4FNSA

Crystal structure of gh36 alpha-galactosidase agaa a355e from geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRLPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 232
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnsA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnsA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnsA02
2Y61A 2H3DA 3NZ1A 1PCWA 1WX0A 4W9TA 2QUTA 3LTSA 1P4CA 1Q6QA 3W88A 4RR4A 4MKNA 4PSPA 1H7NA 4AHOA 1NF7A 1GPWA 1PJ9A 1QDSA 1TREA 4KMQA 2YYTA 1QWNA 1GVIA 2B0MA 4AIOA 3M43A 1P1XA 1CGVA 4Q4KA 2DZTA 1SQ7A 3KE0A 4LS1A 4FNPA 3M5VA 4LW7A 3VMPA 1GG1A 3A9IA 3NL6A 5EY5A 3TSDA 3MHUA 2BZNA 3PF3A 4R34A 4Y8FA 2BY0A 4HA1A 1AG1O 1KFEA 4A22A 1SO3A 4J3VA 2ZRYA 2E09A 2NT1A 1MXDA 4EVZA 3NQ8A 1T96A 2ZA2A 1JXJA 4LTSA 2QCMA 4MZYA 1BSIA 1WBJA 2X16A 3KAOA 4HIBA 5EKYA 4RZ6A 4FXRA 3TQKA 5DXXA 1J0KA 1KM5A 3EXRA 4GUGA 3DKLA 1GTHA 1X8FA 3NPVA 3GDLA 4H3DA 2WKLA 5DFAA 1JXKA 5LSMA 3VE7A 3DKJA 4GUHA 3TMLA 3CTTA 1SMDA 1CXEA 1HL9A 4PEEA 4UQEA 5H91A 4U4MA 4NX5A 3W7PA 1HTYA 1EHAA 3NQFA 3UWUA 4UIOA 3BAIA 3LHZA 4I7UA 1Y0EA 4UTJA 3C8FA 3FKRA 1ZJIA 1FWRA 3IV3A 3HB9A 4JTFA 4WX2A 4LUIA 1EUAA 1OF6A 2V2HA 4MJZA 4K8EA 1H7XA 4LVFA 3PBUA 3WJZA 4AW7A 3STEA 1V7YA 4IJBA 2BXVA 3V1PA 3RLUA 4FLRA 5G4EA 1NVMA 2HTMA 3BSGA 2WNZA 2R8WA 4BI6A 1KLZA 2EPHA 1WP6A 3BCFA 2JKAA 2Z6IA 4MY8A 3W1XA 1HXKA 1TTPA 1XCXA 2OSXA 3L4TA 2CLFA 5DN1A 4XB3A 4JFTA 3ZOAA 3GKFA 3TQ0A 2DZVA 1GWJA 3W2KA 2AAAA 1OX4A 2QPUA 5LZLA 2E5CA 1VCVA 3NL3A 3VGDA 2D3LA 1A5BA 1I2QA 3T4CA 2Z2UA 3TFCA 5K2ZA 4Z0SA 1S5VA 5J5RA 2WO5A 3RK8A 2ALWA 4MZ1A 3A21A 1GZGA 5HQEA 2FLIA 2VOMA 1CDGA 3A24A 5I3IA 1F6PA 1L6YA 3HIJA 4K39A 1WE5A 4U33A 1E3ZA 1CXFA 2QR6A 1YYAA 3UCQA 2QF7A 2PRLA 5LHEA 1UJPA 1NSJA 3CZSA 1Q4NX 3L2LA 3EJRA 5CLWA 3UWYA 3WK1A 3KVKA 2A85A 4J28A 2Y62A 1NF0A 5HR6A 1P6WA 2GJRA 1O94A 2QMJA 4UTTC 3NQCA 1UH3A 2NXIA 4UCGA 3W1PA 4LRTA 1TQUA 1CI1A 1TO3A 3P60A 1UKSA 4JTHA 2FH8A 3NA8A 3BLIA 4FMVA 4JS3A 4QNWA 4DPQA 3W1RA 1C8VA 1VYPX 5F4WA 1XUZA 1KTNA 4JX5A 4NNAA 4AEOA 5LGXA 3KRSA 3DFQA 2ABAA 1KV8A 5I3FA 5E70A 3UG3A 2JKPA 3ZT6A 1K8YA 3C2RA 4CVWA 3L5AA 5E0FA 4O1CA 2YXGA 2NUWA 1LOSA 4UMBA 2ZZ6A 3TC6A 4UNIA 1IZKA 5TQLA 1RPXA 5I3KA 3FFSA 2XVLA 3S8HA 5DLCA 4E38A 4EWND 2X1SA 4FXSA 2XN0A 1MW2A 4LNYA 5DELA 2VUYA 1THFD 1HO1A 2PRMA 3F4WA 3HGOA 2X30A 3SECA 3CWOX 3W22A 3W72A 4PCSA 5CPLA 3E9AA 4GFSA 2OYKA 3CZGA 4WY0B 1FDJA 3VGFA 1KM6A 2XWDA 3LXBA 4DELA 4LVBA 4QJ1A 4UMCA 4UQBA 3O6DA 5LNWA 1QOQA 1QWUA 3ZQ9A 4O19A 2YW4A 3O16A 4PODA 5EBUA 3CQ0A 1PV8A 3RNDA 2UV8G 1JUKA 3FEMA 1VC4A 4X2RA 3L4VA 3B04A 3PAJA 1KM0A 1H3GA 2BY1A 1KWGA 1ML1A 5FESA 1QI4A 1W9XA 2HS8A 4WOQA 5C55A 1MFUA 4NJIA 1DJNA 3S1VA 1ADOA 3LV5A 5C6MA 1QO2A 4MIMA 4IXHA 2QJGA 1L9WA 5L6UA 3W7LA 4WXYA 5LNRA 5AHIA 1QAPA 1A5AA 2NWRA 3DI0A 1JDCA 4N4QA 3ABQA 3OA3A 4MY1A 2W6RA 3IK2A 3NPWA 5DY3A 1KFCA 2CLEA 4UTIA 1G94A 3NYZA 4UFLA 3FJLA 1PVNA 5D04C 4O8RA 2BY3A 3LHUA 3M6YA 3D51A 4JTUA 1JDAA 2QDHA 5CGMA 3G1SA 3O07A 3GNNA 4C1KA 2EADA 4Q32A 4X9YA 3C61A 3W7RA 3DX4A 1YTDA 2OT0A 1R75A 1TPWA 5G2WA 2X2HA 4WF7A 2A4AA 4M5PA 2V3DA 3IVSA 3VGHA 5DY2A 3SGUA 1G69A 4S2BA 3S6DA 5F2GA 3IJ9A 3WENA 1SW7A 3KOFA 3W7JA 1A47A 3ABRA 4NX0A 5DCDA 1S5WA 3CLMA 3QSTA 3LCIA 4MFDA 3W7HA 1SZGA 3O8AA 1F05A 2ISWA 2ZUSA 3GDMA 1I45A 3CZKA 3QH2A 1G4EA 4N9BA 2D0HA 2ZRZA 1HVXA 2B7OA 2ZQ0A 4ZL1A 1G1YA 2WC7A 4N6EA 1WPCA 1W3TA 1QW8A 3WK3A 3BMWA 4WD0A 3G3DA 1F73A 2E6YA 4XBKA 4IWWA 2VEIA 3E12A 4WJEA 3O6YX 3TONA 1EP1A 3TE9A 3AJ7A 1XBXA 2PRHA 5AOUA 1M53A 3CZEA 3DX3A 4DF0A 3AMKA 1SFLA 2VR5A 3TH6A 2YR1A 4O16A 2ZRXA 3NAVA 3KLLA 4YCOA 1KCLA 2HSAA 1TPUA 5AHLA 4YL2A 4ZMGA 3R89A 4MVAA 2AAMA 5CPMA 2C3ZA 4YCPA 4A29A 2WSYA 3VMNA 3G22A 2QJHA 4JL1A 4U28A 3UG5A 2DZSA 1PIFA 3MP3A 5AHMA 3D52A 1UH2A 1XD0A 3QYQA 4O0KA 4QM1A 4OGZA 4X22A 4UTWA 3STCA 1Y7VA 1Z41A 4RV8A 3OVRA 1WYIA 1KB3A 2J88A 1TTIA 1OVDA 3O6CA 1EO5A 4N9DA 4QQ3A 3S2CA 4B5NA 3L67A 3CGTA 3BAXA 2QCCA 3OLIA 1FWSA 2PURA 1JQXA 4JY9A 1TV8A 4CCEA 4DQWA 3LXCA 2Z0IA 3YPIA 1CPUA 4JIPA 4JY8A 3WMSA 4LS2A 2XWEA 3WJSA 2NWSA 2I1OA 3EJUA 3ZT5A 2E8YA 1M5WA 1IXPA 3W3OA 3ZSTA 1YXCA 1EO7A 3G1AA 1J0JA 2YW3A 1PS3A 5IBXC 2Z6JA 3QEZA 2BWGA 2E0PA 4QISA 4JTJA 4Y90A 2D3NA 1XBZA 2NX9A 3VMOA 3MI6A 4L4LA 3STFA 1MO0A 3M44A 1SZNA 1H63A 3OBKA 5BRBA 3ABOA 2H8ZA 5AN7A 4Y6GA 3VCRA 3TTYA 3IVTA 1RP8A 3O06A 1I75A 1P5BA 2A7PA 1GCYA 2WJZA 4OU1A 3EEGA 3DHFA 1JCNA 1K02A 2QKFA 2Q3OA 3W37A 1B0IA 3MUXA 1OG0A 4WY0A 4IOTA 1VR6A 2ZFAA 1L6WA 5D2VA 3EDFA 2NX1A 4O13A 2JK2A 4I7VA 4XTIA 2GUUA 1OF8A 2QEZA 1FDZA 4Q33A 1XSKA 4FX8A 3CIWA 1FY6A 5AHNA 4KWWA 2B7NA 2Y24A 4JYDA 4CQ8A 2ZXAA 4D2JA 4BWLA 5HPOA 3WDHA 3M5YA 1PIGA 5KEZA 1R2SA 4YMZA 5I3HA 3DFSA 3HPXA 2RDWA 4MZ8A 4HHPA 4DBDA 1DL3A 4BFAA 3OHIA 3DFOA 2V5LA 2YGYA 3W07A 3K30A 3P62A 3R12A 2CW6A 4H8VA 1XSIA 2Y5EA 3PM6A 1B9BA 3CEUA 4K36A 2C1HA 3QZEA 3BCDA 3P67A 1TB3A 2C14A 3INPA 2ZUVA 2DORA 3RMJA 1UD3A 1TMHA 1CGWA 3LCFA 1EEPA 4RXFA 4UNKA 4AWSA 4DBEA 1O5XA 3QQ0A 5HUPA 1VH7A 4ZQOA 2XVKA 2Y4SA 1F74A 1E43A 4IMGA 2VFHA 4UFMA 1TJRA 3RU6A 1CYGA 3W2MA 