4FNSA

Crystal structure of gh36 alpha-galactosidase agaa a355e from geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
718
structure length
718
Chain Sequence
b'KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRLPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 232
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnsA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnsA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnsA02
3BAIA 2FB3A 1TB3A 4MLJA 3VI2A 3WY2A 1HVXA 3L2LA 3M44A 3O1NA 3UXAA 3DX4A 3BVXA 2A85A 3EJPA 1YPFA 1RPKA 2CU0A 2CW6A 3W73A 1FQ0A 3A9IA 4FXRA 2CZDA 3TONA 3B04A 5E0FA 3WJSA 4UTTC 1XBYA 4O4WA 2XVKA 3CV5A 2ATMA 4KFPA 3OLEA 1OHLA 4JTFA 1W37A 3BUPA 3W2NA 1ME8A 2Y7FA 3NQ2A 4ZL1A 3BO9A 1R33A 3KOFA 5D38A 1CI1A 3GK0A 4IXXA 1YADA 1VYPX 4MKNA 3EB2A 3N2MA 2V5BA 2VEMA 3QF0A 1FCBA 4XBKA 3O8AA 3CLWA 2FGZA 1TPUA 3M43A 3IVTA 5C6MA 1JUKA 1K8YA 3VGDA 4JEQA 5D2WA 1KBBA 3M47A 4UQDA 3A47A 3NQFA 4NJIA 1MSSA 4MJMA 5K4ZA 3UCQA 3GR7A 1PIGA 3MI6A 2HSAA 5F4SA 2VELA 1AW5A 1XFBA 3PWAA 5BNKA 4JR5A 3WEOA 4JIQA 2Y85A 1LWJA 3UWYA 1WA3A 3MMTA 5CZJA 2V5LA 2C18A 3LI1A 4UFIA 1CGXA 2EO7A 5LKYA 5E0KA 5K7JA 2V2HA 3PB2A 3CHVA 4ZQRA 4OGZA 2R91A 3W2JA 3GZ3A 3S2CA 2JKAA 1GQNA 2GUUA 1W3IA 1TQSA 4PH6A 1TMHA 4TX9A 5HQEA 1FWTA 2Z6IA 1KWKA 4YCOA 1TTQA 4JTLA 3H54A 1SFJA 3P82A 2YKKA 3L5AA 4DF2A 3TC6A 1PZ2A 3SGZA 3SIZA 1LBFA 3W75A 4HT3A 1VRDA 1CW2A 4DELA 2PWDA 3OVPA 4JYEA 3QYQA 3LRLA 3W1LA 4A29A 3W1AA 1CXHA 5J5RA 2PCQA 2C6QA 2F61A 3OG3A 1D3CA 1OVDA 4HN4A 1OJXA 3RU6A 3W83A 3G1SA 4HHPA 1A53A 3BUDA 4NXKA 2V3DA 3B03A 4O0ZA 1Y0EA 5CLWA 3M9YA 3QW3A 3KLLA 3HG2A 2O7SA 1GYLA 1LOSA 1H1ZA 1Z41A 4CQ9A 3W84A 2E6AA 3TAKA 3WFZA 2BLEA 1OX6A 3BCDA 3BG5A 3C2VA 1I2OA 2G3NA 4LNYA 3PB0A 1FY6A 3W38A 2OSYA 4A3UA 4S2BA 1SZEA 1ZALA 3E9AA 4J3WA 4YLWA 4HOWA 3CQ0A 3TTSA 1PIFA 3W7RA 2O7QA 1XV8A 2NUYA 4WUIA 4JFSA 4FNUA 4IXHA 3W1XA 4XQ6A 3EDDA 5AHMA 3IJ7A 3MJYA 5AC7A 1KW1A 2X1UA 3OLIA 1BAGA 2V30A 4UFLA 4U33A 1E40A 4PCTA 3MWAA 4LPCA 1JCJA 3BG9A 4GC4A 2C15A 3FKRA 2PRLA 1F74A 1G7VA 3LLDA 3WFAA 1G9HA 1SMDA 5CZTA 1UA7A 1JD9A 1PV8A 1BEUA 4JNMA 4JTHA 1GPWA 5D2YA 3MO7A 2WVVA 2XN0A 3BPWA 2Z6JA 3PAJA 1TPWA 3LLFA 2P0OA 1LROA 4G1KA 3LPPA 4BR1A 1XD1A 1ZNNA 1EP2A 3BVJA 3VM7A 3NAVA 4LT9A 4FO4A 3TU9A 1GTEA 1I2NA 2D2OA 1O4UA 2OYLA 1EA0A 3LBMA 7TIMA 2GUYA 2H90A 1SPQA 3DFTA 3G8EA 4O1AA 2ZDRA 3PUEA 2C8NA 1VIWA 1KTBA 1G4TA 3G0SA 5F2IA 1NEYA 1PS9A 5BMXA 6TIMA 2VRKA 3N2XA 3OEXA 1G7UA 4MYXA 2DU2A 3I7QA 4Z1CA 4EIVA 4MJZA 1KFJA 4U3CA 1PHWA 1UD6A 3M5XA 4ZMGA 3DDFA 4CCEA 4AEFA 3BGJA 1SSDA 4H2CA 4UTIA 2OYMA 4J3VA 3LHTA 1GVSA 3QQ0A 5TQLA 3I6RA 3P61A 3MI2A 1OFPA 2DZXA 3DENA 3VMPA 4JICA 5CGQA 4IWWA 1JG9A 1AVAA 1KBJA 3DFNA 4LY8A 3C3NA 3HGOA 3W7DA 2X2GA 1TIMA 2HTMA 4UFHA 2C3ZA 4ZZ9A 2R8WA 3GNNA 1KBKA 1LOLA 3CTTA 3PY2A 3KRSA 3W2LA 2RDWA 3NQGA 1CXIA 4DO4A 1VLIA 4N6FA 1EB3A 1BVNP 3E12A 1HTIA 3L0KA 5HR6A 3VMNA 1UD5A 3DHUA 3WK2A 3GKAA 1C8VA 5KZDA 5K9XA 3C2OA 2Z1BA 3GBEA 1F05A 4XBSA 3HJEA 2IGTA 1NF0A 3O6DA 2D3NA 1TCMA 3IEBA 5HPOA 3TNOA 2V82A 3NR0A 3PBYA 1F2JA 5HMSA 3W7JA 5I0DA 1OGSA 3W7PA 1CGVA 1JXKA 3BGGA 3FIGA 2RFGA 3BLIA 3KHJA 1LDCA 5F1VA 3OHIA 4LV9A 4GUJA 5HWMA 3BH4A 3R8RA 1CXLA 5K2ZA 1G4SA 3B4UA 3S6DA 5DXYA 1UH3A 1TQVA 4NZFA 2ZZ5A 3B0UX 3NVTA 4ORMA 1W5NA 5HUOA 4AWSA 4FB7A 4B5NA 4JTGA 1HUVA 1FWRA 2YX0A 1K02A 1JDAA 3ZR4A 5DXXA 5CGMA 1V3LA 1LP6A 3P8IA 1I75A 3F4NA 4IMGA 4R34A 2A4AA 2YPIA 3K8KA 1YYAA 2BX7A 4AF0B 2XIIA 3EJUA 1JCMP 3L68A 2ABAA 1KM0A 5KINA 2CLKA 4M56A 3L21A 3QFEA 4O1CA 1WQ5A 1PVNA 3HGRA 1SZNA 4UUIA 3CZSA 3ZO9A 3AJXA 4O1BA 2F2HA 2WVVB 3LI0A 3FAXA 4RLIA 3LX9A 3C4UA 1ZJBA 1KWGA 1CLVA 2CHNA 1LORA 2Z0IA 2C1HA 1G1YA 3P81A 1F7BA 5LNRA 3UZ5A 2E8ZA 2CLEA 4YWIA 4O15A 4CVWA 4YMZA 3B0PA 4MY9A 5CSSA 3KXQA 3S5OA 3ZS4A 4IX2A 2WNZA 3CC1A 4HIBA 3BV4A 4H6KA 2FPVA 3RNDA 1XXXA 1DJNA 1W56A 3W2MA 2EAWA 1KB3A 1P0KA 4E38A 2A5HA 1XDLA 2X30A 1A5SA 3BLEA 3WJWA 1XL9A 2BHYA 3V75A 1B2YA 1S46A 3DHPA 1JUEA 4JS3A 3W7CA 3QM3A 3QQ1A 3UG4A 2Q8ZA 3E02A 3MP4A 1MFVA 1U2YA 2A7PA 1HL2A 3TFCA 3D4ZA 2NXIA 3ATYA 1VQTA 2QUVA 3BC9A 3RK8A 3QW4B 1QW8A 4ALDA 4BK9A 2FIQA 3CPRA 2YJQA 1KLZA 3ANYA 4LU0A 3AJ7A 1W8SA 4HKPA 1XI3A 5F2LA 1HXKA 1Q4NX 3DKJA 3FJ6A 4DPQA 3BAJA 1IXQA 1MEWA 3HO8A 4LVGA 1SZFA 5HWNA 3KVMA 2GVLA 4GQRA 4UNKA 1DV7A 3S5NA 3P7YA 4Q4KA 2BXVA 3K30A 3K8LA 1KGXA 1Q45A 3TMQA 3HJZA 1CIUA 3G1YA 2AGKA 3NO5A 1UD4A 1EO5A 4JX5A 1WBHA 3G1XA 1CXFA 3UPWA 1G67A 2VUYA 1H3GA 2ZCGA 4FHAA 2RHGA 3NA8A 2OMAA 3Q37A 4YL2A 3EWZA 3NQ6A 1QHPA 2G5WA 1N7KA 1KV5A 2ZBTA 2ALWA 5CGTA 3C6CA 1VZWA 1X1OA 5KITA 1KGWA 1S5TA 2ALDA 3CZLA 4I7UA 1IXPA 4KWVA 1U33A 1P4CA 3TW6A 2X2JA 1KGUA 4OU1A 1AL7A 4K6AA 4PA8A 3WK0A 2C0AA 3VGFA 5F4WA 3NDOA 3LB0A 3PBVA 1OG0A 4RXGA 5LNUA 1XGZA 4O52A 4K39A 5G2WA 1LRNA 2F1AA 2ZRUA 1FBAA 2WKLA 4O1DA 1OK6A 1FX6A 2FJKA 3QRHA 4OHQA 1EEPA 1JFHA 1LZOA 2VENA 1UA3A 4O17A 3W1RA 2TSYA 1P0NA 2C14A 3C2EA 3QSRA 3BVTA 3NM3A 3WDJA 5FESA 2OT1A 2NV2A 3TDFA 1D3GA 1K7EA 3VNZA 3STGA 2NSXA 4JYFA 1HFBA 4KFNA 2DP3A 1J0JA 5A6MA 3ZT7A 1HO1A 1I8JA 4NVTA 