW2A 3T0DA 1NKGA 1JZ6A 1LXMA 1JYXA 5E1QA 2ZQ0A 4AQ0A 3A24A 2XHNA 1RWFA 1L7JA 4DUXA 2WZSA 1NS4A 3MWXA 1N7RA 2WW1A 1MMUA 1NSZA 1JYNA 5JMFA 1NSMA 4TTGA 3BLCA 3OBAA 1EGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLC A;  3BS6 A;  3WVF A; 
#chains in the Genus database with same CATH topology
 2JKA A;  2JKP A;  3OB8 A;  3BUI A;  3VDA A;  1W2Z A;  3VD5 A;  1JZ4 A;  3WIQ A;  1RWC A;  2CQS A;  3DX4 A;  3D52 A;  2CIS A;  2CWT A;  3RSY A;  2OW6 A;  1RW9 A;  2WO0 A;  3ECQ A;  2WW0 A;  5KBP A;  3D4Y A;  3BLB A;  2EAD A;  3BVV A;  1N9E A;  2OQE C;  2E2U A;  3E7J A;  3EJS A;  1RWH A;  2WVX B;  2F7P A;  3D4Z A;  3E80 A;  3VDC A;  3A0O A;  3D51 A;  4KFF A;  3T2Q A;  1RKY A;  2WVY A;  3Q1N A;  2PNC A;  1OJM A;  1OJN A;  2XN2 A;  1JRQ A;  4FNT A;  4K35 A;  3K5T A;  1US1 A;  1TQT A;  1NSV A;  1UI7 A;  3J7H A;  1HN1 A;  1NSX A;  1K1X A;  1AVK A;  2C11 A;  3WFA A;  1WMN A;  1C82 A;  3QFZ A;  2XN0 A;  1KSI A;  1W6C A;  2WOF A;  1LF9 A;  1PX4 A;  3W7X A;  2E22 A;  3BUB A;  3KN4 A;  1HM3 A;  2BT3 A;  2WGQ A;  1LVN A;  3LOY A;  3BUQ A;  3NBB A;  1QX1 A;  3DYP A;  3VD4 A;  3NBJ A;  2CG0 A;  3TY1 A;  3VDB A;  2D73 A;  3I3B A;  1NSS A;  3T0D A;  2F18 A;  1TQU A;  1JYX A;  5E1Q A;  4AQ0 A;  1V7X A;  4DUX A;  2WZS A;  3EJR A;  5CA3 A;  1N7R A;  1PU4 A;  3X3Y A;  4FNU A;  3OBA A;  2CFG A;  1EGU A;  1LOH A;  4BTX A;  3EJQ A;  3DDF A;  3X40 A;  1K1W A;  1UG9 A;  1EKM A;  1JOV A;  1PS3 A;  4BZH A;  2WYH A;  1YGA A;  2YX9 A;  1OAC A;  4EV5 A;  1W4N A;  3BVW A;  2OW7 A;  1OJP A;  1SO0 A;  4FNS A;  1MN0 A;  2CQT A;  4BTY A;  3MUY 1;  4K3A A;  2HTA A;  1IVV A;  1JZ7 A;  1J0N A;  3AMO B;  2CWV A;  1OJO A;  2WCO A;  3T0B A;  1DYU A;  3WA3 A;  3X3X A;  4KFD A;  1QAF A;  3ALA A;  3ACS A;  4FNV A;  1MMY A;  3VD3 A;  3N9H A;  3DX2 A;  1SPU A;  1SNZ A;  3S4A A;  3KII A;  2F1B A;  4OJZ A;  2X03 A;  2WVX A;  3DCD A;  3X42 A;  1X1I A;  3X3Z A;  3W7S A;  4DUV A;  1N7O A;  1K1Y A;  1HXK A;  3SX1 A;  3D50 A;  3W7T A;  2CIQ A;  1J0M A;  3MUZ 1;  3DX1 A;  1CB8 A;  4BZE A;  3W7U A;  3T0U A;  2CIR A;  2XN1 A;  