1M7XA 2ABBA 1GVOA 4KWUA 2WSPA 2F61A 1W3NA 1ZENA 1ZJAA 1KM4A 3P5YA 4K7VA 2NZLA 4PTNA 1TPEA 1MFVA 3K1DA 1VJIA 3ANYA 1QWGA 3NZRA 3W2NA 2XFWA 1H7RA 4POCA 4UTMA 3OLEA 4GUIA 3A4AA 1GVRA 1OGSA 3RILA 3P8JA 2VT0A 4JX6A 1QPKA 2J9ZA 3C4UA 4XZ9A 1DHKA 4K7YA 4OT7A 3JRKA 5FI8A 4O15A 4OWGA 1OX4B 3M9YA 3E0IA 4AH7A 1AK5A 1IXQA 1YPFA 1LWHA 4U3CA 3BLEA 4IMCA 2QAPA 2ISSA 4MUZA 4KFPA 4DF2A 1G4TA 1I2OA 1MWOA 3W76A 1KV5A 1WBHA 1XDMA 5LNUA 3BV4A 5E9AA 5AYZA 5FF3A 4DF1A 1U83A 4GQQA 1CXKA 3IGSA 4E0CA 2E5BA 2ZZ3A 4H8UA 2OYLA 1LDCA 5D38A 3LOTA 1KBIA 1HG3A 2CLMA 3A5VA 3HPSA 2Y2WA 2V5BA 1TTJA 3CT7A 1LOLA 1GYNA 3HZ3A 1PE1A 1LBLA 1ME7A 4X9SA 3F4NA 1BLIA 2FPVA 3W6YA 2VXNA 3ZWSA 2WVSA 5A2AA 1UA7A 2AMGA 3M5ZA 4HOWA 1NAL1 4ORMA 3B06A 4O11A 2YFNA 2B7PA 3P7YA 3TX9A 1C9DA 4FLSA 1D3GA 1TCDA 3VNDA 4GUJA 1JGIA 1DTUA 4UOZA 3TIMA 1V3MA 3S5YA 1ODUA 3LCXA 1C29A 3OG3A 1J4EA 1VRDA 4XUGA 3UXDA 1VHCA 4IX2A 1QR7A 3W7NA 1JRBA 4A3UA 3W38A 4NJGA 1GVQA 3NL2A 2GVGA 4K8HA 1JD7A 2BY2A 4U2ZA 2HMCA 2QPSA 1VIWA 3TJXA 3CM4A 1KXTA 5G5IA 1RQBA 1JL8A 3WDIA 2IQTA 3IIVA 3T44A 3EWUA 2ZUTA 1H61A 3TCEA 2RFGA 2VENA 4L4MA 1EUNA 4LOCA 3LRKA 1M7PA 1YDOA 5K9DA 1JJKA 1FWWA 3ZT7A 5D33A 2D0FA 3KL0A 3BUDA 4JX4A 5KINA 3GAYA 1F76A 1ICQA 1LTDA 1ZALA 2FDSA 1QI5A 2H90A 2J9YA 3UZJA 4GE8A 2JKEA 4O54A 1TCMA 1KXHA 2QCHA 4QAIA 1XFBA 3RIKA 1G7VA 2B4GA 4M19A 2FTPA 4CN4A 2PWGA 1ZFJA 3VGGA 2DH2A 1XH1A 4GI8A 2C0AA 3KEHA 3VSTA 2ZYFA 2BXZA 3GXPA 3IGXA 3KVMA 3DI1A 3W7QA 2FGZA 1W0MA 2RHGA 1PAMA 4RXGA 3G3MA 2AQWA 4MJMA 5IM51 1YDNA 1DORA 4IUOA 3B05A 1JULA 1EWDA 1H1YA 5D2XA 3B0UX 3S1UA 3HOJA 1YDVA 3ATZA 3N9SA 4NQ1A 4OHQA 3W2UA 4FB7A 5K3VA 2RH9A 3BVTA 4OIFA 3BAWA 2F1AA 5CGQA 1A5CA 3L5LA 3M5XA 2GUYA 1XGZA 1P0KA 4GWEA 4TR9A 1LRNA 1OX5A 4AHQA 3TJLA 2YSWA 1ME8A 3FAXA 4KFOA 4N9EA 3KVJA 5C5YA 1CLVA 3G8RA 1WZLA 1OYBA 3G18A 1SO6A 4IQLA 5LNSA 4PFMA 2YKKA 3BVUA 1JDDA 3TXVA 3UY8A 4H2CA 3LI0A 4NU7A 5HNRA 4O14A 5EMUA 1PHQA 2E6AA 5AB3A 1KGWA 2A5HA 3P5ZA 4O53A 3PY2A 5CPNA 1Q3NA 3BLBA 4GQRA 1JUBA 5CZSA 1LCOA 4GRSA 1BVZA 1MSSA 4ZVJA 3MO7A 1GJUA 4O10A 2VFEA 3CB8A 5A8GA 2G5WA 5T26A 1TQWA 1K7EA 3BUBA 3EJSA 4J9JA 2CHNA 5I24A 3IJ7A 3BLFA 4EOUA 3N19B 1DV7A 4WLCA 1RD5A 1TV7A 3NM3A 4UQ9A 2FE0A 4LC8A 1WXJA 3OEXA 1OT2A 1SR9A 1LYXA 3FS2A 4AYSA 3N9RA 4A2SA 3L21A 3RF9A 1LWJA 3W23A 3GXTA 3WFAA 4M6VA 4UUIA 3EDEA 1OT1A 3WN6A 2BHUA 1HL8A 1Z32X 1N55A 4FF7A 4JFSA 1K7XA 1QFEA 4LC6A 1UA3A 2A1YA 2QCGA 3CPRA 1X6UA 1WQ5A 4G1KA 4QSHA 2X2IA 3GVGA 2C19A 5LHFA 2ZZ5A 3C0JA 1HL2A 1OK6A 4UTHA 4IMDA 3SR7A 5I5RA 1JCLA 2EF9A 4UR8A 1R2RA 5HJLA 3VSUA 3HG4A 1AL8A 1W5OA 2DU2A 2QCLA 1XH2A 3TA6A 1BTMA 1A53A 4GIAA 2ZXDA 5AYXA 4CCDA 4UOQA 4JICA 1NM9A 1BG9A 1LLZA 3IRDA 3U6WA 2ZX9A 4CN6A 2G95A 2YPIA 2FJKA 3DX2A 3H54A 3ZSSA 5FEPA 4WOZA 3W1QA 1TTQA 3W87A 1YTEA 4P2VA 1I4NA 3NG3A 3C56A 3B0PA 1QHPA 4HKPA 2WANA 2Y6ZA 2GVJA 2WPGA 3P81A 3LCGA 4MOZA 3G0SA 4ADTA 2C7FA 3QMTA 4JGDA 3TROA 4HNVA 5HWNA 1F7BA 1VCFA 3CLWA 2WQPA 4LUJA 3EJTA 3B03A 5AHEA 2RDTA 2WKJA 3Q37A 4J3WA 1MXGA 1FCUA 2ZA3A 1LOQA 4J27A 4ATWA 4ZZ9A 1BPLB 2VEPA 3OVPA 5BOOA 4JTSA 3I65A 1K8ZA 4AF0A 3EJQA 1GVSA 2R91A 1QO5A 2WSKA 1IXOA 5FF4A 2QMKA 4AYGA 3VX0A 4LU0A 2A2IA 4M7TA 5F2LA 4RCXA 3S0CA 3QFEA 2D73A 1KTCA 1ONRA 3L66A 5HINA 5F4XA 3MJYA 4GXMA 1PHWA 2RKXA 5A6LA 2WVUA 3QW3A 1E40A 1KGUA 3SFKA 3BVJA 3K8MA 3HGSA 3TW6A 2J6XA 1IF2A 3LXAA 1SZEA 3PWAA 1LP6A 3TAOA 3OLGA 2ZX5A 4JCLA 4UTLA 1Z42A 4NXKA 3W1MA 1ZAIA 3PSVA 3L9CA 3TKFA 3DC0A 3NXFA 3GBDA 3PSWA 3BSHA 3EDKA 4KKXA 3N73A 2P10A 2WVTA 3IEBA 4CNPA 5BMWA 3UERA 4QITA 3HJZA 3TC7A 1GJPA 4H6KA 3MP4A 3HO8A 4BI7A 2IGTA 1UUOA 4TMBA 3D0CA 2QCDA 2YOCA 3TTSA 3MWAA 1FWNA 5EA9A 3TNOA 1DKWA 3W84A 2VEKA 1VLIA 3QW4B 3WJYA 4FNQA 4NVTA 1XV8A 1BAGA 1OABA 2E6FA 3TR2A 3HGRA 3O05A 3DHDA 4JIQA 1VJSA 5A5WA 4AMAA 3I68A 3KVLA 3MBDA 3DDGA 1QPOA 2C18A 4JR5A 3GYEA 4YWIA 5SWUA 1W5QA 3PBVA 4EF8A 4DO4A 3HG3A 3HPZA 5KZEA 5E0KA 1WO2A 7TIMA 3EXTA 2VFGA 1U2YA 1WAUA 4FHAA 4UTUA 1TPB1 4JD4A 1I8JA 3W85A 3W1UA 4IX0A 1QMLA 2Q3RA 2ZXBA 2J9XA 2WSQA 2F7QA 2X1RA 2FHCA 3DDFA 3NR0A 4MLJA 5AC8A 3Q58A 1CGUA 3BW2A 1OHLA 2F84A 5L9FA 5HR7A 1EPXA 4RK8A 1EA0A 3HG2A 3GXFA 2QUVA 1LROA 1WDWA 4NNCA 1G6CA 3VM7A 3SSJA 3BH4A 1RP9A 4RJEA 3UWWA 5BNKA 2XIBA 4H8HA 3LBCA 3B8DA 1R2TA 4DPPA 4JXCA 2EAEA 3S1XA 4ZQCA 3UPBA 1VZWA 1F5ZA 2BLEA 2PCQA 2Q8ZA 5C2XA 2X2GA 1JFHA 1O60A 3WY2A 1AVAA 1VYSX 3NQ2A 3NQDA 4IMFA 4IXXA 1P0NA 1RZMA 5K4ZA 3WJWA 3K8LA 4PA8A 5HUOA 3PG8A 1B3OA 4E2DA 4ML9A 1CXHA 1YXDA 1GYLA 4OE7A 3HJEA 3BVXA 2ATSA 5CSSA 3HQ1A 5D2WA 1G4SA 3VU2A 3WY3A 1NEYA 2YZRA 1LBMA 3CZNA 3U2OA 2A6NA 3ZWTA 1U5JA 3A22A 2GJPA 3LPPA 1I2PA 3C2OA 5U4NA 2TRSA 2QLYA 1HX0A 3CWNA 1ZNNA 2C6QA 1XBYA 3NQ7A 2ZBTA 3LDVA 2Q8LA 1HWWA 2V8ZA 4PL2A 4U2YA 4K38A 2GQAA 4LY8A 5AFDA 2QCFA 1GJWA 4O4VA 2CLKA 3IIOA 4UFJA 1YTKA 3PBYA 2FQIA 2LLEA 5CZ0A 3DX0A 4GI6A 3TXZA 2EQDA 2ISVA 1F6KA 1KA9F 4TVUA 5FF2A 2FB3A 4MLRA 3L2MA 3IGUA 2BHYA 1D9EA 4BWLC 2BHZA 3G0UA 4PSRA 3M7WA 1MW1A 1FXQA 2CFFA 2DZPA 1SO5A 3DZ1A 3G1XA 4N9CA 2ZICA 1BWLA 2GOUA 3JS3A 4UXDA 4FLQA 1IIHA 4Z1BA 1YPIA 2CZ5A 