1ZAIA 2NUXA 4RJEA 1JCXA 1G94A 1ADOA 1T99A 3RFAA 4BZYA 4GFSA 3W85A 3N34A 2Y24A 4QITA 3E49A 1VYSX 5I24A 4AEEA 3GYEA 1J0HA 3BMVA 3LGEA 3L65A 1QMLA 5CZ0A 3IIZA 3CGTA 4JYDA 2ZX9A 4KWUA 1GJPA 2CLHA 5LHEA 1ZY9A 3CLMA 4GQQA 3EWYA 4PL1A 1NSJA 1EO7A 3ZQ9A 3U6WA 1B57A 1EUNA 1MO0A 3TUUA 1U30A 2GJLA 4UTLA 3LRMA 4IMFA 2WNQA 1QWGA 4UMAA 3LCIA 1QPNA 1DL3A 3QEZA 3SECA 4B9ZA 1EWDA 3MYPA 4OT7A 1MW1A 4NZJA 4LWWA 3ABOA 5DFAA 4UC5A 5EPDA 4NNAA 4P61A 4GI8A 2NXGA 2QDGA 1B0IA 2WPBA 3IJ8A 3G18A 1RZMA 4IPIA 1W5OA 1ICPA 2ZTKA 5HR7A 1K3UA 1OFQA 3DGRA 3VGGA 1LBMA 4O53A 2Q3RA 1IIGA 1R34A 2Y61A 3GXNA 3T55A 3ZWSA 1SO5A 1TTIA 4GIAA 4N4QA 2VFFA 3VE9A 3G3MA 2V2DA 2CLLA 5C55A 3DFOA 2J9YA 2JBMA 3DXIA 2WOQA 4YXGA 4WQ6A 2I1OA 3G22A 3CZNA 3SFKA 1HTYA 1KFEA 3HPZA 1VCGA 3ZT5A 1GG0A 3LCWA 2E09A 3W1MA 3W1TA 3EDJA 1JI2A 2OYKA 2E6DA 1SW3A 1VJSA 2Y88A 2DJLA 1IGSA 2JGYA 3Q2DA 5D09A 3FFSA 4QQ3A 2FH8A 1B3OA 3VCRA 3S5ZA 3S5YA 2TMDA 4XZ9A 5EYWA 3WNOA 2QAPA 2J9ZA 4BA0A 2NWSA 4XWUA 1WAUA 3N19B 4FX8A 5DBTA 3WN6A 3EWUA 3LHWA 3NQAA 3JS3A 3SZ8A 2CWNA 3O05A 3P8JA 1JAEA 1QWUA 3C2FA 4RZ5A 4O19A 1GCYA 4NT0A 3PC0A 4X9SA 1OF6A 1WOBA 1EA9C 4HNUA 5ABTA 4AIOA 5I3HA 3R12A 4GUHA 2GJNA 3PG9A 1TQJA 3RILA 1FCUA 4N9BA 4IPJA 3CPUA 3BLFA 1XH1A 5FF4A 2E0PA 3G3DA 1C29A 3K8MA 5AHIA 3G24A 4JTTA 4JL1A 3S0CA 1VFUA 1LWHA 1QPOA 3TSDA 1Q3NA 2VKZG 4OQVA 1B4EA 5IM51 1TQTA 3H53A 3RIKA 2WSPA 5DLCA 5C2XA 1WV2A 5D04C 1WBJA 1A5AA 3LCGA 1HG3A 4U2YA 5CG7A 4I7VA 1SO4A 5L9FA 4DQWA 3AO0A 3N9SA 2B7OA 3IIVA 3VSUA 4GRSA 3UG5A 5CKSA 4PFMA 4NQ1A 2E5BA 2X1SA 5TBOA 2EPHA 2YW4A 1Q6LA 4N9DA 5D2TA 3W7LA 2Y89A 4NX0A 1KCLA 3P5YA 5AFDA 4ATWA 4O28A 3TROA 1OFAA 4O13A 1K8XA 2CZEA 3A4AA 4AIEA 3L4TA 3HGSA 4LS1A 2QAFA 1JI1A 3NGJA 1T0OA 3BK0A 4ML9A 4M7TA 3S8HA 3BLBA 5LSMA 1M6JA 4N9EA 5HWJA 1OYCA 3O6YX 4RR4A 2V2CA 3UD6A 4JTIA 5I3IA 4J3SA 5AHNA 4AMAA 1TV8A 1WDWA 4PC8A 4ONVA 3TMLA 4ADSA 2QCDB 3WY1A 1CDGA 5DCDA 2ISVA 2J25A 1GVQA 5EA9A 2ZA2A 4H4IA 4GI9A 1IF2A 5LZLA 2Y2WA 4M7SA 3EDFA 2WVTA 4QM1A 4GI6A 4FX7A 5AHLA 4UR8A 3MBFA 3T4CA 4EOUA 1G69A 1N8FA 4M6QA 3HMJG 1VLWA 1QO2A 3W86A 1HL9A 2VEPA 3CWNA 3TW7A 4S1FA 2I14A 1RP9A 3B8DA 5DY3A 4GJ1A 1O60A 4PSRA 5D30A 1O5KA 4CNNA 2AAAA 4PCSA 1A50A 1W0MA 4NJHA 4FIQA 3CWOX 2QCLA 4J27A 1KFKA 3DHFA 3A24A 3W7HA 3M1ZA 4NU7A 5G1TA 4AB4A 3W22A 3IIPA 3L5MA 3B05A 3M07A 5DCEA 2OX1A 3L5LA 3MI3A 5I3JA 2F18A 1LLWA 1OYBA 3GAYA 4R33A 4UCFA 3D0CA 2C7FA 1C9DA 3I65A 3IGXA 4AMWA 1XDMA 4UXDA 4XTIA 1H7PA 2C16A 2OCZA 4WXYA 5F2MA 2GVYA 2YGYA 3LCHA 3O06A 1JCLA 1VH7A 1CGWA 1ZJIA 4B9YA 2PWFA 1H61A 1OABA 1TQWA 1H63A 3BMWA 4AF0A 1W5MA 3KE0A 4BI6A 3BSGA 1JD7A 4HA1A 4Y8FA 2D3LA 2Z1KA 3TXZA 1HT6A 4A21A 1ME7A 3RLVA 1BSIA 1TPC1 3G1HA 1UOKA 3PUOA 5H2ZA 3RMJA 1EWEA 2D73A 3LHVA 5SWUA 3W37A 5EMYA 4H3DA 4JIPA 3UNDA 3TQ0A 4JDBA 5DO8A 5D33A 2PURA 1PCKA 4O10A 1SR9A 3M5ZA 3GXDA 3HB9A 2B7NA 2NT0A 3WEMA 3KEHA 3DX1A 4WD0A 5AN7A 5DBUA 1JDCA 2E5DA 3TTYA 3BVWA 2NUWA 4FNQA 2QJHA 2FE0A 1FWNA 2EQDA 1TV5A 3EX2A 4UNLA 5KEZA 3L0NA 2E68A 2CXGA 5C5YA 1H5YA 1NAL1 1V3MA 5FF0A 3L4VA 3SY5A 4E0CA 4UZSA 1L0PA 2VFDA 3W88A 2CZ5A 3W87A 2ZXAA 3ATZA 1QOPA 3GIYA 3LCLA 1JGIA 1S5WA 4N4PA 3VFLA 3C8FA 3N14A 1DORA 1RQEA 4JFTA 4L4MA 1DOSA 2TRSA 3VM5A 3S1UA 3TX9A 1SMAA 3KWXA 1WZLA 1DVJA 2WKGA 1S5VA 2WSQA 4AVFA 3AXIA 4C1LA 2H3BA 1YPIA 2I9EA 4JXCA 4I7WA 3VO0A 1BG9A 1FXPA 1G6CA 3HF3A 2Y4SA 3HPXA 5KZEA 3T7VA 1R47A 1XUZA 4TO8A 3L2IA 3T40A 1JL8A 4GO8A 4RZ6A 2QCEA 1TMQA 3WNKA 1ALDA 1PE1A 2DJXA 4AAJA 1CPUA 5I5RA 1UD2A 1JULA 1CGUA 3WNLA 1TPEA 3IV3A 2EADA 4K36A 3D52A 3LXAA 4IUOA 4NJJA 4LVDA 3LHZA 2GVGA 5FF2A 3LOTA 4UQ9A 4UTKA 1C8QA 1HNYA 1I45A 6CGTA 2DH2A 2WCSA 4PEEA 4CQAA 2QPSA 3K1DA 2NZLA 3TE9A 2ZZ7A 3FLUA 3FAWA 3WK1A 5TD4A 3LHYA 4I9AA 1GG1A 1JR1A 1MWOA 5CPNA 4BI7A 4LRTA 2ZX6A 4WJEA 2R14A 1TJPA 2YIHA 5KZMA 3W1UA 4M8UA 1J4EA 1XCFA 2ZYFA 4CCCA 2WPGA 4MUZA 2B7QA 3VNYA 3BW3A 3NQCA 2XVGA 1VFMA 3LERA 3CEPA 2OT0A 3GDRA 3QC3A 3A22A 2CPUA 5LGZA 1R2RA 3A21A 4DBEA 5FEWA 1VCVA 1E3XA 4IQLA 5FF7A 3GLCA 1M7PA 4JFVA 2H3DA 3NNTA 2HS8A 2QR6A 3EXTA 2W6RA 3CIXA 5GVJA 1ZAHA 1IZJA 3BAKA 4Z08A 4GINA 3ZR6A 2A6LA 4O11A 3BARA 4RKAA 3V1PA 2E6FA 3UY7A 3BUQA 1KM3A 1VC4A 1X6UA 2QDHA 1X7FA 1AMKA 4ORIA 1EP3A 3NL6A 3SGUA 3CIWA 1V5XA 2QUTA 3W2KA 1MEIA 3L4UA 4HNNA 2VOMA 4ZVJA 2Y62A 1JIBA 1H7OA 4HNTA 2ZUWA 1PS3A 1H7XA 3OBKA 3VSTA 1XBZA 1LLZA 5G4EA 2V3EA 3DX0A 3KLKA 2Y63A 3YPIA 5LNWA 2VEIA 1HWWA 2FFCA 4JCLA 1AQMA 3M0ZA 4GE8A 3FKKA 3IGUA 2A1YA 2ZRWA 3Q94A 1SZGA 5KSWA 2X16A 3W9ZA 1Z48A 3GAKA 3TCEA 4JX4A 2WC7A 1F5ZA 4WLCA 3ABRA 3TQVA 3UWVA 3PBWA 4FNSA 2ZZ2A 4X3ZA 5AYXA 2F1BA 1CYGA 2E77A 2RKXA 1UJPA 1Q6OA 2HS6A 4LS2A 5A2BA 2YFNA 1THFD 3MBDA 5EL1A 3STEA 4R53A 1KTCA 3EDEA 3VSVA 2YCEA 1XC4A 1UH4A 2PWHA 3ABQA 1JQXA 4IJBA 2RDUA 4IX0A 1GYNA 3QGVA 3LTSA 4ZQPA 1KM1A 3W7GA 3KVKA 3INPA 3HG4A 1A47A 2XWEA 4MPQA 1JDDA 3UWZA 4U31A 3WNPA 3TQKA 2V9DA 1OFOA 3UWWA 1TCDA 1PAMA 2EJ1A 1VJIA 3W07A 3W74A 3A5VA 4GO9A 3GXMA 4WY0F 4AHOA 5AYZA 3ZWTA 1UUOA 3TOPA 3TK7A 1YLVA 1YDNA 2YXGA 4WXZA 4JDYA 1DJQA 3WNMA 5MHBA 2AQWA 2PC4A 2NT1A 2DZSA 3PSWA 3NL5A 