1IQY A;  4BZG A;  1W5Z A;  3QFY A;  1MMZ A;  2ZXQ A;  2E2V A;  3HI7 A;  1IQX A;  2XHN A;  1RWF A;  1L7J A;  1NS4 A;  2YFO A;  2WW1 A;  1MMU A;  1NSZ A;  2WOH A;  2ZL8 A;  4TTG A;  1TQW A;  3BUD A;  1W7C A;  4KFE A;  3HII A;  1AVL A;  1N7P A;  3DX3 A;  3BVT A;  1IU7 A;  1ULV A;  3VD9 A;  2WDA A;  1HN0 A;  1V7W A;  3T2P A;  4DUW A;  4OK2 A;  3X41 A;  2FUQ A;  3RRS A;  2E2T A;  3HIG A;  1MMX A;  1SII A;  1IVW A;  2EAE A;  3SXX A;  1LF6 A;  3I3D A;  1F4H A;  4FNP A;  1X1H A;  2XSG A;  5JMD A;  3T2O A;  1TQV A;  2E24 A;  4J5T A;  3MPH A;  3BVX A;  3SEP A;  1F1S A;  1PX3 A;  1NSR A;  3DYO A;  3MV0 1;  1YQ2 A;  2BRP A;  2CFW A;  2F7R A;  3NRE A;  3DDG A;  4OK4 A;  3WIR A;  1TQS A;  3MI6 A;  2HTB A;  3AMO A;  3BS6 A;  1W3Y A;  1IVX A;  3EJP A;  2CG1 A;  3NJX A;  3CV5 A;  3S4C A;  1H54 A;  1HM2 A;  1WMP A;  3CZN A;  1O7D D;  2Y73 A;  1NS2 A;  1V7V A;  4BTW A;  3T09 A;  3I3E A;  3QDE A;  1NS8 A;  1F4A A;  4UFC A;  1QWN A;  1SIH A;  2F1A A;  3S4B A;  1JZ2 A;  3VSN A;  1N7Q A;  1NKG A;  1JZ6 A;  2C10 A;  1LXM A;  2ZQ0 A;  1D6Y A;  3MWX A;  4KTP A;  5JMF A;  1NSM A;  3QG0 A;  3LVT A;  1HMU A;  4EV2 A;  2F7O A;  2WW3 A;  2EAB A;  1RWG A;  2OQE A;  3NJV A;  3K25 A;  3CZS A;  2FUT A;  1W6G A;  1RWA A;  1TXK A;  2JKE A;  2FYV A;  4BZF A;  1IVU A;  1AV4 A;  1HWW A;  2CWU A;  3WVF A;  3BVU A;  1A2V A;  3VD7 A;  3W7W A;  1N7N A;  3OS7 A;  2BRW A;  3PGB A;  1JZ5 A;  1X1J A;  5A1A A;  4MMI A;  1HMW A;  1F9G A;  2WVZ A;  3AFJ A;  3T08 A;  1DP0 A;  1QAL A;  2CFL A;  2OOV C;  1JYW A;  3DX0 A;  3IAP A;  3MV1 1;  2D1W A;  3IAQ A;  2ALW A;  2OOV A;  2CFK A;  3D3I A;  1JZ3 A;  1QAK A;  3CZJ A;  4FNR A;  2EAC A;  2RDY A;  1I8Q A;  3WA2 X;  4MMH A;  4RNL A;  1D6U A;  1R34 A;  2YFN A;  1JYV A;  1LUR A;  1D6Z A;  1NS7 A;  1TU5 A;  1R33 A;  3BGA A;  5GW7 A;  1JZ8 A;  4NEI A;  2CFD A;  3E1F 1;  1UI8 A;  3AFL A;  3VSM A;  2Y74 A;  3IMH A;  3EJT A;  1RJO A;  1WMO A;  4FNQ A;  3T0A A;  1LXK A;  3BUP A;  1HTY A;  3EJU A;  1Z45 A;  1NS0 A;  4KTR A;  2Q1F A;  2BRV X;  3DYM A;  1L7K A;  2WYI A;  1NSU A;  1QWU A;  3DEC A;  2WW2 A;  3S4D A;  3A24 A;  3ACT A;  2F7Q A;  1JYN A;  2W0Q A;  3BLC A; 