2J24A 2VELA 1FQ0A 1UD6A 3WNLA 3W71A 3KL3A 5F1UA 1ICSA 2G97A 3MI2A 5MHBA 2CZEA 4PL1A 5DBTA 4AB4A 4A21A 4AWUA 3GXNA 4O18A 1FX6A 3THAA 2OZ0A 6TAAA 4O0ZA 4H4IA 1LZOA 2O7SA 3OIXA 3W75A 4M56A 2NV1A 2XN1A 1OFPA 3W7MA 3KLKA 1G4PA 4I7WA 3UNDA 4ZQRA 3WK0A 3K8KA 1K8XA 1B2YA 3BK0A 3EXSA 1JR1A 3N34A 1GT8A 1K03A 3KL5A 3MYOA 3NEVA 2E77A 1W1ZA 2GVYA 3QC3A 2YX0A 2V0TA 4JCMA 3W7EA 2DJLA 2V3EA 2VEMA 3SY5A 2G96A 1XM3A 3P82A 1CW2A 3W2JA 1NOFA 4HNNA 5IBXA 1D3CA 4CCCA 4CN1A 3UQNA 3ZR4A 3KRUA 1SW3A 3EX3A 4GI9A 2QJIA 3W1LA 1XCFA 1PPIA 1H7PA 3DENA 2F7FA 2JGQA 3FIGA 3LTPA 2O7QA 2CLHA 1OFOA 2VFFA 6ALDA 2PWEA 1H7WA 5A2BA 3NPXA 4AWTA 1QX1A 3G1DA 4NJJA 3BMVA 3BVWA 4GINA 2VRQA 4UZSA 4Z1DA 4J3UA 4EF9A 1TQVA 3VSVA 4PCFA 3D4ZA 3NQ6A 1KLYA 1YXYA 5KSWA 4FX6M 1QCWA 3PR2A 4Z0JA 4FNTA 2KZHA 5K9CA 1EWEA 1X1OA 2V3FA 2DJXA 4GO8A 4NXSA 1JCJA 2ZXQA 3L65A 3NQVA 1KFLA 4JTKA 2WKGA 4HT3A 2J25A 4JTTA 2R94A 3SIZA 4GUFA 3S5ZA 2WOQA 4IPIA 3IIPA 1UCWA 3C52A 2DZUA 1GQNA 3F1QA 2VFIA 1IXNA 4NJKA 1DEDA 3VO0A 3SI9A 1L2UA 2NSXA 1F2JA 1WZMA 1X7FA 5E93A 4CKQA 1RQHA 1ALDA 2GPTA 3GDKA 5HDRA 4XBSA 3VI2A 2CU0A 2VFDA 1MZHA 3GX9A 4UZUA 3G1YA 4TMCA 1OYCA 1XD1A 5D2TA 1Q45A 3LI1A 3ZR5A 4N4PA 3AXIA 2BSLA 1W5NA 4NT0A 3UPWA 1JF6A 4PEKA 1MEHA 2TPSA 1N8FA 4O1DA 1W37A 5HWJA 4ICNA 1Q6RA 2Y7DA 4FO4A 4QAWA 4LWWA 6TIMA 2FIQA 1QNVA 4LVDA 2A6LA 2TSYA 2PWFA 3DAQA 4CNOA 5D30A 4DEFA 4E2BA 2PE4A 5FEWA 1FCBA 2OSWA 3DXIA 3PUOA 5CSRA 4O12A 1GVFA 1B57A 2X2JA 3LX9A 3MP5A 4WZHA 4I9AA 3TK7A 4JFVA 2F7PA 1S3HA 2EACA 4DO5A 1BWKA 5I0DA 3BC9A 2GJNA 3C2EA 3LRLA 5J5DA 3A5FA 3MBFA 4ALDA 2EGZA 2EHHA 3BG3A 4HNUA 1PIIA 4HP5A 2H3BA 2WCSA 3BGJA 2EKCA 1L0PA 3FW6A 1XXXA 5D32A 5K7JA 3IVUA 3CEPA 1OFDA 1H60A 3G1VA 4X0NA 3TV8A 1KWKA 2YYUA 1QW9A 4CLMA 2NV2A 3W7DA 1GTEA 1KBBA 2V9DA 3GBEA 1OFAA 1EH9A 4UMAA 1JD9A 5FF0A 3LHWA 1TPC1 1MXSA 4JNMA 3W7OA 3EWWA 4U31A 5E6YA 3E49A 3GXMA 2QUUA 4JTIA 4OBTA 1TJPA 3KHJA 4OQVA 4S1FA 3LCHA 3UWQA 1VFUA 4KWVA 4TO8A 5K4XA 2BTMA 1JI2A 4AF0B 1W5PA 3G1FA 3FAWA 3GK0A 3L4UA 4KFNA 2ZA1A 3CPUA 3MHFA 1PZ2A 1CGTA 3EKLA 3TW7A 4AIEA 4LV9A 1SMAA 2I14A 4HPXA 3HG5A 2EJ1A 1KFJA 1PCKA 2TAAA 1WOAA 2DP3A 3WNNA 3A47A 1TRDA 5E1QA 2VC6A 1UUMA 3I7RA 3G24A 3TU9A 1FCQA 2C13A 2CLIA 4LRSA 3W1NA 3W9ZA 2Y85A 3BUPA 2ZRVA 1B4EA 4ADUA 1DHPA 4UFHA 3VFLA 5AC6A 4UTKA 3FYOA 3S5OA 1CIUA 2YJQA 2F7OA 1VAHA 3KRZA 4PH6A 3GR8A 5D37A 5F2IA 2NXHA 4O57A 1WZKA 2GVLA 3SJ3A 3WK2A 1WZAA 2F7RA 2EEXA 4J3TA 4PCTA 2F1BA 2G3MA 3AJXA 3BG9A 2NUXA 1T0OA 2YA1A 4BR1A 2GQ9A 4CQAA 4IMEA 1HNYA 2WV8A 2E68A 2QCDB 2EAWA 3SZ8A 1VPXA 4N02A 4UQAA 1R47A 3L4XA 1Z48A 4AMWA 3SGZA 1JCMP 1XKYA 1CGXA 5EMYA 4H7VA 1W54A 3F03K 4OKDA 3GTNA 3I7QA 1IGSA 2FFCA 4BF9A 4OJYA 1RV8A 4UC5A 2V81A 3LCLA 3KXQA 2FB2A 3NQGA 4JDBA 3UY7A 1R46A 2YCEA 3DU0A 5D2YA 4O50A 1UD4A 1EA9C 2FH6A 3C2VA 4WSKA 3M0ZA 5F1VA 1CXIA 4JL2A 1V3JA 4FLOA 5DO8A 5HXMA 3Q94A 2PWDA 1JVNA 1D7FA 5LGZA 1L6SA 3M07A 3GDTA 1EIXA 3CZLA 1QI3A 1VB9A 1BF2A 1KW1A 1K7FA 4GO9A 3TSBA 1KM2A 1ZJBA 3WNMA 2Y7FA 4HOXA 1T99A 3CU2A 2GJLA 2WVVA 1KXVA 3T78A 3UD6A 1KBKA 5LKYA 2OSYA 4JYEA 3USBA 4AHPA 3UEQA 1TRIA 1W3IA 1LORA 1J5TA 2NLIA 3N3MA 1FBAA 4LV4A 2ZE0A 2WCGA 3WFZA 3P84A 4B9ZA 3GXIA 3PULA 2Y7EA 3P74A 4HSOA 3LLFA 3ZR6A 4CNNA 2OMAA 3FYPA 4R53A 1H51A 3W7KA 3PS7A 4JN6A 3GZ3A 1QPNA 1UB3A 5AYYA 5I3JA 1O7DC 3C3NA 3E96A 3EWZA 4RKAA 2ZTJA 5AHFA 3LERA 5KZDA 3I7SA 4FEZA 2VRKA 3M47A 1JG9A 3GR7A 1KCKA 4M7SA 4LQ1A 1EP2A 2OCZA 3BUQA 3DBPA 2H8XA 1AW2A 1KM1A 4UCFA 4QNEA 3W1AA 5TBOA 5HWMA 1BVNP 1S46A 4BK9A 1KBJA 3BLKA 3N2XA 1CGYA 3W74A 1M6JA 2CLLA 5F7UA 3QF0A 1ZY9A 3D4YA 1VS1A 4JFWA 1DOSA 1DJQA 3VNYA 2E5DA 1WA3A 1G7UA 2ZDRA 4NZJA 2OW7A 4W93A 2W79A 4N2YA 3GDRA 1YADA 1TPDA 2WSRA 4GC4A 5DBUA 1OB0A 3S42A 1QOPA 4DO6A 3TQVA 3HBLA 4O28A 1UASA 3MW7A 3W2LA 4NI3A 3L0GA 2HS6A 4J3SA 5HMSA 4BA0A 1H5YA 1XDLA 3PG9A 2ZX7A 1VFOA 5EL1A 3FLUA 3L68A 2CPUA 2YIHA 1U30A 4UQDA 2OW6A 1AW1A 4E2OA 3NNTA 2X1UA 5EYWA 4WY0F 5F4SA 3L4ZA 1O95A 4ZQMA 4UQCA 1HO4A 5KITA 1JCXA 2XVGA 2ZUWA 1IZJA 3O1NA 3AO0A 1JF5A 1AL7A 9CGTA 4RZ4A 2A0NA 3R2GA 1DQXA 4O52A 3T40A 1FXPA 3WNKA 5GVJA 3CC1A 4XWUA 1ME9A 3TMQA 1MEWA 1VYRA 4OV9A 2J27A 1AQHA 1VLWA 3G1HA 1OSEA 1QPRA 1J2WA 1XSJA 4FIRA 3GIYA 5A6MA 3D50A 1UBSA 7CGTA 1XI3A 4JTLA 1R34A 1ZS2A 1TQSA 2DZWA 4FNSA 4MAZA 4K6AA 1PL9A 2Y7GA 2ZCGA 3IJ8A 2VKZG 4AEFA 3FJ6A 2ZWYA 4B9YA 1IIGA 4UTTA 1LBFA 4NNBA 2E6DA 1CX9A 4YXGA 4R33A 4GJ1A 2FHFA 3TAKA 5D09A 3LB0A 1UOKA 3MI3A 4ORIA 3TSMA 1T8XA 2A7RA 3EX1A 4M8UA 5G2HA 4TIMA 3O15A 3PUDA 1TQXA 1SUXA 5G1TA 2QCEA 2VNCA 3RFAA 3VM5A 1E51A 1TMQA 3LGEA 3LPOA 3WEMA 5I23A 3DGRA 3L0KA 1JCYA 4EIVA 1BKSA 2DZXA 2ZUUA 2DIEA 1R33A 3UZ5A 1FDYA 3LHTA 4PC8A 5TD4A 3WJXA 3OLDA 1LRQA 4UFKA 4M6QA 3ZFHA 3Q2DA 2G3NA 4O1BA 4RLIA 4AXKA 4YLWA 5D02A 3WELA 1SZFA 3QPZA 4HN4A 3B0VC 2OX1A 3BGGA 4GNJA 4GBUA 3FA5A 4XKYB 1MEIA 3QMSA 1VFMA 3LLDA 2ATMA 3M41A 4ZQNA 1MW3A 2R14A 1LM1A 5LNVA 3QPYA 2Y88A 2V82A 3GNDA 3IIZA 4LPCA 2TMDA 1ZAHA 4MFEA 1AMYA 2RDUA 4S2CA 3WDJA 4WUIA 1UD5A 1O4UA 1SO4A 1PZ3A 3PBWA 3QM3A 5DCBA 3VKJA 3JR2A 1E3XA 1U33A 3PB2A 1HT6A 