3W1NA 2DZVA 5AC8A 3UWQA 2DIJA 3IJ9A 4QJ1A 3OIXA 3TIMA 5HXMA 3R13A 2PWEA 3ABSA 3GNDA 5LGXA 3D4YA 4CQ8A 5EKYA 3VMOA 1TQXA 4X9YA 2F7PA 1LRTA 2BY1A 4X2RA 5I3GA 4IGHA 4EVZA 1IXNA 3G1AA 3RLUA 1BF2A 1LCOA 1SQ7A 1MEHA 1UKSA 3OVQA 4FMVA 1NF7A 2FYVA 2EKCA 3M41A 4MY8A 4L4LA 4JN6A 4BFAA 1LTDA 4HP5A 1W31A 1QI3A 1H7WA 4U2ZA 1FDYA 2QCGA 4LTSA 2FTPA 2PE4A 4Y9AA 1K7FA 1S3HA 1NOFA 1DBTA 1UKTA 1GOXA 1KM6A 2BSLA 4Z1AA 2VEKA 4QAIA 3LV6A 1V7YA 3LV5A 3OLGA 3WJZA 4MFEA 3NQ8A 5DCBA 3USBA 3O15A 5CZSA 2EACA 2YW3A 4Q33A 5CXPA 2BY3A 9CGTA 3LXBA 1PZ3A 2VRQA 2ZRZA 3VU2A 4GBUA 4LUIA 1GWJA 4JY8A 4ZQCA 2WO5A 2Y7GA 4JX6A 1TRIA 1JF5A 2YA1A 1M53A 1GZGA 2ZQ0A 1VHCA 1GVFA 3NG3A 5A8GA 1W1ZA 4O4VA 8CGTA 3QJAA 4O54A 3S1XA 3E0IA 1QI4A 4J28A 1LYXA 3A6OA 3QH2A 3MW7A 5U7SA 3GX9A 2YA2A 5G4WA 1QNVA 3RF9A 4TIMA 1SO3A 1VS1A 3EX6A 4FLRA 4Y96A 4JCMA 1WOAA 5DELA 3GKFA 1QPQA 2ZRVA 2FHCA 3II1A 4K7YA 5G2IA 3W23A 3S1WA 2FH6A 4LQ1A 2V0TA 3O6CA 3S9YA 1F6PA 4HPHA 1OF8A 4OV9A 2GPTA 2EABA 4UQCA 5H91A 3EKLA 1PJ9A 1J0IA 1Q6QA 1QI5A 4MZ8A 3GVGA 2JK2A 5U4NA 4QAWA 3DKLA 2Z2UA 2XVLA 2Y70A 2E8YA 3UYCA 4CKQA 1VCFA 4S2CA 5AHEA 5K9CA 4EWND 3L9CA 3QZEA 3CT7A 3LXCA 2CFFA 3T44A 3BLKA 4LXFA 3HGJA 3FA5A 1WP6A 3E96A 2H8ZA 5AOUA 3N9RA 5D2VA 2V3FA 1UB3A 1OFDA 4H7VA 2ZICA 2QCDA 3KVJA 1K8ZA 1IV8A 3W7MA 2IQTA 2CZFA 5AC6A 4GXMA 3UZJA 2Y7DA 1FCQA 2NX3A 1L9WA 2ZX5A 1UD3A 3TJXA 1R75A 3KL5A 4HOZA 1I2RA 1WZMA 3FYPA 3P60A 3SI9A 3VX0A 2BWGA 1M5WA 2ZE0A 1KLYA 2BZNA 1B4KA 4UTWA 1OX4B 3PSVA 5E6YA 3AMLA 4U4MA 4IOTA 3W70A 5EMUA 1ML1A 1UH2A 1LOQA 5CPLA 2PRHA 1XCWA 3G1VA 4AWUA 1JXJA 2F7RA 4FF7A 4FXSA 4KKXA 2QCMA 4JTEA 1KBIA 1TTPA 4GKLA 1WZKA 1FCVA 3NPUA 4JTKA 2YFOA 2JGQA 2OZ0A 3W7NA 4K8EA 4FLQA 2WANA 1D3HA 4OJYA 3TH6A 3G0UA 5D05A 1DTUA 4ADUA 1IZKA 1AK5A 1SSGA 4UQAA 1CGTA 2D0GA 1I2PA 2EAEA 4W93A 1GJWA 1SO6A 4UTWC 4R7JA 3HIJA 2QF7A 1MW2A 1PEZA 7TAAA 6TAAA 3LTPA 4NUWA 5G5IA 3KRZA 4E2OA 3DU0A 3S1VA 4MB1A 3GXIA 2DZWA 2NX1A 4WZHA 3C2RA 1EP1A 1TTJA 3HZ3A 2Y7EA 1SUXA 3HBLA 2G96A 5I3FA 1W54A 3BAWA 2ZA3A 1QPRA 3BUIA 2YR1A 1W9XA 3EWXA 1WO2A 1TPH1 3NQVA 5LNSA 3DI1A 4K38A 1TPB1 1QWNA 4WOZA 4JD4A 1QDSA 1BKSA 2X2HA 1F6KA 5I3KA 1E51A 3GDLA 2WSRA 3OA3A 3O63A 1SFLA 2H8XA 3ELFA 4O50A 3BCFA 2A7NA 4UIOA 3NQDA 1KXTA 2A21A 2JKPA 2ATSA 1YTDA 4DEFA 4HPXA 4LW7A 5BMWA 4AXKA 3U2OA 4PODA 4KFOA 1OFEA 2NLIA 4RXFA 4UTJA 3DX3A 3DZ1A 4OE7A 5LNVA 2B4GA 4UFMA 5DN1A 1I4NA 1W5QA 3MYOA 3W7OA 1EIXA 4DXVA 2FPYA 3ZFHA 4CNPA 3CB8A 4CN1A 3L67A 4O8RA 3JRKA 4UMBA 3L4XA 1KFBA 1R2SA 2FPTA 2WV8A 5D03A 5F2GA 3STCA 3G0XA 3S42A 4KWWA 3NEVA 4WOQA 1QR7A 1FUYA 3FOKA 3NPXA 3IIXA 3GXPA 4J7RA 4WF7A 4NJGA 4JFUA 2E4TA 5FI8A 1YDOA 2G95A 4RCXA 4DF1A 3KVLA 2DIEA 3VE7A 4UQBA 1KFCA 4UOZA 1F73A 1KXVA 4QNWA 3IVSA 5A6LA 2A7RA 5BOOA 1NFBA 2GOUA 5E70A 4UZUA 2KZHA 3WENA 4GUGA 3TKFA 1OT2A 1NM9A 2GQAA 2B7PA 4FIRA 5FEXA 1SW0A 2OJPA 4MYAA 2ZUSA 1RD5A 1BWKA 5CPOA 3P80A 4BWLA 2D0FA 5K3VA 2TPSA 3LDVA 3G1FA 5D37A 4UTHA 1W3TA 1LBLA 4AH7A 3M7WA 1AG1O 4O14A 1JRCA 4M6PA 3BVUA 2QCNA 3L2MA 2ZTJA 3LCXA 3QMRA 4JTSA 3GR8A 4UCGA 1PCWA 3C61A 3JR2A 5BRBA 5E6ZA 4ZQNA 2DORA 1DEDA 2VNCA 1RQHA 5EBUA 4JTJA 5LHFA 1RP8A 2QEZA 4PL2A 1TYGA 2DZPA 1AQHA 1WYIA 4UFKA 5BRPA 1QFEA 4O18A 5D02A 2WNWA 4M5PA 4UFJA 4LC6A 4RV8A 1PPIA 2EEXA 3KL3A 3PM6A 5KMYA 5FEPA 2VR5A 4JFWA 1Z44A 4BWLC 1PIIA 1WE5A 1QOQA 2P10A 4Z0SA 1LM1A 4MVAA 2FB2A 2QV4A 3W7KA 3HG3A 3I68A 3TFXA 2EGZA 1R2TA 4MOZA 3DH7A 4CLMA 1JRBA 4NXSA 4HNVA 3FYOA 1GT8A 5D32A 4TMCA 2E6YA 4DO5A 4N6EA 3WY4A 3WK3A 2Y5EA 4JY9A 2LLEA 3L4YA 2CLMA 4MZYA 4NNCA 3I7SA 4N02A 1H60A 5C54A 4CCDA 3UY8A 2WNNA 1W5PA 3DHDA 5DY2A 2WQPA 3VGHA 1H7RA 2ZXBA 3DFQA 1EPXA 2PRMA 1E3ZA 2AMGA 3LBCA 1OX5A 4FEZA 3DX2A 1M7XA 4WSKA 2Y6ZA 3STFA 4IMEA 3D50A 2OSWA 2R94A 4TR9A 3HPSA 3LPOA 1WPCA 2X1TA 3HQ1A 3P62A 2WJZA 4C1KA 2FHBA 3NXFA 4DO6A 1ME9A 6ALDA 4J3UA 4HSNA 4JTUA 4AHPA 1SU5A 4OBTA 1KXHA 2F7QA 1YXDA 3WDHA 3EKZA 4LRSA 3CTLA 4LVBA 3L4WA 1AL8A 3KL0A 4JL2A 1X1ZA 4RX0A 2ZUTA 3BAXA 4IMCA 2ZIDA 3T78A 3Q58A 3EJQA 4Z0JA 3VNDA 1JQVA 4KMQA 2W0UA 3UWUA 3N3MA 3ZT6A 4J9JA 4QSHA 1ZS2A 1BTMA 3CEUA 1FWSA 1WX0A 2J88A 3EJTA 1EX5A 1QCWA 2GJPA 2J6XA 4CGTA 3IGSA 1BWLA 5CPMA 2GQ9A 3LCFA 1VPXA 4TVUA 1QHOA 1T96A 4DPPA 4LOCA 1OK4A 2J9XA 3HOJA 1VAHA 2VFEA 4J3XA 1VFOA 2WSKA 1EUAA 2BHZA 1XCXA 1VHNA 3PBUA 2ZX7A 1MZHA 1WXJA 3M6YA 3W76A 4A2RA 1KM5A 2ABBA 1UUMA 2E9BA 1EH9A 3NQ7A 3C52A 3L0GA 4XTDA 2RH9A 1OFRA 2G3MA 4QIUA 1T8XA 2ZFAA 2F7FA 3KRUA 8TIMA 3AXHA 3B0VC 4H8VA 2HMCA 1ONRA 2ZWYA 1GJUA 3R5EA 3CU2A 3F4WA 1VGAA 4H8HA 2E1DA 1ZFJA 4OV4A 3PS7A 1J2WA 2EF9A 3W1QA 3TR2A 2ZWZA 1DKWA 1TV7A 3TSMA 1BPLB 4UTMA 4FX6M 2YDAA 3P84A 3TJLA 1G4PA 5E93A 4HPJA 1WZAA 4PSPA 1TPVA 3AMKA 1G4EA 3TC7A 1KFLA 2OW6A 1VYRA 1XH2A 3ZR5A 3EXRA 3CZGA 3R2GA 1XUUA 4NX5A 3P5ZA 1MXDA 1HX0A 3BW4A 4HOXA 3EXSA 4PTNA 4TMBA 3BAYA 3WELA 1O7DC 3G1DA 2QJIA 1Z32X 3EWWA 4UQEA 4PCFA 4LVAA 1XD0A 1BVZA 3PUDA 4MFDA 3HG5A 2C13A 1KA9F 4AYSA 2P1FA 3ZOAA 2QJGA 3FW6A 2ZZ3A 1ODUA 2ZXQA 3TA6A 4WSJA 4AHQA 2XN1A 1JCYA 4UR7A 2XFWA 3DBPA 3FJLA 3EJRA 3QMSA 5L6UA 3W3OA 3W7EA 4NNBA 4NI3A 1PL9A 