#chains in the Genus database with same CATH homology
 1HMU A;  1LOH A;  2JKA A;  2JKP A;  2WW3 A;  3OB8 A;  1N7P A;  1K1W A;  1RWG A;  3NJV A;  1UG9 A;  3VDA A;  3K25 A;  3VD5 A;  1ULV A;  1JOV A;  3VD9 A;  4BZH A;  2WDA A;  1HN0 A;  1JZ4 A;  3T2P A;  2FUT A;  1RWC A;  4DUW A;  4OK2 A;  1YGA A;  1RWA A;  1TXK A;  2JKE A;  4BZF A;  2CIS A;  1RW9 A;  3ECQ A;  2FUQ A;  1OJP A;  1SO0 A;  3WVF A;  1MN0 A;  3VD7 A;  1N7N A;  2WW0 A;  3MUY 1;  2HTA A;  3OS7 A;  2BRW A;  1JZ5 A;  1JZ7 A;  1X1J A;  1J0N A;  1MMX A;  5A1A A;  4MMI A;  1HMW A;  1F9G A;  2WVZ A;  3E7J A;  3T08 A;  1OJO A;  1RWH A;  2WVX B;  3E80 A;  2WCO A;  3T0B A;  1DP0 A;  3VDC A;  3A0O A;  1LF6 A;  3T2Q A;  3I3D A;  1JYW A;  3IAP A;  3MV1 1;  1F4H A;  2WVY A;  3Q1N A;  1X1H A;  2XSG A;  5JMD A;  3IAQ A;  3T2O A;  1OJM A;  2E24 A;  1OJN A;  1JZ3 A;  4J5T A;  4FNV A;  1MMY A;  3SEP A;  1F1S A;  3CZJ A;  1PX3 A;  3VD3 A;  1I8Q A;  1NSR A;  4MMH A;  4RNL A;  3DYO A;  1NSV A;  3J7H A;  1HN1 A;  3MV0 1;  1YQ2 A;  1JYV A;  1NSX A;  1LUR A;  1K1X A;  1SNZ A;  2BRP A;  1NS7 A;  3NRE A;  3WFA A;  4OK4 A;  1C82 A;  3BGA A;  1JZ8 A;  2HTB A;  3BS6 A;  4NEI A;  4OJZ A;  2X03 A;  2WVX A;  3DCD A;  1W3Y A;  1LF9 A;  1PX4 A;  3E1F 1;  1X1I A;  2E22 A;  3VSM A;  3AFL A;  1HM3 A;  3NJX A;  3IMH A;  4DUV A;  1N7O A;  1K1Y A;  1HM2 A;  3T0A A;  1LXK A;  3DYP A;  1NS2 A;  2CIQ A;  1J0M A;  3VD4 A;  3MUZ 1;  3TY1 A;  3T09 A;  3VDB A;  1CB8 A;  1Z45 A;  1NS0 A;  3I3E A;  4BZE A;  1NS8 A;  2CIR A;  2Q1F A;  1F4A A;  2BRV X;  3DYM A;  1L7K A;  4BZG A;  2D73 A;  1NSU A;  3I3B A;  1MMZ A;  3DEC A;  1NSS A;  2ZXQ A;  1JZ2 A;  3VSN A;  1N7Q A;  2WW2 A;  3T0D A;  1NKG A;  1JZ6 A;  1LXM A;  1JYX A;  5E1Q A;  2ZQ0 A;  4AQ0 A;  3A24 A;  2XHN A;  1RWF A;  1L7J A;  4DUX A;  2WZS A;  1NS4 A;  3MWX A;  1N7R A;  2WW1 A;  1MMU A;  1NSZ A;  1JYN A;  5JMF A;  1NSM A;  4TTG A;  3BLC A;  3OBA A;  1EGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...