3NDOA 3H53A 1LRTA 1EB3A 7TAAA 8TIMA 3R13A 2Y63A 1JRCA 2CZDA 3QMRA 3LHVA 5KMYA 1UKTA 5BW6A 4UTWC 2EABA 1SFJA 3AXHA 1OK4A 3TFXA 1KTBA 3EWBX 2Z1KA 5FEXA 3T7VA 3ABSA 3W7GA 1SW0A 5KTLA 4JYFA 3NL5A 4DXVA 3EKZA 1K3UA 4Z1AA 3LHYA 1XUUA 1TV5A 4ADSA 2V2DA 3L2IA 1UD8A 5BRQA 2P0OA 4O17A 4Z1CA 3LTYA 5D03A 1KFBA 4JEQA 2ZZ1A 3S5NA 3A23A 1HTIA 2FHBA 2TYSA 3WY4A 4MB1A 3EDDA 2DH3A 2JGYA 1A5SA 3S9YA 4M6PA 4HNTA 3ECQA 1I2RA 5AC7A 2ZZ2A 8CGTA 4CQ9A 3P80A 2FPYA 3LRMA 2F18A 3QJAA 3W73A 2BX7A 1H7OA 5H2ZA 1Z44A 3GKAA 1MVYA 2I9EA 4NZFA 3QQ1A 4FNRA 2WNQA 4X3ZA 3W7CA 2ZX6A 3CV5A 2H6RA 4FX7A 4BZYA 3GAKA 1WV2A 2XIIA 4JTEA 1XBVA 1SPQA 1JQVA 2QAFA 2C8NA 1YLVA 3I6RA 1LLWA 2ZRWA 1UD2A 1TPVA 3BG5A 1RR2A 1H62A 4AEEA 1WOBA 3W86A 3A6OA 5BRPA 3VE9A 4LVGA 3SW6A 4XTDA 6CGTA 3BPWA 3O63A 3WEOA 4RZ5A 3UYCA 2ZX8A 3GB6A 1EP3A 3EWYA 2X1TA 1M7OA 5BMXA 4K37A 2ZZ7A 3HMJG 1DQWA 3WNOA 2W0UA 1TPH1 1RPKA 3LBMA 5DCEA 5C54A 4IPJA 4LXFA 4GKLA 3NGJA 2YA2A 3L4YA 3VGEA 1DVJA 3QRHA 3KFTA 1OFQA 4TX9A 5CGTA 3V75A 4WXZA 5A2CA 2OJPA 3DFNA 2OYMA 5CPOA 2YDAA 1UH4A 1FCVA 4J7RA 4TU1A 2E1DA 4BI5A 1GOXA 5CG7A 3PVFA 3PC0A 2PWHA 3BO9A 3CHVA 3BAYA 2E8ZA 4QIUA 3N14A 2Y89A 1W56A 4ZQPA 3W1TA 3L5MA 3VX1A 3NOEA 3ELFA 2NXGA 1VHNA 3W83A 4AVFA 4WSJA 5D05A 1AQMA 2V30A 5CXPA 1V5XA 4HPJA 3TDFA 1OFRA 1V3KA 1VGAA 3BUIA 5K9XA 3NM1A 3G8EA 4LS0A 2V2CA 1X1ZA 3DX1A 1H50A 3HGJA 1XL9A 1W8SA 1ZAJA 3M16A 3QSRA 4LVAA 2EO7A 3EX2A 3P61A 3S1WA 1JI1A 1QHOA 3BAKA 1JUEA 1TYGA 1ICPA 3FOKA 3T55A 5KZMA 4RX0A 4P61A 1B4KA 2WNWA 5G2IA 4O4WA 1TPFA 3OVQA 4Y96A 1XC4A 4XKYA 2C16A 4A2RA 1FUYA 5F2MA 4AMXA 2QCNA 3KWXA 3GXDA 3TOPA 1OFEA 3PUEA 5I3GA 4CGTA 1EX5A 1G9HA 2WPBA 3KX6A 3IIXA 4MY9A 4MYAA 1HFBA 2QDGA 3L0NA 1KXQA 2QV4A 3DFTA 3MMTA 1CXLA 2YFOA 1GG0A 3MHGA 3TUUA 2E9BA 2FPTA 2ALDA 1PEZA 3NQAA 3MYPA 3LM7A 5CLTA 2WVVB 3H55A 3DHPA 1TIMA 4UNLA 2ZIDA 3BLPX 4HOZA 3GLCA 2CWNA 3THQA 2AGKA 2Z1BA 3W70A 5FF7A 4HSNA 5G1YA 1UKQA 4IGHA 3NVTA 1KM3A 2BXYA 3P8IA 4O1AA 3LV6A 2E4TA 2P1FA 4UR7A 3M1ZA 4JFUA 2NX3A 3EB2A 3FKKA 2B7QA 3C2FA 3QGVA 2FYVA 3VNZA 1AW5A 1OX6A 4MPQA 1RQEA 5TIMA 1SU5A 2NUYA 5FEZA 2A21A 2DIJA 5CZJA 1OYAA 3EWXA 1NFBA 3BARA 3NO5A 1HUVA 1KGXA 3BW4A 3EJPA 2C15A 3AMLA 1V3LA 1XH0A 3PB0A 4MYXA 3II1A 5G4WA 3ZO9A 5EPDA 2YA0A 3CIXA 3ATYA 3NQMA 3L4WA 4N6FA 3R8RA 3E02A 1C8QA 1KFKA 2OT1A 3R5EA 4R7JA 3RLVA 1Q6LA 1TSIA 5CZTA 5CKSA 2D2OA 1TQJA 4JTGA 4C1LA 1BEUA 3BW3A 1FWTA 4OV4A 3DH7A 4UFIA 4J3XA 4AAJA 4FIQA 3UXAA 3DHUA 4JDYA 3NPUA 1H1ZA 2CZFA 3UG4A 3VGBA 1QPQA 2D0GA 1G67A 3EX6A 2A7NA 3N2MA 2GQ8A 1ZHAA 2CXGA 2WNNA 1SSGA 4NJHA 1O5KA 2F2HA 1Q6OA 2Y70A 5ABTA 3NQEA 3C6CA 3G0XA 1JAEA 1J0HA 1R30A 2ZTKA 5DXYA 1G5AA 2XN2A 4FNUA 1W31A 3EX4A 3W7IA 4LT9A 1MW0A 3CTLA 2ZZ4A 5E6ZA 4HPHA 4XQ6A 3EDJA 3U8GA 3BAJA 1JIBA 1GEQA 4NUWA 5U7SA 3WY1A 1N7KA 1VQTA 1D3HA 1OJXA 3LCWA 1SSDA 4ONVA 3BVVA 2NT0A 1AMKA 1A50A 4Z08A 1S5TA 3DFPA 2CLOA 1IV8A 1W5MA 3UWZA 1VCGA 3HF3A 4Y9AA 3B4UA 3UWVA 1ZCOA 1OFBA 2JBMA 4WQ6A 1XCWA 3STGA 5HULA 1J0IA 3WNPA 1I2NA 2ZRUA 3ZS4A 1RVGA 1DBTA 1PS9A 2PC4A 2ZWZA 1TQTA
chains in the Genus database with same CATH superfamily
1PQZB 3MBWB 4PWHA 1CFMA 2W3ZA 4Q6IC 3MACL 4V33A 4IL2A 4AM0B 3PP3H 3KDMB 1FPTL 4G6FD 2DZTA 1HKKA 1SNRA 2Y7NA 2CLRA 1AH0A 3PZMA 2BY0A 4U0RB 4A22A 2E09A 4IIFA 4HLEA 3CN1A 3TO4C 1JXJA 3EB3A 4IOFD 4RZ6A 3FQNA 1NSXA 1MEXL 3EXRA 1JOVA 5INDB 5LCVL 3WQPA 2CDEB 1Z3GL 2WMHA 1EGVA 2H26B 3FJNA 1UR8A 4IU2B 4GT0A 4PEEA 2YSTA 4DBWA 4UIOA 2IH1A 4NYYA 2V2HA 4NUPA 3GLAA 1F8TH 4AW7A 5JIQA 3SM0A 3HC0A 1RIVL 3MUGB 3RUGB 2YPLE 1Q7ZA 4HJGB 3VCLA 4WJ5B 5K39B 4PBWD 1QLEH 2WN2A 5D1XD 2A77L 5DEZA 1KN4L 5AVHA 2AQRA 4WEBH 3WLWC 2QZRA 3U6XA 2DQGL 4EXAA 1INEH 4GUPA 5IJBC 3ZDZF 3CBWA 3US0A 1Y8BA 4MZ1A 1V02A 2NYYD 1A3ZA 1HEZA 5A16B 4HIXH 2ICWA 1S2UA 5LHEA 5TK4A 1Q4NX 1D9KC 2MH4A 3C2AL 1BSLA 1E5AA 4J28A 2C3HA 4S23A 5GRVK 3EZJB 1O94A 2F58L 4MMZC 2I56A 3VC6A 4JHOA 4GAYB 3AALA 1BBJA 3TV3H 2KZKA 4NHVA 3DXAA 5AYTA 2YEVB 5A6BD 5ICYB 2WHKA 2YXGA 1CU4H 1VPYA 5DJCB 5FW8A 3IJEB 3FFSA 4EWND 4XMKL 2BG5A 3QDMD 5IDIA 2ITDA 2BGSA 3DROB 3L3DA 4FQLL 3RL1A 5DA4A 3H2OA 3D06A 1WMNA 1S9WA 2R2EB 5DD0L 4IMKC 3U0HA 4XO7A 1JV2B 5CUSL 5LNWA 5D7LE 1LF6A 4RNLA 3I75A 4U1KA 3ARDD 4L8BA 3SOBL 2OTUB 1NWPA 4NUJB 5JXAH 4ZSOA 3H7BA 3V5DB 2IH8A 2PXYA 3ZL2A 1A5AA 3ALFA 3OA3A 2AJYL 3NPWA 1KFCA 3L3GA 1EUUA 1R5VB 5CGMA 4JM2F 3G1SA 4Q9CA 3EOAA 1FHLA 4UT9L 1DVUA 2NY1B 3ARUA 1N0XL 4G11A 1LNUB 5DZAA 1G69A 3SDXF 3ONCA 1A47A 4AVJA 2FT8A 5F96H 1EDYA 3DUSA 4PJIB 1FH7A 1LF1A 3FH7A 1WVZA 3G5XB 3ZKQD 3MQIA 3GY1A 4IWWA 2ID5A 4WTZG 1NSVA 3GFYA 3FN0H 4K5OA 3GB7A 2YR1A 3W11D 1AGEA 1CECA 5L9DL 3RWHA 5LIKX 4NQCA 5CPMA 3QXVA 3QQDB 1ONQA 4YTSA 4ANUA 5FYLE 3OVRA 4JG9A 1J1OH 4L9DA 5DJ8B 3SUTA 1D7BA 2H4EA 4B5NA 4W9DC 3YPIA 1GZQB 1FNFA 1NFDA 4Y9NA 3GMRA 1ZGLP 3HC4H 4BDVA 1YXCA 1YNKH 5IW1B 3LQLA 2JIEA 4GIYA 4Y5YB 1Q9KA 4DAGH 3M44A 5MERA 1IILE 5C0RH 3VCRA 3QQ4A 2OL3B 3CUIA 4YPGA 3LM3A 1T5XA 1K02A 2OPCA 1NGYA 1NARA 2A1WH 3AFLA 4HKBB 5CEZH 3BDKA 3CSPA 5DHEA 3UJEA 3CIWA 5AHNA 4RDBA 3UPRB 3VSNA 3WDHA 1NZRA 2VXVH 