4M19A 3WJXA 5FF3A 4K7VA 1HO4A 3LRKA 2WSYA 2A6NA 3EX4A 4X22A 3MHUA 4O12A 1YDVA 2W79A 5A5WA 2GVJA 4HSOA 4D2JA 1XKYA 1TSIA 3BLPX 1P5BA 2NWRA 3GDKA 3EDKA 3IK2A 1VB9A 3LM7A 3FS2A 2JKEA 7CGTA 1VR6A 3UXDA 3U8GA 1EHAA 3VGEA 4EF8A 5G1YA 1OT1A 3WDIA 4MLRA 1J0KA 1N55A 1U83A 2AAMA 3C0JA 3QSTA 2DZUA 1B9BA 3ZSTA 1MW0A 3EEGA 3THAA 4XB3A 4LUJA 1H7NA 3DDGA 3FEMA 4A22A 1K03A 1O94A 2X2IA 2BY2A 3NQMA 3WJYA 1MW3A 3ZSSA 1FDJA 3W1PA 2VXNA 3OVRA 2ZUUA 3DAQA 3F03K 4CN4A 3UQNA 1V3JA 1KM4A 1OYAA 4GUIA 2BXZA 1CX9A 4GWEA 3W6YA 1QW9A 2ZXDA 1XSIA 1AW1A 1UD8A 3B06A 2ZUVA 3GXFA 3NL3A 1AMYA 2ZRXA 1NVMA 1FDZA 2G97A 3GBDA 1A5BA 4UMCA 3NZ1A 1OSEA 1CXEA 1XH0A 4FLOA 4Z1BA 1PHQA 1ZCOA 2F7OA 3QPYA 4XUGA 2J24A 5HULA 3A23A 1I2QA 2DZTA 5HNRA 1KV8A 2A2IA 4CN6A 5FEZA 2VFIA 4ADTA 4RK8A 1TJRA 2QKFA 4LC8A 1MXSA 4ICNA 5HINA 1JCNA 3KFTA 3BUBA 1IXOA 3MUXA 5F1UA 2FLIA 4O16A 5A2AA 4M6VA 4H8UA 5G2HA 2ZZ6A 4Y6GA 2UV8G 4CNOA 3GDTA 4AMXA 3NZRA 1TREA 1GVIA 1L6YA 2ZA1A 1Z42A 2F84A 3NPVA 3D51A 3GXTA 3BG3A 1JVNA 3PULA 4IMDA 2WKJA 2VFHA 1XBVA 4MAZA 1OX4A 5A2CA 4LS0A 4BF9A 2RDTA 3N73A 2VT0A 4JGDA 4Z1DA 1UBSA 3BSHA 1Q6RA 4E2BA 3WMSA 4OKDA 4GUFA 3BVVA 2FHFA 3H55A 2Q3OA 3I7RA 5J5DA 1ICSA 1KCKA 5F4XA 2XN2A 1H50A 1CGYA 1J5TA 1FWWA 3DC0A 2B0MA 1JUBA 2YSWA 4GNJA 2CLOA 1HL8A 5E1QA 1QX1A 4WX2A 3SR7A 3OLDA 4WY0A 3DFSA 4XKYA 1QPKA 3TV8A 2J27A 3EX3A 1TQUA 1GTHA 3EX1A 1YTEA 3PVFA 4RZ4A 5I23A 2GQ8A 1R46A 1UCWA 2FQIA 3GDMA 4POCA 1K7XA 4DBDA 5BRQA 3UEQA 1DHPA 1BLIA 4AEOA 3PR2A 4O57A 5BW6A 2V8ZA 2CLFA 1W3NA 3VKJA 2V81A 2WCGA 4DF0A 2X1RA 1DQXA 3MP3A 3NQEA 2YOCA 1H51A 2QCHA 1G5AA 2BXYA 2OW7A 1H62A 1GEQA 4MZ1A 3GTNA 4EF9A 5E9AA 2VC6A 3GB6A 5F7UA 2A0NA 1OFBA 1RV8A 2YZRA 3W72A 2PWGA 3LTYA 2CLIA 4LV4A 4ZQMA 1DHKA 3WNNA 3VX1A 1MVYA 2DH3A 5EY5A 4UTUA 1TO3A 5CLTA 2ISWA 4N9CA 3UPBA 3QMTA 4W9TA 3KAOA 2BTMA 3NM1A 2YYUA 1SW7A 1KTNA 5T26A 2D0HA 1O95A 2NXHA 3EJSA 3P74A 4OWGA 1MXGA 1D7FA 2QMJA 3F1QA 3O16A 1YXYA 5D2XA 2OSXA 3W71A 2NV1A 1AW2A 1IIHA 4J3TA 3IIOA 5IBXA 5K9DA 1P1XA 4NJKA 5TIMA 1MFUA 4QNEA 1DQWA 4X0NA 4ZQOA 1KXQA 2TAAA 4UNIA 4N2YA 5HDRA 1L6SA 2XWDA 1RPXA 1XSJA 2E5CA 1M7OA 3SJ3A 4AW7A 1ZENA 1D9EA 4FLSA 4FNTA 4FNRA 1GVRA 2YA0A 3EWBX 5HUPA 2GJRA 3W2UA 4FNPA 3LHUA 5CSRA 5IBXC 1QO5A 4A2SA 3TSBA 3UERA 3CM4A 3M5YA 3M5VA 2VFGA 1RVGA 5AB3A 3MHFA 3MHGA 3PG8A 4K8HA 3CZEA 4Y90A 4OIFA 2WVSA 2QCFA 2TYSA 3DFPA 1TPFA 3MP5A 1RQBA 5KTLA 1UKQA 2QUUA 1OB0A 1QAPA 3M16A 3C56A 3O07A 4MIMA 1O5XA 2YYTA 3DI0A 2BHUA 1H1YA 1R30A 2ZX8A 2QCCA 4O0KA 3W7IA 1XM3A 2QPUA 3BW2A 2C19A 1L2UA 3VGBA 1GVOA 1RR2A 3THQA 1TRDA 5AHFA 1U5JA 5HJLA 4BI5A 3NL2A 2ZZ4A 2ZRYA 3W7QA 3NOEA 3P67A 1JF6A 1V3KA 2XIBA 1KM2A 2ZZ1A 4AWTA 4Q32A 1YTKA 3R89A 3L66A 1ZAJA 3WY3A 1CXKA 1X8FA 3L4ZA 2FDSA 3UG3A 1ICQA 5K4XA 3CZKA 2ISSA 2Q8LA 3NPWA 2BY0A 1TPDA 2QLYA 4LVFA 1Y7VA 4K37A 1P6WA 1A5CA 1F76A 4UOQA 3SW6A 2H6RA 2QMKA 1UASA 4WY0B 2WVUA 4XKYB 1E43A 4TU1A 3A5FA 4MY1A 1XSKA 1LRQA 1JJKA 4UTTA 3SSJA 3IRDA 4PEKA 3IVUA 1YXCA 5AYYA 1L6WA 4P2VA 3KX6A 4AYGA 3TXVA 1XBXA 3ECQA 4U28A 3NYZA 3TAOA 1ZJAA 1FXQA 4E2DA 2NX9A 3PF3A 1ZHAA 3QPZA 2EHHA 4YCPA 4QISA 3G8RA
chains in the Genus database with same CATH superfamily
3BAIA 4RH4A 1TB3A 3NZ8A 3PJTA 3MRCB 1U92A 2QSQA 2XKUA 2HTKC 3UVAA 5HHOA 4HZ6A 3BUPA 1A8JH 1ME8A 1FZMB 4HLJA 3KOFA 1F58H 1CI1A 1IFGA 1HZYA 5F3HB 1KPRB 3OG6B 3G5ZB 1A1NA 1JGDB 1U8KB 1XFCA 3O8AA 3VXQA 3TEVA 2CDGB 1HHGB 1U3HD 3NQFA 4KJYA 1Q63A 4RNLA 3I4KA 4NJIA 4U1GB 5I19H 1PIGA 1KNOA 3ISWA 1M1BA 1WBYB 1SJHB 3MRBB 1A7BA 4PB0L 4MCZA 3UJIL 2Z31D 4GRLD 3WBEA 4QLKA 2YXVA 2OU4A 3LKRB 1BXVA 1XR8A 2F54D 5HQEA 5FW8A 2CJUH 4JTLA 1K2DB 3VFNA 4LLWA 1KUMA 4XRCB 1TFVA 2PCQA 2F61A 1AYRA 3Q2VA 1OVDA 3JV4B 3N18A 4BQCA 2IPKB 3TA3D 3QQDB 4XO4A 3HJ0A 3QW3A 5C97A 4JZJB 3LMJH 3T6QC 3ATAA 4E9TA 4YE0A 4YPGB 4LSBA 3FU8A 4NC0B 1UWEH 4ADJA 4GRWF 1Q72H 4DZ5A 1IAOA 5HBBA 3QEHB 4J40A 1MAML 3L9BA 4U33A 4WIQA 3MV8E 4GIPD 3SGEI 5HHPA 5DMNA 4P2CG 1GPWA 1H54A 3VRJA 4F20A 4UV4L 3BGMB 1YY9D 3UZYA 5IBLC 3EOBA 1RUSA 1TG8A 3VG9B 3WS3A 3T2OA 2VZ3A 3IJHA 3IBEA 5BMXA 3O9WD 7REQA 3NVDA 4EIVA 3GSQA 3D39E 4L2LA 3UAJA 5ABEA 3LHTA 4UT6A 5DQ9A 2OL3H 2WZHA 4RDVA 3CFBA 5CSGA 1JG9A 2TODA 3X41A 3S4SG 4OB5L 5IHZA 4TQ8A 3C3NA 4WUUB 1CLXA 4I0PD 5KOMC 2CDEA 3ILQC 1DN0B 3RJQB 4HS6B 3KRSA 1W1VA 4G80A 1Q2RA 4DO4A 1E4HA 3UC2A 3MBED 2DT0A 5FFGA 4PJ5B 4F3FA 4KH9A 1UD5A 1F02I 4GD0A 3MRFB 2PDGA 5C09B 4WK9A 1O7DE 1NC4B 2CR6A 3FO2B 4ONHB 4P5RA 4ZO9A 4GPNA 4YX2H 1R7OA 3LQZA 3K25A 1XF2A 3WLKX 4YXKL 1V3LA 2YPIA 4WHYH 2ABAA 5KINA 3C5ZB 3ZY7A 1T2QL 3W0WD 1UG9A 3CZSA 5I2IB 4NYLA 4JKPL 2VLJA 4WFEE 4TUOB 3LG3A 4PRIA 5HYEA 1LL7A 1ILSA 1PBYA 3U4BH 4YWIA 4C6NA 2YAMA 4OJAA 5IJKC 1UM5L 4LSSH 1URIA 3W2MA 1QSFE 2WQAA 2B0SH 4NNYA 1SXNA 2MFNA 2XGIA 3E02A 1MFVA 2PO6C 1HL2A 5GGRB 3TBWB 4LMQE 4E4UA 3QW4B 1KLZA 4PJ9A 1UZ1A 5GJMA 3L5WA 4Q4EA 2YBUA 2JFCA 1MELA 4PUKA 3UTTA 4Q4KA 1SPUA 2V4LA 3GHSA 1RZKH 1WT5A 3K2UH 4FABL 1OO2A 5EEUA 4RDQG 4LNRA 4MPKA 3LIZL 1CECA 1N6VA 3ZVHA 4YSSA 4RXGA 2NXYD 3ARGB 1RJLA 5G2WA 1XIJA 1LRNA 5IBTL 3QRHA 5ISZD 2OPCA 5BJTB 5FJOA 