2PPFA 1Z5LA 4MZ8A 1KOAA 3SKOB 1QLEL 5TE6H 3DFOA 3IKKA 3EGDB 1BWMA 4XNBA 3BXNB 4WEBL 3L54A 3PM6A 2WQVA 4DP0X 3SKMA 2PO6D 1INEL 2ZG1A 1P84K 3IUDA 1VENA 3GSWB 4APQB 4JANB 2DEYX 3TYAA 1MUCA 2ZUVA 3SN0A 2D7QA 1BEXA 1OG6A 4HIXL 3T09A 1QBBA 3DOHA 1D6EB 2VFHA 2UV3A 4E5XB 1SEQH 2VMCA 3X3YA 3CZFA 1ZJAA 3D0VA 4GI4A 1E2WA 3NJJA 1YC7A 4G42A 4P46D 1O5RA 2J9ZA 4MAVA 3TV3L 4O15A 3VFTA 2NY3D 3E0IA 4U3CA 1I2OA 4EVNB 4PRID 1O5QA 1CU4L 1T2XA 1XDMA 5MENB 1R4XA 3ZE1F 5EEWA 3QFDA 1UR3M 4B2DA 4PJ5D 1E4WH 2FPVA 5L2KA 1GZPB 3KH3A 1NAL1 3B06A 4O11A 4Z3HA 3GZAA 1JGIA 4ZFFB 3LCXA 3TO4D 1QUMA 1VRDA 2HE5A 3SHSA 1JRBA 5JXAL 2GVGA 1A8JH 3ERXA 2XFYA 1YHTA 5TDOB 3W0KA 3D25A 3TCEA 3ZDWA 1F3JA 4QRSB 4OAWB 1U58B 2PDFA 4PMUA 1QI5A 3REQA 4XAWH 2QCHA 1GOHA 3HC3H 4CN4A 4U1GC 3KLAB 4K23H 1UVQA 5F96L 1PLAA 3F6JA 5IIEA 4FTVA 3B05A 5D1XB 1ONEA 5ALCH 3P9MB 3DV6A 2LVCA 3P3YA 4QI3A 2B59A 3WLWD 2FWUA 5SX5K 1MCIA 5DZOA 3CV2A 2OA9A 4N9EA 4XPAH 2PDCA 3B7YA 4JFDD 1GQLA 3FN0L 4GW1B 2R0ZH 1UURA 1PUDA 3OQRA 3LI0A 4A2DA 3DK2A 1D9KD 1ZHNA 1HCZA 3BLBA 3VKCA 4X6FA 3VSQA 4G7YL 2KPNA 3P4LA 3HV8A 4WNSA 5A8GA 1K7EA 1J1OL 2WW0A 3NM3A 3E0LA 1AI1H 4UQ9A 4DOHB 4OFPA 1MMXA 1SN0A 1A5KC 3HCVA 4M6VA 3HC4L 2WC4A 1OOWA 1NIDA 3P11H 3WN6A 1YNKL 3V6ZA 4W89A 2PDKA 3TS8A 1M2OA 3QDMB 5E0QA 2ATKA 5LUMA 4I85A 3VSUA 5C0RL 3T4AA 2DU2A 3U2SB 5LBSH 2OKTA 4YNGA 3MRJA 1XRSA 1T04A 1WKEA 4LUSB 4Z9KB 2A1WL 2FEEI 3QISA 5CEZL 2FYYA 3ARDB 4Y88A 3X42A 1N5AA 1B3YA 1T21A 2VXVL 3K1KC 4ASTA 5ITFA 1VCFA 5TE6L 1WFUA 4UM8A 4CD5A 1FCUA 3Q2NA 3ML8A 3ESNA 4HMEA 3VX0A 3RWIA 2EDEA 4FFZA 3QW3A 1XF3A 4XAKE 5BJTB 3HEIB 5GRXG 1SEQL 3OLGA 4UTLA 3W1MA 1XHHA 4HJTA 4Q4QA 4IS6A 3SRDA 2GJJA 3IEBA 3PABA 3UERA 2ZXWB 4Y2DA 5I1DA 3HJZA 4NPKA 1TWSA 3N42F 4EMZA 3TJHC 5LKNA 5GPRA 2OTWB 3CAVA 1EPVA 1DQDH 1T8QA 2VQ1A 1VLIA 1CFNB 2XSKA 5BZDB 3TP4A 4HGWA 1E9LA 1MOEA 5C0EA 5KS9A 1R9ZA 4IBVA 3AZRA 3PBVA 4QYOA 3HG3A 3VXUA 1NS4A 4GB9A 1GGBH 4GAFB 4AYFB 7TIMA 4P5MA 3BGMA 4KRTA 1E4WL 2K1MA 3VD1A 3EGJA 2FHCA 1GOQA 4MD5A 2CUHA 5IVZA 3BKJH 4JO1H 5E5LA 4RK8A 1EA0A 1J9TA 1OE3A 1WDWA 2QTVA 2FB4H 4FXKB 1UWXK 5I9QB 4H8HA 4F2EA 3SRHA 4JO3H 3B8DA 2QVIA 2HLEB 4WUUD 4X6BA 4XP9H 4PY7A 5HANA 2X2GA 1O60A 3SY1A 2CGZA 1N3NB 3ZJKA 3OGCB 1PW3A 1GMEA 2PLJA 4Z7NB 3GRIA 3U6RA 1UW9A 3K71B 3IJIA 1LBMA 2Y0FA 4XAWL 5FS5A 1I2PA 1HX0A 3HC3L 2VZTA 4MYPA 5IOKA 5CZRA 4K23L 2BS8A 2GQAA 3VXMA 2P88A 3O11A 3LS5H 2EQDA 3DJZA 2ZC1A 5ALCL 3ARZA 2EZ0D 4KUCF 3UAEA 3CUFA 1BXCA 2PO6B 3H2NA 4F2MA 1TWDA 3QHOA 3SCVA 3NVQA 1POKA 3EMZA 4IQDA 2MANA 5CJNA 2R0ZL 3RRAA 3PY9A 3R1ZA 1QNPA 1JK9A 4PRNA 3QEQD 4AWUA 5B8CC 1BECA 3QO0A 1JVKA 5FJOA 4M56A 3B2DC 4FFYA 2MMXA 2XZZA 2VN6A 3W01A 4P46B 5A43C 3LQZB 5FWQA 1V5JA 2GVYA 1AI1L 4TQPA 2NY3B 3L5XH 3SE8H 4HXAH 2XYLA 1A5OC 4PRIB 3P11L 1J88A 3T2NH 3W1LA 2VABB 1I1FB 2PF6A 3VGAB 2O7QA 2XLLA 4P4RB 4KX9A 2IXUA 3KR3H 2AS5M 4Q6IB 3BPNC 4PJ5B 1R9YA 1T20B 4HKJB 4GACA 5LBSL 1SIIA 1ZHKA 1QRKA 2XHNA 4ZYKB 5KSWA 2YD5A 4ZW7A 3N17A 1XQLA 3GM0A 3H4GA 3L65A 3U36B 4JE4B 3W7UA 2GT9B 4PTUB 2WLNA 4KERA 2EDQA 3TO4B 3IIPA 4YDKH 3LEVH 3TBTB 1F2JA 1Z6JT 2GPTA 3GEWB 2OEMA 4Y7MA 3GX9A 4KUZH 4TMCA 1BXNA 1KB5B 5GZOA 1H11A 4N4PA 2BSLA 5FYKU 3MLPA 4R96A 3G6AB 5DMIL 5B1KA 1A6WH 4E4PA 5H8PA 1AJZA 2FEEL 2N56A 1OIOA 3AHVA 1GVFA 3AMOB 5FPIA 5KBLA 2HN7B 4HJJH 5K7JA 3GBEA 1M3JA 1TX2A 1ZA6A 4JFOA 1T7ZA 4L3ED 2ZKHL 5HGGS 1DQDL 4JFDB 3IJDA 3CPUA 3D4CA 1ITBB 3ACTA 2E75C 2E3VA 1D9KB 1MHEB 3L9EA 4PQXA 3LKQA 4LRSA 1B4EA 3OAYK 3ZMNA 1GGBL 3T3PF 2Z93B 4LP5A 4KH9A 4MMZB 2OFJA 1XB6A 2D4DA 3O3UN 1K8DA 5F2IA 4JNZA 1WZKA 4JRYE 3D3VE 4NQDE 1FKWA 4ZGYA 3BKJL 2AQ1A 4JO1L 2CM5A 4N2CA 1TXKA 2R56H 2FB4L 5C9ZA 3BICA 4W85A 2BODX 1GZ1A 4JO3L 4OKDA 3RHWF 4A2EA 3HRZC 4XP9L 2IDQA 4UC5A 3MRKB 4DYEA 5C0AE 1R46A 5I66A 2VQ4A 2UBPC 3QFJA 3NZGA 2VQTA 5I0YA 4LSSH 1R7AA 4WFGE 2VQUA 2WM1A 1OC7A 3VXTB 4A7GF 2D2GA 3VB8A 2MRYA 2L7UA 3CU2A 1T83A 4R90H 5DD1H 4J40A 1TRIA 3UBFA 1E30A 1NMCC 3PXHA 2DQFA 1LEIA 2WO2B 4B9ZA 3GMPA 1UACH 3V4VB 3LS5L 2OMAA 3GZ3A 2ZPKH 1P7QD 2Z00A 4FEZA 1WUEA 3AU1B 4XN8A 3W1AA 5TBOA 3LPWA 1JWMB 1KCVH 1U9KA 1CGYA 3W74A 4D1IA 4JFFA 3VNYA 2E5DA 4G56A 2KHAA 1IEWA 4H2AA 3NZQA 5D4IA 3KBJA 3PFMA 3EA2A 3W2LA 2ZKMX 1YG9A 4QRPD 4J3SA 5DRNB 2ADJA 4P8VA 3ZRSA 1LQAA 3FLUA 3TJHD 2YIHA 4YZWA 3PE9A 3MT1A 2LGNA 1QG3A 4PGBA 4OZHE 2NYKA 3L5XL 3SE8L 3O1NA 4HXAL 4TUFA 1RLWA 3HZVB 2HFGH 3T2NL 3NZUA 2J27A 1TU2B 3W29A 1UEMA 1QPRA 2NW2A 3VXPA 3RLHA 1FFRA 4JY6B 5FKAB 3KR3L 1TQSA 3SGKC 4WDTA 3U4EA 4LCRA 1ANUA 3TAKA 3ETSA 3EMQA 2WXIA 2V5RA 1BG1A 2X1QA 3LPOA 4B9GA 2JI1A 4YDKL 3LEVL 1U8JB 4N3TA 4WUUB 4L7ZA 3QPEA 2CRZA 1CD1B 4KUZL 2CFDA 1E5JA 5D71H 3QPZA 4R2GC 2VUOA 4PV9B 1HU8A 2OLDA 4L8DA 4FALA 1QFWM 1A6WL 1OWWA 5C9JA 1AH3A 2I25N 4GUQA 1ZAHA 2Z3FA 4OUEA 3H53A 4KNTA 7TAAA 1FUNA 4B50A 4YIWA 4UQ2B 4HJJL 3R4RA 2EECA 1RK6A 5DDHA 5D55A 1EJVC 4U6XA 3LHYA 5HHPA 4LY4A 1KYFA 1MIMH 1E5ZA 1H8OA 3BUTA 2TRHA 2G60H 4N8PA 1ROWA 3IM1A 5GZND 3S5NA 3FO2B 1HTIA 5F9AC 1MFBH 1PBYA 2Q86A 1UWGH 2IW0A 1A7PH 5SWZD 3H6OA 3QEQB 1C9SA 5DANA 2MKWA 3VXNB 1GC1H 