5ALCH 4Y5YC 3LZFH 5HHNB 3N42B 4ACPA 3QEQE 3W9EB 4LESA 3VNZA 1ZUAX 2DP3A 1T3FA 2FX9L 2JKSA 4V2XA 1FL3B 2MOGA 2GI0A 1MAKA 3O2LA 3FUFA 2ZDSA 4PBVC 5I24A 4AEEA 4F2MB 3D18A 4DB7A 3D4CA 4TTUA 3QKZA 1M7DA 2ZX9A 4ODVH 1DWJM 1EGZA 1NSJA 3CHOA 1KRBC 1Q0YH 2ZJSH 1PY0A 2A38A 2HJFB 1TTBA 4UNVA 1MIEL 3P3BA 3T0EB 4P61A 1RZGB 3IJ8A 2BM3A 1JVLA 3GMLA 2MIZA 2EILB 1CG9B 1ED3B 5CEZH 1O7VA 1LGVA 3DXIA 2BFVH 2P49B 3G22A 3CZNA 4W85A 3R06B 3B5TA 2PPFA 2CLVB 3O8XC 4EBQL 2R1LA 1IGMH 1P7QD 1YPZF 5D09A 5IXEA 1EJWC 4XZ9A 4W9FC 1K6QH 2NZ9D 3SUWA 3JS3A 4Z9KB 1POKA 3CFMA 2PP1A 2Z92B 3THUA 2YGPA 4ELDA 4AYBA 4IPJA 3GLZA 1BMGA 4ZX4A 2QVNA 5DQDL 4E9RA 1U3JA 5FYKE 4NO0D 4OLZH 2HE5A 2V8LA 4FQIH 3IKCA 1F5WA 1SNZA 3SOBL 3IEAA 4RNRA 2NCMA 1SO4A 4E41A 4K0OA 2DD8L 5IHBA 2YW4A 4XVOA 2KDGA 3MOBL 5DXWA 4X61A 5AFDA 1QAKA 1AZ1A 4K7PY 3CHRA 2AJVL 3JWNC 8RUCA 3SBWA 4F9DA 2FGWL 2X70B 4LSRL 3P0VL 7PTDA 1I85A 5CCJA 2MQGA 5HYSA 4JG0H 1DVZA 2FJFB 4Q52A 1OADA 2J25A 1N0LB 4R0LC 2ZG2A 4M03A 1TJHL 2XSKA 3EFOA 3HMJG 2IKHA 1P5VA 1RP9A 3SJNA 5A95A 5EOTA 3CWOX 5E4IA 4U1IB 5D1QA 1WAEA 2DJSA 1WAAA 4DVRL 4KO9A 4Y2DD 4H7ZA 3V5DB 4QHLB 1XF3B 4LNCA 5KVEL 3UGXA 1XDMA 3TVMA 2OGJA 4EN2A 2I25N 5HTSA 3H9SD 1ZJIA 4PJ7F 4AZ6A 2QPXA 3US1A 3V7AG 1BSIA 5E6SB 2IBGA 2AKRA 4H3DA 4A6YA 1AZRA 2YDQA 4DHGA 2NT0A 1N59B 4FNQA 2FE0A 1TV5A 2XVPA 2AXGB 2A9BA 2WJDA 1NAL1 5FF0A 5DEFB 2FT7A 5LLIC 3OZPA 1JGIA 2OL3B 3N14A 3U0WH 2G3XA 1J1PH 4Q8BA 5GGQH 2J12B 2IVFC 1VD6A 4YLBA 4YHML 4K7FB 1GYAA 1NEZA 4F9PA 3D1MC 1L9TA 1PE1A 1H3XA 4APXB 1JGUH 5CR1A 1XLBA 2AJZA 3D52A 2FLMA 3R94A 2GVGA 1ISXA 5MEOA 1YN6B 3LOTA 5JLZB 5IK3B 5A6BD 4Q7DA 1FWAC 3QFDA 5EFIB 3TE9A 3HZMB 5A6TC 2H9AB 5TD4A 2OLDA 1YAIA 3R25A 3UPRA 4OUUB 4HJ1A 2XTJD 5IT2H 3WUZA 1TZ8A 1J4EA 2FSDA 2ILLA 3CEPA 5TE7H 5LGZA 3OR6A 3MYJB 4IQLA 2YD1A 1V7ML 4M1GH 3MC0A 1UZ6E 1QBAA 2ZOLA 1UJTA 1ES0A 5DMGD 4FQ1H 1KM3A 3U6XS 4UM9B 2Y23A 1V5XA 4H9UA 2Y6TE 3KPPA 3RHWF 3EAUA 4IRSA 3V7AE 1B4JL 1E6XM 1HWWA 4KJWD 4NQTA 1FWFC 5D1ZD 4GXPA 2PPEA 1OJNA 1S7TA 2CCWA 4QOKE 4W9JC 1KTCA 2OCFD 4EIUA 4KX7A 1XC4A 4N7QA 1RU9L 3LTSA 4LAUA 3W29A 4YFLF 3HRZB 2OCCB 4OIIL 2DTMH 3PGDA 2ON3A 3UJJL 1PAMA 2QGDA 4G9FB 5DS8B 3WQVA 2F53A 5B8CB 1YLVA 4L4VA 4XNYH 2AEPL 4R4FL 4PFHA 2NT1A 3BSZH 4F7EA 1FC2D 2Y2YA 2BY1A 3GU1A 1P5UB 5I3GA 4S1RL 3ACTA 5BOZG 1DVUA 1B0RA 3PUUA 2EKCA 5FD0A 2WBJA 3EYOA 3QC6X 2ARJA 2XKSA 4QAIA 2ZCKL 3C2SA 4OF6A 4KTGA 3CSPA 1PCXA 3OPZH 1W8OA 2VRQA 4QRUB 1U6AL 3KM2A 2Y7GA 1TRIA 3GEWB 4HJEA 3OD3A 2JH2A 2AQVA 8CGTA 3C0SA 2P28B 3UO8B 1ZT7A 2ZYRA 2CFWA 1KFAH 4HHHA 4ALAC 1YNKH 1OM3H 2BNRA 4KKCC 1XAUA 2GJZB 4JCMA 4MXVE 1C5CL 4NQCD 3WA2X 1CDCA 4LQ1A 4DUXA 3O6CA 4HPHA 4P8UA 2J44A 1E6NA 2BINA 3HCVA 3UYCA 4AISA 1U36A 1BZ7B 3H2MA 1V03A 2CWTA 2C11A 5RUBA 5IBUG 4LXFA 3NDYE 4ABWA 4Y9GA 1J87A 3FZUD 3N13A 3MWXA 3L95B 5ID0A 3S2AA 5GS0L 3KL5A 5AD0A 4LASL 3DJ9A 1Y18A 4OF0A 3VFMA 4M43L 4DAGH 5IEKA 4DFHA 3GMRA 4M7JH 4NGHL 5GIRB 4D0DA 2W0FA 3RWGB 3NQKA 4KO5A 3VFTA 5HI4D 1SVZA 1AK5A 2CO6A 1AQDA 4MQ7B 1IQWL 3J27A 1MCEA 3FB5A 1A6VL 4JQ1A 1KRCC 1G1OA 1EP1A 4OZFG 1NLDH 1YMHB 3AWEA 4LF3A 1H4PA 2Y1ZA 2BOFX 3VXRA 3FFCD 3IDIA 2DM4A 3DI1A 4K38A 2L4OA 1BKSA 3FDWA 5LBGA 4C6EA 4S10A 1KLGB 1KXTA 4N8VB 5JQ6H 4XN7A 1EJ8A 2J21A 4JFYB 4KFZC 4RXFA 2XWCA 4P4KA 1UKOA 1EKMA 4EI5A 2NVAA 2Q6WB 3UBXG 2E28A 4IIEA 2E1WA 3ZFHA 3CZJA 2ICEA 5D03A 3L4XA 1R2SA 1V6YA 3ZKQD 2A99A 3NTYA 2Y3NA 1PSKH 3SX1A 2NVDA 3IN2A 1UWXK 4DWDA 4FTVB 1SYSA 3VCLB 2G95A 5I06A 2NY2B 3ZE2F 1QR1B 4B91A 1OAYH 3BFQG 2BNUB 4JREB 4I8YA 4M1CD 3HKZA 2R0ZL 1WKFA 1TTCA 5EG6C 2FSEB 3OG4B 1XLHA 2JKJA 3V0TA 3SKJH 1V4YA 2ZTJA 3NCMA 3QMRA 2GDUA 1S1PA 3ALXA 4ICXA 3GTHA 1YHPA 1KJ2L 2OSLB 5ECGA 1N0XL 8XIMA 4LHUD 1CFMA 1U22A 3P4MB 1A4CA 4JFWA 4PB5A 5DRIA 1PIIA 5KBPA 3TO4B 2I27N 1SLVA 3I68A 3RPIB 3Q8AA 4UMSA 3IMVA 3SYCA 3C5SA 2ZWSA 4NNCA 4ELKB 5JQ9A 3O3RA 3S36L 4JQVC 3U6XA 3VKAA 1H7RA 1E3ZA 4Y0GA 1W3LA 1M7XA 4WSKA 3FCTA 3QR1A 1QALA 4X6DE 3HPSA 4XGZB 4PV8B 3CAFA 5FL0A 6ALDA 1SU5A 3GRWA 3WFCH 3L4WA 3VQ1C 1AL8A 5IFJA 1UP0A 1BRLA 2R1WB 3HB3D 2P3ZA 1V3IA 3BANA 4DUOA 3QDJB 3U0HA 3G1RA 4NO3B 1BWLA 2OLSA 4ZTPL 4AZCB 2CIIA 5C70A 3TZNA 4AZGA 1OK4A 4GISA 1CBVH 2N59A 2BHZA 5IQ7H 2EG6A 4LARL 3EJYC 1FZJB 5FW7A 3WF0A 1J0MA 3NPSB 3TCLB 5H35A 4PWIA 5EV7A 5FYLD 3EIFA 1D5MB 4XAPA 3W1QA 4P9HH 5HYJE 1UC4A 2FQGA 2YDAA 1HSAB 1EMTH 2ASHA 1TPVA 1WFOA 1HHJB 1XF5B 3BPLB 4NKIL 3QJFA 1UOZA 4IGBC 2VDOH 4M6NL 1ROCA 3PJUA 3E8VA 4LVAA 4OZHA 5DRWA 2I7SA 5E09A 5E2JA 5FA4A 9RUBA 2PPGA 4NSBA 3UJEA 2BOBB 4HGXA 3S1GA 2JCCB 4AX6A 3QHMA 2HCVA 1HILB 4GX9A 3C09C 1EQPA 2WSYA 4X60A 4XNDA 3HRPA 1XQ4A 4FQQB 3QIWA 1VB9A 3LZRA 3ZMNA 3H2AA 2B59A 2AAMA 4IBLT 4FFYL 4AUJA 3T9WA 4MXWH 2ACSA 4MJIE 1UZ8B 1JPTH 3VDGA 1N6QH 2BDQA 2KUTA 3HBPA 4Z7NF 4PJGE 1KN2H 3QDGA 3MCLL 2CIKB 5CILL 3RL1B 2ZRXA 4P2QD 5J6GA 3RNQB 3HPLB 3WLWC 4M9OA 2W1NA 4YSOA 4ICNA 3QG6B 1TCRB 3REQB 4ZS6D 4RE3A 1BVLB 4YDZA 1IXOA 3KGRA 1CF1A 1UG6A 3VD1A 3K0WA 5G2HA 2BIIA 3WIFA 1GVIA 1TO5A 3HS0B 4A67A 4HMCA 3U9UB 3OKEB 1NARA 1TNNA 5F9OH 4UT6H 1ZAGA 1JTOA 4PR5A 3S3JA 3KHOA 1HKLH 1O6TA 1H1NA 1R0MA 1A66A 2J74A 3BWAB 1K9EA 2CLOA 3X13B 3DVIA 5D5MF 4WX2A 1NFIA 2NNCA 2ZWKA 2PTZA 5JOFB 1E7UA 1XIWA 2WO4A 5D1XA 4LCYA 3D30A 3UEQA 2Y7SA 5I15H 3D5OF 1P2CB 5FSEC 3PP4L 2PTUA 3AUVA 3UDWA 3RNKA 3IMBA 1OGAB 3IFNH 3H4HA 4GS7B 3GB6A 1RBOB 1VRSA 4ZQMA 4WSGA 1CTOA 1ZV9A 2ZSWB 3V6OA 1U8HB 3QMTA 4W9TA 1SFTA 1DSFH 1Q9KA 5F6HI 3BHBA 4LGSB 4C6KA 3MVTA 3PBMA 1SHMA 1AW2A 3MLTA 3FNKA 4NOFA 4AT6A 4DP0X 5SWZA 4HBQA 4J3OF 3X1GA 5ACMA 1KGCD 2YA0A 4Q8PA 2XM2A 4KROD 2WHJA 2P5WA 5T3ZL 2FECL 1M1XA 2NW3A 5IBXC 4D6JA 5L2KB 4J8RB 3OYZA 3UCRA 3JWOH 4Y1AA 4AV0A 4V2CB 3SQRA 1P1ZB 3MHGA 3PG8A 3O6LH 3MP5A 1G9MH 3OKOA 4MIMA 5IMKA 3W7IA 2XKNA 3ZPDA 3VGBA 2OMUA 3WO4C 1U5JA 4IU2A 3J8F7 2H2PD 3ABGA 4FERA 2QVFB 4Q4RA 1FNEB 4BSVA 4OFQA 2W67A 5F1IA 1K8DB 1E1EA 3SCRA 2D8KA 4LVFA 4X6BB 2W60A 3SE6A 4PJHA 1EZVX 5IROA 1QK2A 4TRPH 4PEKA 2NX9A 3N2OA 4JGNA 4MLJA 3QWQB 1GOIA 5H2BA 5M03A 4FXRA 4ZTEA 3X42A 5LNEA 3NESA 3SDDC 4J39A 3NQ2A 4FZIA 3JUZA 3AREA 3UIYA 3LQAC 4YDJB 5DUPH 3LS4L 4X6FA 4XIAA 3ARVA 5EO9A 5K33A 3M47A 3AG1B 5GGUA 1LO0H 3HTWA 3DRQA 4W70A 3O3DB 4X99B 5CZJA 3LI1A 2GK2A 3EKGA 1XFPA 3VSMA 5H1WA 5I1CH 2CKNA 4L4TD 4Z0XA 3F58L 4UILL 3MCNA 2Z6IA 2OR8A 3H54A 5DZNA 5T1KD 3SIZA 1INQA 3MSDA 4JYEA 1PDYA 2BSTA 2HKAA 1RK1A 4ODHL 4DJMA 5GNZA 4LAJH 4O58H 3PUCA 3IGLA 1NDYA 2EPNA 4P5UA 3TT3L 1OJXA 1A53A 3PWLB 2J4WL 1S9KC 4XD5A 4CQ9A 4P5TD 3R79A 1JCTA 4A3UA 5KG9A 1A3QA 2B4CL 4ZMPA 4P23C 4JFSA 3S3BB 3SKNA 5DFTA 3NZ8B 1EJOL 1F3JA 2J5LB 1AXIB 5L7XL 2C15A 1MJJA 2PRLA 4IBTA 5HHOB 1G9HA 1I3VA 4XPBL 1V51A 5AL0A 3QZBA 3GR4A 3NAVA 2Z7WA 3K4AA 2XZCL 1A1NB 4IDLA 4BK5C 4AOFA 1BCIA 3VXQB 5HHMB 5EGRA 5FGBA 1FRGL 4RZBA 4KJYB 5DURB 1KNOB 4AGOA 3SYQA 2R4SH 4ZMGA 3ZKMC 1V79A 3KTXA 2G4GA 3MVIA 1GVSA 4KRZA 4F8QA 1TNMA 3G6JF 1RULH 3GI9H 5CJ5A 1WQVT 1XR8B 4GG6F 4LY8A 2P53A 3O3AA 1A6ZA 4GGHA 1K85A 3BD3A 3PY2A 1V7NL 1NDGA 3VFNB 4LLWB 5KYYA 4AD4A 1WDRA 3PNWA 2VQ1A 1CLCA 2UZYA 1P4LA 4LCCC 2R2CA 3PBYA 1TG7A 2EXWD 1ISYA 1MDLA 3W7JA 2C10A 3BLIA 1ZA6A 4AK1A 5D7SH 3OHIA 1O68A 3BH4A 3B2MA 4XWOD 3B2DC 3WO8A 1UH3A 1IAOB 1K02A 4PJ6A 4GACA 4MCYB 3T4AA 3VPLA 3FUEA 5T5FL 1YEWA 5HHPB 4IIBA 3BFWA 1WA2X 4OW6A 3VRJB 1MSPA 3LI0A 5IB2A 4AQZA 4DXKA 3EOBB 5A3IC 2FQFA 1G1YA 3VW3H 2AEWA 4A6YH 3SBPA 3WS3B 3UZ5A 1F1GA 4HUUA 5L4MA 1TX0A 3B0PA 3RIFK 5LGHH 3APGA 1AJ2A 3IJHB 4F8XA 4YXLL 4QR7A 3PREA 7REQB 1G5GA 3K80A 2EAWA 3GSQB 3WJWA 2AK4D 1WXYA 3QM3A 3CZUB 5DQ9B 1BQ5A 3CFBB 2IAAC 3BJSA 3KWTA 4YTUA 2ERJB 4DPQA 3AXXA 1TEFA 3ESMA 5IHZB 2OZ3A 5AW2B 2BGQA 2CDEB 1WKDA 4GOAA 3S5NA 4KK6D 2WWKT 4G80B 1CR9L 4EKJA 4Q7BA 5D7JD 1J9YA 2QGCA 1GMIA 1WZ1L 3MRNA 3TM6A 3CO8A 1AMXA 3O9NA 3KM1A 3Q6GL 4LLQA 2NY5H 3ARPA 1N7KA 2GJ6D 2H3XC 2G60H 32C2A 3WQ8A 2E86A 1IXPA 3OZLA 4WTZG 4N2GA 3WK0A 3VGFA 4GIRA 5CMAA 4EV5A 3QFJA 4LHUG 1F1SA 5A3HA 1XF2B 1KLUA 2WKLA 1IFHH 4UBPC 2XIJA 2P7TA 3N1MC 4NFDA 4RAUA 2L7JA 5KUKA 3TF4A 1SEBA 1BZEA 2OT1A 2QGEA 1NKGA 4Y2NA 1RZJH 5SX5K 4JYFA 3NIDF 2WOHA 2KPWA 4NYLB 2BRVX 2VLJB 2HXUA 3Q44A 1CI3M 2J43A 4PRIB 3E49A 2UY6A 1JNJA 5IG7A 4DWSA 1OIFA 3OJDA 2R59A 3FFCE 2EIKB 5JOPD 3CIAA 4LB3A 2GJLA 4IMFA 5HVHB 3EYSH 4RRPM 5B7MA 1AHWA 2O0TA 4FHKA 4ZMXA 4LWWA 3OAUH 1A4KA 5DFAA 4WUKH 2PNCA 1KIQA 4PJ9B 4KAQL 3L5WB 2JMRA 1LBMA 4YHNA 5HYFA 2Y61A 2APFA 3ZWSA 4YNYB 3UTTB 3VE9A 4CU6A 4OM0L 5IY5B 1EPFA 2DKUA 5CSYA 2W63A 2Q5BA 4X6EA 4LNRB 5JMRA 5EO1A 3MNWA 1IGSA 2YXWA 1IEVA 4QQ3A 2FH8A 2WLJA 1B3OA 1UWAA 2TMDA 2R39A 2E24A 3ZVHB 1F3XA 4WZ9A 2PDQA 4FX8A 4F3HA 2X7LA 4JO1H 1IUZA 1OJMA 4I5RA 4KRUA 1RJLB 2QLVB 1GYMA 3SGJA 4LF1A 1BFOA 4JTTA 4HKBA 3ASOB 1QUPA 1TQTA 4GUPA 3CN1A 4MKTA 3ZDXB 1CEOA 4QG9A 1F3EA 1T3FB 4PFMA 2E5BA 4N9DA 3D18B 1ZEAL 5I3DA 1ADSA 4AZ7A 3LRHA 2AITA 3K6NA 4RNFA 4POZD 2V2CA 4LU5H 2V9RA 2OQLA 1KCRH 3WY1A 4O1EA 1CDGA 3LJ3A 1I8IA 5EA9A 4JPVH 2ZA2A 1UA6L 2E9MA 2Y2WA 4M7SA 4QM1A 5D2LA 4ZE4A 3AMOA 3GMLB 1FCGA 1N8FA 2R2EA 1P6AB 3RN6A 2CK0H 4JHWH 1E2ZA 3S2LA 3QQ4A 4DCQA 2X6BA 2IQ9H 1A50A 3LAFA 2WWDA 1MFCL 3NJ3A 3IJQA 1P9MC 4F24A 4FQ2L 5FYLE 4L1LA 1HJVA 1U3YA 1MFBL 1OYBA 2UWFA 3VAVA 2HTLD 1QYGL 5D9MA 1JGLH 1ZXKA 3MMDA 2ALAA 4KQ3L 3WMBA 3RWHA 3ITVA 4C6MA 4CDGC 3ONCA 2DVUA 3NTCL 1ME7A 3G1HA 3G9VA 5H8UA 4K8RL 4P57A 2D73A 4MCMA 1CF8H 3SY1A 3TQ0A 3IU3A 3IKCB 1IC5H 4RNRB 3HR5B 4QRNA 4LLYA 3W5MA 2MMXA 4E41B 4B3VA 1DLFL 2CXGA 2DRUA 1EHKB 5HMFA 1L0PA 3RX5A 3O3BA 1RMFL 3IUDA 1NGWB 3S97C 4EDXA 6A3HA 4ILDA 2PP7A 1NAKH 1NGPH 5BNXD 1IEHA 2EC9T 4EDWH 2DMCA 1T4WA 2UXVA 3CDYA 4NQDA 5HYSB 4HQQH 1JL8A 3WNKA 3QTGA 1GOGA 3CHCA 2OXGB 4OJEH 5GGTA 4JDVB 3BQUB 3EFOB 3BPOC 1KYDA 1K1DA 5F8QC 3G2GA 3LHYA 5T1JA 1P5VB 3AY4C 2O5XL 5EOTB 2G5UA 4JHAL 4PJ8D 4M8RA 5IVXE 3JV5A 3GDCA 5D1QB 2PTDA 1I3GH 2PDKA 4PLKC 4GSDL 2Z7UA 5EC2A 2KKQA 3TVMB 3E6HA 4BS0A 1ZGLM 3LH9A 5GRXG 1LEIA 3IV8A 1AD1A 4AFYA 1A9VA 4Z08A 2PYEE 1LG2A 2I5IA 1OQXA 2ZF9A 3E3QC 2AKRB 1BAWA 5ICXA 4A6YB 5E03A 4AVHA 5FECA 3UOAB 3MKKA 4MBRA 3BKML 3GRWH 2PSNA 5LBSL 2Q76A 1ZRQA 4M62H 3GVRA 2NY6D 2F1BA 3VSVA 1NCBH 2PWHA 3IMHA 4HKZA 5JDSA 1KIPA 2IMNA 2BC4A 3SN6N 3TQKA 2G3ZA 3W7UA 3GXMA 1NEZB 