2F18A 4OLYH 5H2ZA 4TUJA 2ARJQ 2Z1PA 2DIBA 4PFHA 3PNRB 3FTSA 1X5KA 1IC5L 4GQBA 5C97A 3CFDB 2X40A 5DHVB 2AV1A 4GISA 6CGTA 2OXHA 3BPWA 1XWVA 1EAPB 3VXQB 1QEWA 2DZAA 1EP3A 2WGXA 1NDGB 4UTAH 3L2NA 4XXCC 5DVPA 1T41A 5C7XH 3NGJA 1R3VA 1OFQA 4LSSL 3DFNA 3OHXA 4G72B 1ZK5A 1JXDA 3GI9H 3PC0A 5D8ZA 4QT5A 3QWRA 4DXKA 1S7VB 2YL6A 4NZ4A 4WSJA 5DD1L 2CBUA 2FATH 3BZ4B 2FNWA 4ZDHB 3MRMB 4I2XE 3B6SA 1UACL 2NOYA 4PJAA 1X1ZA 1H50A 3PWVB 1XL9A 2ZPKL 3RM8A 1S9VA 2WSDA 2W0QA 3V95A 3D47A 3X11A 4R85A 4H9YA 2DT1A 1AYRA 1A1NA 1VFHA 1KCVL 3L0NA 4C6KA 4U1GB 2J5WA 4ZUWB 4MA3B 4WIWA 5C0JB 2VLLB 1XG4A 4YDLC 3MYPA 2FLBT 5ICXB 4G83A 2HLAB 4HHWA 3QUXC 3BLPX 4B5TA 1YAIA 3OKNB 1YYLH 2MQ0A 2OM5A 3ATAA 3DURA 4DPRA 2CUAA 3FJTA 4L3EB 1F86A 4KEMA 4OCLC 5HBFA 3XIMA 1AFVH 2HFGL 5D1QC 1WKDA 1YEKH 4OV5A 4BD4A 5DK0A 3B3BA 4PV8A 2XY2A 1L4IA 4HG4J 3IWPA 5B1BB 3UVIA 2HJLA 2E22A 2VE6A 4OV4A 2PI6A 4MCYA 2B08A 1V7XA 1SJEB 3ARBA 3KPQB 3R4IA 4NJHA 2Y70A 3QV8A 4ZBCA 3ILPB 2ZTKA 1R30A 3GXUB 2LW3A 1A1OB 5IT2H 5FF6A 1Q7QA 4NUWA 4YFLI 1OJXA 3P2TA 3VKDA 3L3IA 2A6IB 4PJGB 3P9LB 3WN5C 4U0QB 3ITXA 4WDIA 1MCQA 4P2RE 2XWJB 2K7QA 3QHZH 1DBTA 1TQTA 4W9TA 2DQMA 3JYCA 1Q6QA 3KBWA 1H7NA 2YYTA 2A74A 4YHZL 1GVIA 1U8NB 4LS1A 4K7PL 3VMPA 1DXFA 5EY5A 3MHUA 5A2JH 5HNUA 4IPLA 1P7QB 4J3VA 3OZPA 2AF2A 2NT1A 2GABA 3NQ8A 4WTXA 1TF4A 3IMBA 1MIML 2OR7A 1P0BA 4C7DA 3LZOA 4GUGA 3KPPB 4XNXH 1UWGL 1A7PL 2VL5B 3FUFA 4KJWC 4PTTA 2YGVA 4WK0B 2CA3A 1YN7B 1GC1L 4OLYL 2VMEA 3QI9A 4QRPB 5GGRA 1ZLVH 3PWUB 2R2CA 3DX6B 2WZ0A 4OJCA 5G4EA 2J7LA 4WU5A 4N2EA 1OHQA 1URIA 2CR0A 1XCXA 2ZYHA 1R87A 2AJ3A 1G7PB 3W2KA 4PBDA 3AS0A 4ERGA 3SZ6A 1HHIA 2COVD 2L8AA 5E1AB 3SX1A 4UTAL 2HG0A 2V63A 3QE5A 4WW2F 1FL6A 1OGAE 3K72B 1Q13A 3D69B 5HQEA 5I3IA 4OKVA 2BIPA 4PWKA 4KVCH 1UJPA 3GI9L 5CNHA 4LASH 5HJXA 1BYPA 2VMJA 4LRTA 2HTLC 2FH8A 2FATL 1RJRA 1MCEA 4Z7WE 3SBWA 4R2GD 1E4IA 1SHXA 1E15A 3AT9A 4NN5C 3F85A 3TC6A 1OAYH 1NCBH 2GSGA 1X5YA 2VUNA 5J57B 3HTWA 4FXSA 4BTXA 3A67H 2VUYA 3TA4D 1PQZA 1WS8A 1WUZA 1F58H 3BYTA 1T5KA 4BFEA 2IXQB 3WD3A 4AM0A 1VBJA 3KDMA 1QWUA 3ZQ9A 1DJIA 1YYLL 2UV8G 1P6FA 4A3HA 4P5TC 3M0IA 1KM0A 3LZPA 5IFPA 4H8NA 2X70A 1AFVL 3SYPA 4WXYA 2RR3A 1YEKL 2CDEA 3NQBA 5SWZB 1NWSA 3T07A 4F7TB 2ITCB 2W6RA 3IK2A 3W3BA 5B8CB 1CYWA 4GYKA 3LHUA 4JTUA 3VACA 1NCAH 4C1KA 2BFGA 2ZNWA 1R75A 3RKPA 2X2HA 1NUNB 3LV3B 4YHKH 3MUGA 1GK8A 1G1OA 2ZE3A 4DEWA 3RUGA 3W7JA 5DCDA 3IMWA 3MLTA 4HJGA 2ATPB 4BCYA 5KYYA 1AKPA 1D5BA 1VRSA 1X5IA 1ET5A 5IT2L 3V4LA 3MCMA 3BPNB 4E8GA 3QHZL 3GH4A 2VN3A 4Q58C 3EOBA 3C86A 2IAMA 1SRDA 3PP3K 1N6UA 1FDLH 1QRND 4PMXA 3IJLA 1U3JA 1WA0X 1X5GA 1W1B1 2WXNA 4R7DB 3X3ZA 4Z3FA 1TV8A 2CU9A 1CUOA 2EUZA 3ME0B 4C6CA 3D08A 3GS7A 2NXZC 3WLJA 1R5IB 4XNXL 5TF1H 2YD8A 1H63A 3SQOH 2H8ZA 1OCWL 3TWYA 2AL1A 2BNQA 1IT9H 1HDMB 3QUKB 2VLJA 3UGUA 4XPTH 3QUXD 1K4CA 2R2EA 3W37A 3AVEA 1JV2A 4ES9A 1W6CA 4QHKI 3CFTA 1ES0B 1GGCL 4XXWA 2H6PA 2Y24A 4BWLA 2HFEB 4OZHF 5HPOA 2VYOA 3OYXA 2OTUA 3HPXA 1IGJA 4KWSA 2X1IA 4NUJA 1IR1A 3F84A 3S34H 1MKFA 3CD4A 5JBEA 3NP4A 4RL3A 1FFTB 3SGJA 3FQWB 1T7WA 2N3JA 4S3EA 4A2LA 4GO6B 1UZHA 3CFCH 2C14A 1ZA3B 1NEZG 1VH7A 4KVCL 3ZDZE 3RU6A 1QTSA 1H3TA 3BQUC 4KI5C 4LASL 3VD0A 1Z8AA 2ICSA 1KEGH 3UJ2A 1VFFA 3FU6A 4DP9X 3WD5H 3AQYA 3VFOB 3FQ1A 3HRZB 2MCMA 2WJ5A 4HHMA 4JX6A 4LKCB 1MUJA 2V5DA 2KDGA 3CFEB 3WBDA 2CDGB 5H37A 5TFSH 5SWSD 1HKJA 2IKIA 4LDCA 1G4TA 3S4TA 4PB4A 1THAA 3PPCA 4XI5D 1OAYL 1NCBL 2VO5A 3MCKA 2F6XA 3A67L 1MWAA 1I82A 3FGCB 5H6HA 4EE9A 3IBOA 3QQDA 1F58L 3CCHB 2FX9L 2X9XA 1DSFH 1NMCB 2DMKA 4HETA 1H5VA 4CNIB 1Y18B 1N19A 3RGBA 4ODVH 5K59F 4AVHA 4M8QA 4XUGA 4ERSH 3RY4A 4PCPA 1RJOA 1QR7A 1RSFA 4NJGA 2GI0A 3VE0A 5IW1A 1E6SM 1EBGA 4Y5YA 3UXLA 2RD0A 4M9OA 5D5MF 3QZNA 1FZKB 3LMZA 5HHNB 4KJWD 4P8XA 3LRKA 1FWAC 5T5FA 2FO1A 3MU3A 3LQAC 3WD0A 2NLJB 2J9YA 4QAIA 2BRRH 3VRIB 5TTRA 4YHKL 4BRVA 5DURD 3GXPA 3GRWH 3KVMA 4KK9C 2I07B 5IM7A 5AL8A 3TF4A 3VA6A 3UZEC 3SDXE 1EGZA 3WIHH 2BOLA 3N18A 3GVWA 4TR9A 3F7VB 1JGVH 3FAXA 5LNSA 3EH5B 1OSZA 4IT1A 4IRSC 4HH8A 2I17A 4H2CA 2BSED 5EMUA 1MMZA 3HE7A 5CPNA 4E5XA 5JUEH 4KQ4H 1FDLL 2Y3AA 2HTLD 2WWMC 4M8VA 4NPJA 1TJIH 4JBRA 5BU9A 2NW0A 5AB0A 4JGUA 1WXJA 4R2GB 1OT2A 3I3EA 3DGCR 3RDTA 4ECLA 1N55A 2D20A 4CDHA 4LC6A 4EVNA 1XLBA 2C9VA 3BZJA 3CXDH 3JV6B 3HZMB 1E90A 5BZWB 5TF1L 5I5RA 4IEFB 3T6QC 4TNFA 3SQOL 1NCJA 2Q6WB 1EC9A 1IT9L 4XPTL 2E7BA 1ECYA 4GVIA 4WKXA 4S39A 3DX2A 5FEPA 3F83A 4MSWB 2WANA 5FDYA 1DR9A 4MDOA 4ZFFA 3PZGA 3UFIA 2UZXB 2DKUA 4UBDC 3AICA 3GBNH 3FB5A 1HH9B 4P49A 1E0XA 3NQKA 5TDOA 1KKOA 4FG2A 4QRSA 1USQA 4NGHH 4PLJC 3CFCL 5F4XA 2WVUA 1U58A 2DEWX 5AW3B 3WQ8A 5DK3A 3PWJA 5KJ7E 1KJVA 2R1NA 3KLAA 1SN2A 4JBSA 1KEGL 1XX1A 3WD5L 3GVVA 2FMOA 3FFCA 5D1XA 1VBHA 4BI7A 3P9MA 4TMBA 5FAAA 4E2VA 5EA9A 3GVQA 4HGMA 5C3LD 5TFSL 4Z2KA 3FEQA 2I27N 1G43A 2IG2L 2OJZH 4UNVA 1BAGA 1CDJA 5DFVC 1IKNC 5AKQA 5A5WA 5C9KA 3KVLA 4FABH 3BCJA 2C5DC 4HN8A 4FHAA 1QRNB 3G9AB 3IS1X 4HMNA 3L81A 1DSFL 4IX0A 2AITA 3ZE1E 3WHE1 4JQXA 3U7BA 3Q58A 3MACH 4H9VA 3OKDA 3NSJA 3HG2A 1M2VA 2V67A 4ODVL 4Z18A 3G04B 3RO6A 