4U7SA 3S2JA 3K5SA 3BWUF 4MNMA 3SYAA 3WYRA 5DJYA 4YUEL 1UUSA 2AJZB 3MTRA 3HE6C 2J8UF 4L61A 5MEOB 1KGCE 2X9WA 4MY8A 1YYLH 4PMOA 3UPRB 4JQIA 1EVUA 1HESA 1MRQA 1Q9OA 2FTPA 3L7FA 5INDA 2E25A 3E9TA 2HFGL 4YE4L 3WUEA 4A7GA 1E9QA 3OR6B 3AIWA 4QFUA 4M93C 5JHDA 1C5BH 3U7YH 2X3CA 2ZOLB 5L9DL 1SPDA 1B9KA 1ES0B 2OMYA 4KXAA 3QI9B 3X14A 1XRTA 4G8FA 4EN3D 3KPPB 1OY3B 4UOW0 3JTBA 3WLMA 4IRSB 4B27A 2V33A 2NX5E 4QAWA 3DKLA 5D7KE 1UXLA 2LVEA 1FWBC 4UTBA 1PKYA 1S7TB 1F97A 2DMBA 4K7PL 4AL8L 5CCZA 4ILSA 2V9UA 4XBJA 2WP3T 1XYCA 3PGDB 5IW6A 1KXQE 1W6WA 3T6VA 1L9WA 3DMMC 1B54A 5JW3L 2OOFA 4LL4A 5AAMC 1MJ8H 3ISIX 4L4VB 3ZRCC 1XINA 4Y4FD 3BLCA 4AC1X 5GGSY 3VIKA 4FXSA 4KKXA 4E42A 2QCMA 4F7EB 3RVVD 3MJ7B 1B0RB 1YA5A 3EJZC 5ES4B 2WBJB 3EYOB 3FXIC 2YL9A 4I85A 1I2PA 3H26A 3WKYA 2ARJB 1SOXA 1FG2A 4L4TE 1S9WA 5IWLA 3QFGA 4N0UE 4I3SL 2JFEX 3R58A 1OP9A 3FTZA 1QPRA 3RPDA 4CSZA 2FDMA 2Y7LA 3NQVA 4MWAE 1FFQA 1ZT7B 4BYHA 4PUNA 4MASA 3PNRB 4QUOA 2BNRB 4HIEA 1OFEA 4AY0A 4OE7A 2O92A 3WCYA 5E2TL 5D8JH 5CLZA 4TKWA 4G1EA 2FPYA 1JXGA 1F41A 5DI8A 4P2OB 3LZLA 1UYWH 2V5KA 5DJDA 5FI8A 1G7MA 3NCXA 4FG4A 3P0YH 3MUIA 3GMMA 5KVDL 3PFQA 5ID0B 3SJVE 1OGGA 1JCKA 1EGMA 1NM9A 3FB6A 1S2AA 1Y18B 3R1GH 2J75A 3ETBJ 2HK1A 5C2BH 2K3TA 1CD1A 1DFBH 3UO1L 3M0YA 4UCGA 3VFMB 4E6MA 1LL1A 5IEKB 3C61A 1UMLA 1DEDA 4B7LA 3GMRB 2N4IA 4Y9NA 4U6HA 4D0DB 2W0FB 3TYFA 1YCSA 3OB8A 5KSAA 2VR5A 5FEPA 3VFTB 1V08A 1LM1A 2QV4A 2CO6B 4P5SA 2VEGA 4KITB 1JRBA 2H7WA 4Y2LA 3FB5B 3MJGX 4DO5A 4N6EA 3WY4A 1PCSA 4H7CA 4F7TA 4JY9A 4MZYA 3WNIA 3TJHD 3KTSA 2E9JA 1UYQA 4LF3B 1P0EA 1D7BA 3GHPA 3VXRB 2WXFA 1WPCA 3IDIB 3NXFA 3WDHA 1TKWA 2VLMD 5CM1A 2ZUTA 1KXTB 4Z0JA 5FJUA 4L65A 4XD4A 1BTMA 1TVDA 3EJTA 4P4KB 4EI5B 1DYZA 2ZUMA 4JB9H 1VFOA 2ICEB 1NCOA 3QXVA 3PBUA 2ZX7A 2DWDB 2GB2A 4JFDD 1ECEA 1VGKA 1YIXA 1J12A 1SYSB 4G83A 4PCYA 1MI3A 1JRQA 1OAZL 1KBPA 5F70A 2ZTBA 5GS1A 4WV1C 5HHXH 1OM9A 3CUPA 4MZIA 4AQLA 5KSVA 2JB5H 1XUUA 5K39A 3P73A 2VD9A 2QJIA 2WY3B 1T4KB 5C0DA 1RAMA 5KANI 1EO8H 3TLQA 5JIWA 1AJ0A 3U1QA 1LQ0A 4D6HA 4WSJA 4Z2IA 4RGNB 1JCYA 3URQA 3DBPA 3EJRA 4PJDF 3EOOA 3KBMA 3C5SB 2Z7GA 2Z34A 2RD0A 5KZCD 4O12A 1VFTA 5D70L 2W79A 4DBUA 1QWHA 1U83A 4OF8A 3QY7A 3EEGA 2WYSA 4NAMA 3DDGA 1E65A 4AX7A 2X0WA 3WJYA 1MW3A 2IGLA 2DL2A 5IFJB 3SUTA 1BRLB 3EWCA 3W6YA 2H9GA 1AW1A 1S7RA 5LGYA 3GBDA 1OOWA 2NMSA 4FLOA 4NN5B 1ZCOA 2CIIB 3OV6A 2DZTA 1KV8A 5DSCA 5DD6A 4YSUA 2C3HA 2IH9A 4G9FD 3V9CA 3F12A 5IIEA 4ZMNA 1JCNA 4DVBB 2OTPA 3DJTA 5D7LD 5HJ3A 4E36A 2UV8G 4CNOA 4H13C 5H35B 4PMZA 3QS2A 3D51A 4IIFA 2R1NA 2OMWA 3ZGHA 3ZZLA 5BVPH 2NXZB 4KK5C 4OECA 1H8OA 4QF1A 4O1FA 3QJFB 3EKCA 5DZVA 4CSSA 1GTNA 4GLRH 5JOPE 4N85A 5BW7A 1PWMA 1HL8A 2VDKH 4MAUH 2R0LH 4IU3A 4OZHB 5DRWB 3ZUCA 4RZ4A 3QIUC 5FA4B 4POCA 5BRQA 1DHPA 3RUGA 3GIVA 1AFVH 2V81A 4DF0A 5TF1L 3G6LA 3CUZA 2BHFA 2BXYA 4AZIA 3KR3L 3RZCD 1WBZA 4OJZA 3QIWB 1DHKA 3RGVD 1TO3A 1F4WH 2FBJL 2B59B 2EKGA 3FY1A 4B50A 4E9VA 4Z7QB 4ABUA 5ITFA 1J8VA 4M3HA 1O6VA 1C9WA 5T26A 2A9CA 3TCSA 3EJSA 1D7FA 1UCBL 2YL8A 5JHLA 5I30L 4QXTA 5FUCC 3L12A 1NU5A 3BH9A 1X4YA 2QSVA 1SLUA 3OR7A 5IUSA 1XSJA 3SJ3A 4RIRB 4AW7A 3UCCA 3VXSE 3ITXA 2O56A 5J6GB 1G0CA 1IGIH 4RPQA 5IFPA 3N3TA 2H1XA 2QQQA 2J20A 3ARDD 4XBEL 1JPGA 2CGYA 1KRAC 1N5YH 3KD4A 3AW5A 5KTLA 1JWSB 3WIFB 1J5DA 4BBWA 4Q14A 1X1JA 5KBNC 3PL6D 3QHZL 2ZRYA 2XIBA 1E4WH 4PR5B 2HKHL 1ADQA 1ZP3A 3RVTD 3R89A 4NUPA 2DWYA 3L3HA 5F3BA 3NP4A 4U1HA 3AIEA 1NFIB 3G3LA 3QPQD 4KK8C 1E43A 3QB7C 4X4XB 1XIWB 4LCYB 2CKBL 1L6WA 2CUHA 5HNUA 4AYGA 3NYZA 8XIAA 5C3LD 1OAUH 5DC9B 3QPZA 3EO9H 1E6JH 3RNKB 2WW5A 3ML9A 5AVSB 2FMNA 3EJPA 1RPQA 4KKLD 4IOSA 2P52A 1JOIA 3OLEA 2JF1A 4L2YA 2EIMB 1TPXC 3BXNA 2Y7FA 4M6AA 2H5UA 4M3JA 4AMKL 4IXXA 3UZQA 2CYGA 2V5BA 4HW6A 1Q0XL 4HXAH 4MD5A 4AT6B 1BAFH 2Y6SC 5SWZB 3BJTA 3PWAA 2EIEA 4G8TA 4AG4H 4NZDA 2P5WB 3JW7A 1RVFH 3FT3A 4DJDA 1R5WA 2NW3B 5CINH 2C18A 3RYSA 1KKOA 4F7MA 2P76A 1SYVA 2QVHA 4XNUL 4PH6A 2E59A 1W72A 3OKOB 5K9QI 5IMKB 1P0DA 4XN4A 3W75A 2OMUB 4IU2B 1RWGA 3FRPG 2P3YA 4NEHB 1MZRA 5EF1A 5LAXA 4BSVB 2I60H 5F1IB 2XJLA 4FFZL 3G1SA 4O0ZA 4QRPE 3M9YA 3KLLA 4AIZA 2HLFD 2W60B 4PJHB 3TAKA 1FY6A 2G8ZA 1QLFA 3W7RA 3IS1X 2BIOA 2ENJA 3IUIA 2C9QA 2K4AA 2X09A 4ZBJA 3B9DA 3EDDA 4F0MA 2G5RA 2NY1C 5H2BB 2V30A 5DHEA 5IESL 1K9FA 2J1WA 4GC4A 2FRGP 4AQEA 3RWCA 3CXFA 1NUDA 1PQZA 3QWOB 3ETSA 4GKTA 3MO7A 3I85A 3OA5A 4RNHA 2XN0A 3BPWA 3KDPB 3AREB 3ABLB 3PAJA 3CNYA 4G1KA 3P77A 4FO4A 4OF3A 4X6FB 5HMDA 4EIBA 5IJDC 4NEIA 1SYTA 5EO9B 4XH2A 1ZHKA 1UT9A 1JXDA 3L1FA 1MMYA 1YJDL 5GGUB 4H04A 2VRKA 4U4IA 4MYXA 3DRQB 2DU2A 4B0MB 4IGBA 3M7OA 3DARA 3BGJA 1PW3A 5J11B 1YEEL 4DN3H 3MNMA 5K93A 1DUYA 4PTMA 3LKOB 4Z0XB 2MHAA 2O9PA 4D6EA 3MJ9A 3R0NA 2L0DA 1HNFA 1GUVA 1CXIA 3BL3A 1INQB 4IFOA 1X5HA 3WLRA 1A0QH 5D7IF 1ZLSH 2BSTB 3WK2A 1RK1B 1C8VA 3BH8A 1D5IL 4G8GE 3ZDZF 1ZOXA 5I6SA 1FIEA 1NF0A 2C9AA 1OCQA 1TCMA 5DDHA 3BGGA 1L9OA 1E4NA 2JV6A 4KCVA 2Q8AL 3C08H 3TEYA 3KPLA 3S4BA 5HDBF 5KG9B 3R8RA 4XAYA 3LXUX 3GYCA 4ORMA 4AWSA 3Q1SL 4KX8A 3SKNB 3MGOB 3NQBA 3RIAF 3CG8A 1F3JB 2GEQA 3RTQD 1N68A 1MJJB 5E08H 1SZNA 