2VR6A 5B39A 5E51A 5MEPB 4ERSL 3RWCB 4AQ8A 4L0PB 3BI9X 4M03A 2V5YA 3GZOA 3ALWA 2CUIA 1ZSDB 3KS0H 1JFHA 3NQDA 3QDMA 3K8LA 3PG8A 4DKTA 4YDLB 1Z3GH 2V6AA 3QUXB 3EYQC 4JOMA 1G4SA 3WY3A 3DVFA 1DQML 4CADA 2LR4A 4J2PA 3X3XA 2BRRL 2C6QA 4YBHA 3ARDA 3VFUA 2L3BA 3GRWL 3R8GA 3B9VA 2CLKA 3CPLB 3UETA 5HQMA 3PBYA 3IUHA 4XX1E 2WQSA 3GHRA 3WIHL 2ISVA 4KCVA 5C2UB 4Z7OE 4LLVB 2VDKL 2PA6A 1JGVL 1FXQA 4IHBA 4FMKA 3EG9A 1SO5A 2Y5SA 4BHYA 1ZVHA 1IIHA 4Z1BA 3DRQA 1BM7A 5IJCC 1IB5A 3K2KA 5BJTA 1NPJA 2G97A 4KI5D 4A21A 3RG1C 1FX6A 4QLJA 5JUEL 5CU5A 4KQ4L 4XAZA 2ED6A 1LE9A 1U93B 1TJIL 1EX1A 4Z7WF 2P26A 1SXCA 5IVOA 4JCMA 4PJHF 4GP4B 2V3EA 2OTWA 1J8RA 2ZWNA 2G96A 3WN5B 5SWSB 1CW2A 2JK5B 4ZPTA 3V4PA 3KRUA 5KBNC 3NJ3A 1US0A 3CXDL 4ZOCA 3ACSA 1BFOA 2FQDA 3OPZH 5A2BA 2F08A 5FM4A 2VDIA 3RRQA 4LX4A 3CWHA 4NLAA 3OKEA 2Q1EA 2KZWA 4YTUA 4WV1A 4PJFB 2EXSA 3F01A 2QDVA 2PABA 2RJGA 1GQNA 1U3NA 1U8KB 4FXKA 1YMMB 3SI9A 3F12A 5E93A 1CIDA 1E4KC 4GXFA 5CG0A 1Q6CA 3MKVA 3B83A 3GBNL 3NZSA 3QJFB 2FZNA 4P3CL 1N3NA 5F1NB 3MNZA 3OGCA 4PEKA 1MMYA 4HZ8A 4B3EA 1PMYA 4NGHL 2BGNE 2EJAA 4ODXB 4P05A 4O12A 1KBWA 1A7BA 3ZDYB 2ICWJ 3I6TA 1K4DB 4JFVA 4LANA 4OQ1A 5DURB 2EHHA 3QXBA 1ZVYA 4KK9D 3A64A 1AE6L 1MQKH 4FQ1H 4CLMA 5I1HH 5LNGA 1AVKA 3RL2B 2I5QA 4KO9A 2A3HA 3LEYH 2PO6A 1JI2A 4AF0B 2AEQL 2OJZL 3SPGA 4CEUC 2HROA 3FBQA 4LV9A 4IRSD 2GTWA 5CC3A 4K73A 1AHWC 1IWBA 4MX7A 3IF1B 2WWMD 4X5WB 3PGCB 1YNLH 4RW5A 1E0VA 3LQZA 1CDHA 2NUXA 2YA1A 2E27H 2CIPA 4U1LA 2IBZX 2V81A 1I1FA 4P4RA 4IPPA 4Q6IA 4PJ5A 5DO8A 2GGIA 4HKJA 4WDWA 4ZYKA 4L1LA 1W3KA 4S10A 3TSBA 3WNMA 4WR3A 2GT9A 4PTUA 3L8QA 1P53A 3TO4A 1LE5A 4N1EA 1J5TA 3X2QB 1CB4A 1NKRA 2WCGA 2DYPD 3FB7B 3WFZA 4UDUB 3TBTA 4AGOA 3QHFH 4UBDD 4Z3GA 4PHZA 3E74A 3C3NA 2WW8A 3G6JA 4G6JH 1KB5A 3SJVE 3I4KA 1WJ3A 4DQOL 4WFFD 3ZM8A 4IOSD 1KM1A 3U4FA 3BOVA 4PLJD 1I8LC 3LS4L 2X4PA 1ET8A 2BRWA 2CLLA 3ZO0A 3QF0A 5HMDA 2Z8RA 4FL4C 1TV3A 4KRPC 2BSCA 1RD6A 2OK0L 4N8UA 1OB0A 1M71B 1UASA 5D2LB 2GEEA 3OBAA 3EFOB 3N2OA 2HA1A 1TITA 1U8OB 2AXHA 3P4MB 3R2GA 2W65A 1DJSA 1DQIA 4JFDA 3W24A 3CYVA 4OV9A 2Z2AA 4ATLA 1G7IB 1IBZA 4N9GB 5DFVD 4HJ0C 2E40A 1XSJA 3OPZL 1P6AB 3IJ8A 3AHYA 5FYJE 2Z93A 4MMZA 4CVZA 4EV5A 1WUNT 4N5EC 4NO5A 3V0IA 2GQHA 5G1TA 3RFAA 3WEMA 3WE1A 1OCNA 4D1JA 4XP1H 2DWYA 1QSVA 1XL6A 2NXZB 4RGMC 2G3NA 4X8GA 5I1LA 2FJHB 2ATMA 1XLKA 1MREH 4NIKB 3JW7A 5BRZD 5I1KH 2VCAA 2TMDA 5FACA 2Z2BA 1YDYA 4F7KA 4PTDA 3VXTA 1DWIM 5EBLB 2CSPA 2FQEA 1LILA 4MDJB 3BOXA 4ODUB 1PYFA 4XZHA 5ABEA 4F33A 4ZS6C 1WDAA 5C0BE 1SFJA 3FB6A 1MQKL 4FQ1L 3TT3H 4R5VA 5I1HL 3V4VA 3W7GA 1AACA 3NL5A 2HZGA 1Q8AA 4Z1AA 3GIQA 4ADSA 3LEYL 5E9DE 5IFAH 2CM6A 2XVBA 5E6UB 1KENH 3FU8A 4UNUA 3P0XA 3HHMA 4HNTA 3W2DH 3JSSA 3OIHA 2X4NB 1T7VA 5CAKA 1HXMB 5E4IA 5XIAA 1SO0A 5BWAA 4Z7VA 5DRNA 1YNLL 5IOPA 3CYJA 3T3PE 1MCRA 5DJ0B 4G7YH 2QAFA 1LLWA 1GPFA 4KQ3H 1TPVA 3BG5A 2EDXA 3VE9A 3HZVA 2E27L 4AZUA 3S47A 3HG1E 5FGCE 1RUKH 4F27A 1AIFB 3ASWA 3HMJG 2DM4A 4JY6A 3GSRA 5FKAA 2HJFB 3FU9A 2YLLA 5TK2A 1RHCA 1AYOA 4PP2B 1Q9WB 2RGSA 4TU1A 5IK3B 5EF3A 5EZIH 2NQ3A 5JLZB 2G2RA 3AS3A 2L04A 3PBGA 3HAEH 2Y89A 2IH9A 4UOW1 1NEPA 4FQPA 2QKSA 3R06B 4DVRH 3NM1A 3G8EA 3QHFL 3CZUB 4WUUA 4UYPA 2BRQA 4TPRH 2EO7A 5L8LB 3P61A 1KGCE 5EBMB 5D7IB 2PDQA 4JFQB 4G6JL 1A65A 3FQ2A 3EO1B 1W8OA 3N06B 4PREB 4WU7B 3TTQA 1DEEB 2DZEA 3QDJE 5EIQA 5T3XL 1DIDA 1BZ7A 3ZMEA 5KYUB 4BZ1A 3A3HA 4F1ZA 4NO0A 2J8OA 3MRQB 2NSOA 4UQ2A 1Q9LB 3RTLA 1D5IH 3IMUA 1YMHB 5I1AB 1P4IH 3TCLB 4B4HA 1V93A 2P1FA 4UR7A 3FA4A 2Z24A 1M42A 2HCZX 1BJ1J 1ETA1 4XMZA 3FO2A 1PY0A 4IRSB 3DN5A 3LKNA 3RJDA 5DZPA 1V3LA 2E46A 3QEQA 2VZUA 1S7WB 3VXNA 2J6EH 2WLZA 5T3ZD 4RNFA 4DZBA 3V5HB 3FSUA 2Y1VA 3MUHL 1YZZA 5DJ2B 4D0BA 2N0KA 3UXAA 1H1ZA 4E9TA 4Y9FA 3B4NA 2GQ8A 4P8WA 3CFDA 3IK4A 4XP1L 1G9MH 4H41A 2IKHA 3QEUA 1GEQA 4ZUSB 3VXQA 3EYVB 4GKZB 4ZMVA 1NDGA 2RHEA 2JBMA 1U91A 1MREL 3H7VA 4MJIA 1K77A 5I1KL 1FQ9C 1LP9A 4IBSA 1PCWA 4DM1A 5CCKH 1RW9A 2A3CA 4K3GA 1NF7A 3IE9A 5IEHB 1NJ9A 4TVPH 3DX5A 2DYPB 2JFCA 3PF3A 3TT3L 1UTDA 4MLSA 4Z7OF 3WXVH 2DD8H 2FZMA 3ZE0E 2OTDA 1BSIA 5IFAL 3PPFA 4ESKA 1KENL 4JDZA 5ABZA 3VTAA 2GIYA 2ZL8A 3W2DL 1ACXA 3N1FC 3A4DA 4WNJA 1HL9A 4KRPD 1B0RA 2UY3A 3N0AA 2VLLA 2O4MA 4YJZL 4UTJA 2Z65C 2HLAA 1RMFL 3OKNA 1QNQA 4FR1A 1EHNA 4L3EA 3TO2A 4KQ3L 2ADIA 4UT6A 3M0HA 4H01A 4JFTA 1Q0EA 3DNKA 4HJ0D 1C12B 1RUKL 2QPUA 5PTDA 4LL4A 1FSKC 3Q1EA 2P5ED 2D31B 4J1UB 2AQOA 5EZIL 1JYVA 1G7HB 3PGFH 5CLWA 4N5ED 2GJRA 1SJEA 3KPQA 2L5HA 4HQVA 2E74C 3ECBA 3OC8A 4DVRL 4QNWA 3FSWA 3ILPA 1E9IA 3AHTA 1A1OA 4QG8A 5EMJA 3W82A 4ZZFA 2ZADA 4TPRL 5LGXA 3DFQA 4QTGA 3VRLF 3WEXB 2A6IA 1EJ6A 3BLCA 3P9LA 4OCNC 5PCYA 5BRZB 4K7FB 3T05A 3NFSL 5DLCA 2OB3A 4WO0A 2CBIA 1LUCB 5DMIH 4LNYA 1XYLA 1O6SA 3HGOA 5I18H 3BANA 4DN4H 4OGAC 2Y07H 3VIFA 4JRFA 6PCYA 3GUWA 4H00A 3VGFA 4ZS6D 2B3RA 4UQBA 3O6DA 3VILA 1U8NA 1D5IL 4DWHA 3O16A 4TOQA 1P4IL 3BZFA 4M6OH 3V16A 1S9YB 2OKMA 1RZFH 2OVLA 2R24A 4S3CA 3HBPA 4HD9A 4L9LC 3DJRA 1FWDC 2ZKHH 1HSAA 2QJMA 2Y1YA 1JE6A 4TTGA 2FDMA 3QNZA 2E9GA 3R7QA 4F0MA 1CZ1A 3FOLB 4PJBB 5TE4H 4R3SB 1XIGA 3D8MA 2VL5A 3ZE2B 3WTSA 2J6EL 2QKIC 3MFFA 1S7UB 2CBQA 4CUCA 4QRPA 3PWUA 4OZIF 2J1KA 5G2WA 3DX6A 1CVSC 2NTSP 1HHKA 3W7HA 3QZWA 3GDMA 1I45A 2DLFH 4L1XA 2YR3A 5I6XC 4D8PB 1G9ML 4X2UA 2A4EA 4NRZB 2G9KA 4QDWA 4V27A 1JNNH 5E1AA 3REVB 3APFA 3RPBA 1H8LA 1IVXA 2WDAA 3ITCA 4DF0A 3D69A 1ITCA 4DTGH 2HSAA 4LPXA 5EZJB 3MUAA 1KNOB 5CCKL 1F41A 1Q94A 4OZFG 1HL5A 4UTWA 3VFRB 4XPFH 4TVPL 1EO5A 1R85A 1AO7E 2FO4B 3VRJA 2NX5E 4CVXA 3WXWH 3QUMH 4XPGH 3WXVL 2DD8L 1N7MH 2O6FA 4RIRA 1FAIH 3MGOB 4XR8C 3ZSTA 4HWZA 2HXTA 4NQEE 5D7EA 1W8GA 3OSVA 5MKGB 5AN7A 1ZLVK 2SEBB 2A7PA 3Q13A 2H2PC 3EEGA 2Q3OA 3WCYA 1REIA 4WK9A 4GEIA 4IF2A 5DVOA 2ZCLH 4Q33A 4KO7A 1Y0LA 4OFYD 4KWWA 1QMUA 4CQ8A 2K8QA 4JS7A 4RCAA 4U1HB 3M5YA 3WTVA 3WE6A 4DBDA 4HX1B 4HHPA 5GZNA 3OHIA 2GSIA 2HRHA 3NCEB 2W0FA 2CW6A 3N91A 1AHWB 2ITCA 5GGVY 1AD0B 4AT6B 1KC7A 1FHGA 3Q3GB 5CN3A 1DIEA 3FUNA 3LKOB 3PGFL 1E43A 4ZUUB 4IMGA 5JQHC 1QSZA 3H7UA 2VI0A 3P5YA 3OLEA 4DYKA 2DIAA 2WJ7A 4UOW0 1TSRA 3QZOA 3F4VA 3MU7A 3URQA 1P2CB 1VERA 4QCIB 4Y5XC 3FT9A 3QJVB 4LEEA 1LDCA 2H3NA 4R0LC 4HEPG 5I18L 1SYSB 5GHWH 4DN4L 1ECZA 1PE1A 2Y07L 4PMNA 2VXNA 1BKHA 2XG4B 4RPQA 4A63A 3I6EA 4R7DA 4TL5A 4L2LA 4M6OL 4UOZA 2CWRA 4Q14A 1RZFL 2CKRA 1J4EA 1JGDB 2GW5A 4G8EB 4LLDB 3ME0A 5HYJD 3KZ8A 1R5IA 1MFDH 4FL4B 5TE4L 4KRPB 4X8CA 1YDOA 3HUJF 5D33A 1HDMA 3QUKA 3WL9B 4H9MA 2FDSA 2DI7A 5AZ0A 2JKEA 4D8ZA 1XFBA 4AY7A 5I74C 4FK9A 1FYTE 1ES0A 2DH2A 4ZO7A 1U5HA 3KEHA 1L7JA 2BXZA 3WHXA 1JYXA 1IC5H 2DLFL 2Z1WA 1H1YA 3GWQA 4F48A 3W2UA 2A9CA 3PTQA 4HYRA 3TL5A 3GVRA 2CGRH 1JNNL 4HZLB 1OX5A 5TE7H 4MWAC 3V0HA 3FK3A 1TE6A 3FQWA 4BKTC 2P5EB 4YR6B 1SO6A 4PFMA 4NFCA 3BVUA 1WWBX 4DTGL 1B31A 5GJSH 3V0FA 2DSWA 2E6AA 2YS4A 1JYNA 3WH8A 4HKXA 3DHJA 4GRSA 4XODA 3GS4A 4J5VA 4XPFL 5CAYB 2AKMA 3C12A 3WTYA 1FJ1B 2XH7A 1TYJA 5TNVA 3HRZA 3WXWL 1QFOA 2CIRA 2J7GA 3QUML 4XPGL 1N7ML 4LKCA 1LYXA 3TCSA 4JFPB 3GXTA 1FAIL 3QIUA 3EDEA 4JM0A 1JVLA 1GYMA 2AQNA 3GDBA 3QR3A 2Z91B 4UR8A 1N4XH 2ZUNA 3SCUA 5K93A 2FECI 4IGBA 4OGAD 1B0WA 2H7WA 3UA3A 2VRAA 4N2IA 1TMLA 2OI9C 2FBJH 4M02A 3W1QA 1Y18A 4YO0B 2ZCLL 1NSUA 3CQPA 4DEUA 2CITA 1ZWIB 3O7UA 1IX2A 3L9RB 4F80A 3MFGB 1YEDB 4XNAA 2WQPA 4J3WA 3IMHA 2LLLA 3PZOA 2ICEA 1BPLB 4P2CG 5M1TA 2V7HA 4BWUA 4JTSA 4NP4H 3ZKNC 3KM8A 2AL2A 3DX7A 4RCXA 3CHOA 3QFEA 3SJNA 3L66A 3LRHA 2A7BA 3QIWC 3HGSA 2CK0H 4N9OB 1IF2A 1NMAH 3HZKB 1SZEA 4IKJA 5DJYB 3S7GA 1PG7X 3N04A 1F9CA 4ODBD 5JR1H 3NSCA 3S3SA 3KP0A 2PMZA 4QRQB 2QCDA 3O4OC 2YOCA 2W9LA 4UU9B 4AG4H 3OBEA 2VEKA 3F7VA 4W1TA 3MV8B 2ODHA 2AI0H 4L4PA 1LLOA 2CXKA 1X5FA 3HGRA 1H3XA 1H3PH 3DHDA 4PBGA 3QJHB 4P99A 1NGXB 3DC8A 5GHWL 3S4BA 4PWJA 2P80D 1E1CB 4I5RA 4CD8A 2VLKE 2DJUA 1NAKH 2J9XA 3M0VA 2PUZA 2E2UA 5AYBA 4YHZH 3FULA 1UBPC 4DP6X 4GBDA 2YD0A 3ZE0F 3PDGA 4K7PH 3SSJA 3Q8EA 2R2BB 4LGPB 3X1GA 4NAJA 4OY9A 2EAEA 5K59E 4HT1H 2R7EB 3NZPA 4TLSA 3IJ6A 1I7TB 3JV6A 3HZMA 4KO6A 3PPGA 1MFDL 5BZWA 1QXLA 2RB8A 1A5UA 4NKOB 2Q6WA 3WFDH 4LSTH 3X41A 5CEZD 5D5ME 3SCMC 1N12A 3CZNA 5GSRA 1DJXA 3A22A 4L5FH 1MAJA 2TRSA 1XIJA 5DUJA 3NQ7A 4PCYA 4O51B 2QQ6A 4WJG3 2NNCA 2BC4A 2VAJA 1F8IA 2QYGA 3HQNA 1MCSA 1OAQH 3BQVA 4OGXH 4WEMB 5CJQH 1MCJA 4PRHE 2ZJSH 1HH9A 2CGRL 4U6YB 4D6IA 1DVFC 5TE7L 2GUOB 4RDQF 5ENLA 3BN9C 5GGTA 5GJSL 1UR1A 3GXNA 1OM9A 4NQVA 4H25B 1MUMA 4I90A 3W7MA 1GGIL 3KLKA 2VDMH 3OJMB 4Y4HC 3W53A 3K8KA 1UFGA 3VKBA 1ORSB 1C9WA 3TBVB 3H42H 3RA7H 1XM3A 1RWHA 5AZUA 1EANA 5GRZA 3MA8A 1RZ7H 1VCAA 2IKJA 1W2VA 2C7UA 3X3GH 1JZDC 4W6XB 3S3DB 1N4XL 2P76A 5CN2A 3PR2A 2FBJL 4FNTA 4HBQA 4RH4A 3AHXA 1KLUB 3W02A 4GO8A 5EN2B 3JVAA 5TJWK 1TKKA 4JTKA 5DJAB 4HIHA 4GUFA 4H26A 3R0KA 2DZUA 3CMFA 4N2AA 4AE0A 5MEPA 4I1RA 5HYJB 1H5BC 2FECL 3RCYA 1OYCA 1J87A 3VDHA 2ZXCA 1GJIA 1W5NA 3TYBA 4NP4L 4DN3H 3THML 2ZXEB 3GPSA 2BSTB 5CSRA 2CK0L 3CDZB 1NMAL 1QLEB 1US2A 3FTZA 4HIEB 4O8AA 3WLIA 1HM2A 5JR1L 2X0YA 3CPLA 1UQYA 2PW2B 1FHNA 4N90D 1EH9A 2B4CH 3MV9D 5HY9B 2PCPA 1KXQE 3W0WD 4NT6A 5AYIA 2KPWA 3NEHA 1U21A 2VD8A 4MWAD 4AG4L 2QQKH 2BTMA 3ZQWA 1FSKB 4W87A 3MHFA 2AI0L 2AAVA 1RZ8B 2JLPA 1OCBA 3KCLA 1H3PL 3WNNA 4BK5C 3I7RA 5AB1A 4UFHA 1FWJC 5ES4B 2F7OA 3Q9PA 1XL4A 5DQPA 2XH2A 1NAKL 1U93A 3VCCA 2FVKA 3TLLA 3CBKB 3ARYA 4E0RA 5D4QA 2JKJA 3KDPB 3HR5B 5L2JB 3WN5A 5EUOF 2YCJA 5HMFA 5AQ0A 2JK5A 4H7VA 1W54A 4N0UB 4HT1L 5I6SA 1Q4WA 3PWNA 2ZVRA 5A95A 1YNTB 1ZV5A 3MNVB 3WFDL 3Q94A 4LSTL 3O4LD 5LGZA 1OCWH 4N2OA 4XVSH 4L5FL 4H83A 1ZK9A 1XGUA 4Q4RA 3B3IB 4HOXA 4X7FC 3MVIA 1KBKA 1OAQL 4WQOA 4L9LB 4LHUD 1GGCH 2YDQA 4OGXL 4B92A 2PDWA 5CJQL 3QO1A 2ZJSL 2ZTJA 3VJ6A 4UTBH 2F53E 3ZKND 1LO5B 4MDPA 1VKFA 3RURA 1KCKA 2QKIB 5F7AA 4DK5A 3IT8D 1NUGA 4QRRD 1L0YA 1SXZA 1ZD6A 4XP4H 3QIWD 5F7UA 5DS8A 3E6HB 1VS1A 1WFOA 5EOTA 1K4DA 1PLCA 1RU9H 1A5MC 2HS6A 5I6XB 1N82A 2VDML 2L7JA 2R23A 3VYOA 3NCOA 3C6SA 3VD3A 4F2TA 4C5ZA 4XN1A 3NNTA 1XR9B 3H42L 4I9WD 3AO0A 3RA7L 1GOGA 2Q3AA 3TMQA 4JKLA 3M0JA 5IMMB 5IJKA 1RZ7L 2PCFB 4PJHE 5C86A 4UANA 3RVTC 1URLA 5BS0D 2BSEA 3X3GL 1W15A 1UBSA 5AW6B 4WFEE 3UNTA 1D7KA 1ZS2A 1PL9A 4DYJA 4AJWA 4X6EB 1AQFA 3BHBB 1T6MA 3LB0A 2GQ3A 4X5WA 3V0EA 3MBWA