3ZO9A 2Y7QA 1CLVA 3OB0H 2L04A 1BDYA 2NY0C 4AGQA 4LHQB 3RNDA 3BKJL 3I2CH 2F5AL 2AMUA 3PPSA 2JJWA 4E4FA 2DQMA 4DOHE 1KMGA 2X30A 3UL4A 2BHYA 3EF4A 4M7LL 2QUVA 1CLOL 4BK9A 4OD1L 4L6OA 1NC2D 4IRJC 5I0WA 4LU0A 2O1AA 5F2LA 3HO8A 3NFNB 4AENA 3O3AB 1A6ZB 4ONGH 4ODSL 4D0BA 1J0ZA 2VDKB 3RX3A 2H26A 1NDGB 5ITBL 5KYYB 1UHVA 3PNWB 2VQ1B 1HCFX 2UZYB 3SCMA 1P4LB 4Q58C 1QHPA 5GGTH 1YEHL 4UMGA 2HCZX 5CGTA 1A6UL 1H5BA 5HJBA 2VAAB 1SXAA 4UQ3A 1QBMH 3GC2A 1GCFA 4JQAA 2GSEA 1GGIL 1ZA6B 4LANA 5EZIH 3LB0A 3BGAA 3RDTA 4Y9PA 5LNUA 4W5ZA 2PDHA 2E75C 1EUTA 4N22A 1I1AC 3SM0A 2XX0A 1JFHA 1LZOA 3T4AB 1PBGA 2L5HA 3MCOA 2RDXA 3OZ9L 5HI5D 3PZUA 1J0JA 5A6MA 5DRNA 2GDVA 1Y6NR 3FUIA 3D33A 4FMKA 4US5A 2DN7A 3GYEA 5B39G 3RGBA 4HUUB 5JYMA 2AJXL 3RLSA 2Q3ZA 2SEBA 2IJ0C 1FHLA 1DE4A 4NQEA 3TUUA 3A6BL 2WNQA 3EBGA 4Z2HA 4N2FA 2ED6A 3N41F 3SDCD 4Z76A 1DIKA 4LX4A 4GBXD 3I50H 4JK0D 4W81A 3BE7A 2CLLA 4XVJH 2L8AA 3FNDA 3MRNB 4ZMVA 3HPZA 2HUEA 4ZFMA 4LLQB 5CBEA 1MHPL 3GSNA 2JGYA 32C2B 1DVFC 5GSRA 3L5XH 1ID2A 2DQDL 2W9MA 4PGZA 4XWUA 4JQIH 2F54E 3TYGH 5EUOA 5DJAA 1V02E 1ASOA 3QFJB 1E6QM 1F4XH 1KLUB 1V93A 5FF4A 2E0PA 5AHIA 3MA9L 4AQ1B 2P7TB 3W0KA 4RAUB 3CQFA 1SEBB 5C2XA 4RE2A 1BM3L 4NM4L 3E1F1 2JWYA 5IW3A 4XMKH 4J4KA 1RWFA 4ERAA 3VSUA 1DE6A 3CSTA 4AVIA 3F8UB 2FBRA 4KV5E 5D2TA 4NX0A 4WHBA 2UY6B 4RV3A 5IG7B 4LCSA 4O28A 2CZEA 3HGSA 3OJDB 4LS1A 5FLVA 3NGJA 3II3A 2A4EA 2IG2H 2VDMH 4Y7EA 3QAZB 3VXMD 5KETA 1NEPA 1I9CB 4UV7L 2VLME 4EJ1C 4UTBH 1AHWB 1FAKT 3BKCH 2ITCA 5BXSA 1ID5I 2MPVA 1QLEL 1A4KB 2IDCA 3RVXC 4C56A 1AGEA 2PD9A 1T6WA 4X5WA 1GZPA 1KIQB 1AD9A 3K7UA 3VI4E 4UR8A 3MBFA 4DHLA 4EOUA 4YHNB 4H0HB 1FWHC 4RE4A 4P23A 1LDPH 1O60A 4PSRA 1T40A 4X0KA 1W0MA 5KBLA 3ZTNL 5FGCE 4Z0BH 3L5HA 3W22A 3L5MA 4X6EB 2GL5A 3AZUA 5EO1B 3MNWB 3FB7A 3RR1A 5I3JA 2OEJA 1BYNA 3G5YA 3NAAH 3VNLA 2DIKA 4RMRA 4NHUA 1IT8A 2X1XR 4QWWC 1H7PA 4DZBA 2GVYA 1PY4A 2X7LB 1Q66A 2J1KA 3V0WL 4BI6A 1J8SA 3PDOA 1BFOB 1UOKA 3LHVA 4HKBB 4OCXL 3S6OA 4AZBA 2YC1A 1XBDA 1FH7A 2J13A 3ABMB 4AITA 4HXBH 2EO1A 4KKNA 4JJ5A 3CWHA 2W65A 3QUXD 1S3KH 2VJXA 3B8IA 1IQDA 3WTVA 5T33L 4DK3A 3L4VA 4E5TA 1Y1DA 4UZSA 2VDIA 3KPSA 5FIPA 2VDNH 1KN4H 1SMAA 1WZLA 2N56A 2NUPA 2NQZA 4K07A 5GJSL 3GBMH 3S0PA 2ZUQB 4BE5A 1BSLA 1VCAA 4U3XA 3MUHL 5C0GA 5DA4A 4FCHA 3W0WE 5CP7A 1NGYA 1I8IB 1OWQA 3T04D 5FF2A 3CXDH 5D2LB 3AMOB 3WJLC 4JQ3A 4MMZA 4AU0A 3UH8A 4CQAA 4JDTL 2R2EB 1AY1H 1FG9C 3QQ4B 2ZD0A 4WJEA 4DCQB 3NEEA 4A6GA 1FV1A 4PGLA 2OMNA 1CZ8L 1L6GA 2OT0A 2B8OT 1TEYA 3E9UA 4KETA 4XZIA 1FGNH 4JFVA 1DP0A 5SV3A 2CA3A 2W6RA 5GVJA 2RDYA 3LKSA 4HUVA 2RFXA 4APQA 3ZR6A 4NUJA 4MADA 3LNGA 3MJ8B 2HFTA 1VC4A 1AMKA 2WLZA 1HP4A 4ORIA 3SGUA 1W80A 3K0YA 1Q90A 1PS3A 4P57B 4DN1A 4PJCA 3VA8A 5M5DA 2IGFL 3IU3B 3F00A 4NT6A 4XPGL 3WMCA 3NT0A 3GU9A 3LB6D 1ISWA 4DP5X 1HKMA 4LLYB 2VDLL 1KYFA 4JX4A 2A4ZA 5H8DA 4G6KL 1S7VA 2APWA 3IDJA 4Z7UF 3STEA 3O3BB 2APVA 2D7TH 3I3EA 4EDXB 3BZ5A 4B15A 2ZQKA 1ITBB 3W7GA 3SCOA 3E7JA 1A47A 5I71B 5ISZE 3BN9D 4ZO8A 4XVTL 4JFZL 5CG0A 2J72A 4QRRA 1NS4A 1UUOA 3U2IA 4NQDB 2YXGA 1ZVYA 2AQWA 4KO7A 2ED9A 1DYUA 2WB1A 3NWRA 1PG7L 1U8OB 3B5GA 5E5RB 2AGTA 2PBGA 1SQ7A 1KCXA 4HGMA 2FYVA 4WGKA 4BH8A 3M41A 4GZ7A 1QI3A 2PE4A 4Y4HA 1GQLA 4HU0A 2BSLA 1V7YA 3GG8A 3OLGA 1R3HA 3NQ8A 5KW9L 4RA3A 3PAYA 4LDCA 2MSPA 3KLHD 3E6HB 4Y19B 4NNPL 1LEIB 5LAPA 3ZE1B 3QJAA 4F2UA 3E0IA 1OAXH 3V5KA 5LXGH 4LAQH 1YMMD 1ONWA 3LEVH 2Z28A 3GK8H 4PJAE 5ICXB 1NDZA 4H19A 2ZRVA 3JVFC 4Y2WA 5FECB 3MA7A 3S1WA 1GC1L 3X11B 5GS2D 3DX5A 3EKLA 4QXGH 2JQXA 4GQBA 2J6EL 2Q76B 1E5ZA 3SO5A 4YDKH 4ZSUA 2VB5A 3NJNA 3BE1L 2IAMC 1HYSD 4JPQA 3H2WA 4HKZB 1NBCA 1G9NH 3BT0A 1Z5YD 5JDSB 3W11D 3KVJA 1IV8A 1LL4A 2BC4B 4GP8B 4OTXH 1PZCA 5AC6A 3HBGA 2Y7DA 4AG0A 1DXFA 1LJMA 4Q4OA 4OUIA 2AJSH 1UXSA 4BM7A 3PSVA 5DJYB 5E6YA 1ML1A 5K69A 1GOOA 3KIIA 2BASA 2W81C 3VSQA 2ID5A 1XBRA 3ROLA 2EEBA 3S8FB 1Q9OB 3SBQA 1YRRA 2VC7A 1IBGH 3MLUL 3EH4B 3CK0L 2LLNA 5KVGH 3DU0A 2RCSH 4N9GA 1E9QB 1SUXA 2PDBA 3SCPA 4Y2OA 4DP1X 2DI9A 3WFBH 3P30L 2J1YA 4FXKA 2YR1A 5JHDB 1TPH1 5IF0A 1N8WA 4MKSA 3QZOA 3LSCA 3O0FA 4ABQA 5I3KA 2OMYB 4KBXA 4ZXOA 3ELFA 3X14B 4G8FB 4LW7A 5EWIL 4AXKA 4PODA 43C9A 1KBVA 4UIMA 5DN1A 5BQ7A 5JHLH 1ECYA 5F2GA 5TF0A 3STCA 3G0XA 4KY1L 3H9SE 1K72A 1ENUA 1TVLA 5G4NA 3WN5A 4BCXA 2IOOA 5IW6B 3N1AA 2C71A 3O6FD 2EDRA 1CD8A 4J6RH 4Z7WF 4FIRA 2PUQT 4K9EH 4PREA 3BJ91 3HUJF 5E6ZA 4QXVA 2DORA 1H0DA 4E42B 4PL2A 4NC2B 2QPEB 1WYIA 2RGSA 1PPIA 1M56B 2FWLB 1W8NA 4DP6X 4MTVA 4BUGA 1ADQH 4PBWD 1QOQA 4Z0SA 1I1XA 5HY9A 3A4JA 4XMTA 5E00A 2EGZA 5GS3A 4GB9A 5ANMB 3EHBB 5EF0A 2CSPA 2HXAA 1FG2B 2ITDA 1PLBA 1GT8A 1ZE3C 4CNSA 1S9WB 2FTWA 5K5YA 3NBBA 4CCDA 3UY8A 2BSSA 1JHTA 3L9YA 5DY2A 1L9SA 1IU7A 2XIQA 1EPXA 1HP5A 2Q7NA 3ZTJG 4X8JA 5C0QA 2F7QA 1U92B 1W9VA 3CTLA 4TVPL 1JWUA 1AXTL 4IMCA 4IFRA 1GGCH 2XTJE 3E5BA 1QK0A 4HIEB 1NQBA 3WH7A 3VOCA 1XPGA 4G3YH 2NV9A 2VDNB 2CWVA 3LMZA 1HKJA 4EE9A 2HKFH 3FO9A 1USZA 3EW3B 4BWTA 4G1EB 4XCYA 3S88H 2NRDA 5C7HA 3B8SA 5DI8B 2WQWA 3ISYA 2VXTL 3L0GA 5DJDB 3IUHA 1ZVNA 3QIBD 1JHLL 1KZQA 1G7MB 4MCZB 3GMMB 3BQUD 2GK0A 2H8PA 3OKNA