4FNSA

Crystal structure of gh36 alpha-galactosidase agaa a355e from geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRLPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
total genus 232
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnsA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnsA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnsA02
4QAWA 5F2LA 3YPIA 4UFJA 1TCMA 2FJKA 3P7YA 4PC8A 1QPNA 5CZ0A 3TUUA 1GYLA 4MJZA 5TBOA 1N55A 1YPIA 3UPWA 1AW1A 2NZLA 2YJQA 2C18A 3W7EA 1QR7A 1J0JA 3N14A 1WZKA 4WY0F 3BPWA 3GXMA 2NUYA 2ZX6A 3AMLA 5E1QA 3EJQA 3MP5A 3GVGA 1VIWA 1I8JA 4ADTA 3CIWA 4M7TA 4DF2A 1EEPA 4TMBA 5DBTA 3HJZA 3M0ZA 4PFMA 2V3DA 3CLWA 1KXQA 3I68A 4O13A 4PCTA 5FEXA 4ZMGA 5KINA 1WPCA 1TMHA 1K7XA 3VSUA 4Z1DA 3AXHA 1W31A 5BMWA 1S5WA 2ZA3A 4AWSA 2Q8ZA 2EADA 4AEEA 4WUIA 4L4MA 4HPXA 2FPVA 1JF5A 5DLCA 3T7VA 3LHUA 1HNYA 4NZJA 4IX0A 1A5BA 3PBUA 3AJ7A 5I5RA 5AHMA 3WENA 1SU5A 3C2VA 4O12A 3G1HA 1UBSA 3TK7A 3WDJA 3G1AA 1JDAA 2P10A 3W1MA 2Z1BA 2G96A 3GAKA 2GVYA 3A23A 4ZQCA 3W72A 4N4PA 1Z41A 4J7RA 2QKFA 2CLMA 2WNQA 4ICNA 5CPNA 4KFOA 3EWXA 3LI0A 4X2RA 4WJEA 3CTTA 3EX4A 5BRBA 4JX5A 1ZJBA 3BAYA 3NEVA 3VCRA 2E0PA 3EB2A 2V3FA 4UNKA 1RPKA 5AYYA 5K9CA 1UD6A 4U2ZA 2HS8A 1B4KA 1Q45A 3W85A 1OJXA 1OX4A 2ZX8A 3TTYA 3T40A 1QMLA 5BNKA 3TNOA 1Z44A 4YMZA 4HKPA 3PUEA 2VXNA 2V30A 3U6WA 2YX0A 4MKNA 1SZNA 3P60A 2VEIA 3W1TA 2YZRA 1H1YA 3LXAA 4LV4A 2ZZ1A 3KVMA 1H7PA 3RNDA 2XVLA 4H4IA 4GIAA 3C52A 3G3MA 3M43A 1TRDA 3UNDA 4AB4A 1OYBA 3PSVA 1OF8A 4PODA 5G2IA 3LRMA 3MJYA 4JIQA 3GNNA 5A6LA 1KCKA 1XBZA 1W37A 3PB0A 3NDOA 4YWIA 3MI6A 2EJ1A 1YXCA 4L4LA 4HOZA 2A7PA 3BLKA 4LOCA 3E49A 3N73A 2P1FA 3ZQ9A 3Q37A 3R89A 1KM5A 3L21A 3UEQA 3RFAA 3NNTA 5I23A 4HP5A 3KL5A 3RU6A 2C3ZA 4EWND 4AW7A 2WQPA 1KFCA 3QEZA 2VUYA 2FE0A 3NQVA 3DX1A 4GBUA 1LLZA 4B5NA 1DQWA 5E0FA 2DIJA 6ALDA 2WKJA 3S1VA 1F73A 2ZYFA 2ZQ0A 3PG8A 3TC7A 1ZAIA 4GI6A 4OHQA 4PSRA 1U2YA 4QNWA 3PF3A 4JTGA 3W7PA 1LDCA 2OSWA 3L4ZA 4D2JA 1QO2A 3VM5A 3BLIA 5D2TA 2ZRUA 3ZR4A 2W0UA 4ZQPA 3OBKA 5K2ZA 4N9CA 4U31A 5HDRA 2WVVA 4EIVA 5LGZA 4J28A 4LC6A 1UA7A 3S8HA 4LNYA 4GQQA 3DX3A 2XIBA 1EUAA 2J24A 4MYAA 3DFPA 2A5HA 3C2RA 3D51A 2ALDA 2OJPA 3W22A 4WD0A 4MY1A 3PG9A 2G3NA 1D9EA 3ZT7A 4O53A 2FIQA 4FXSA 2ZXBA 3QSRA 1TREA 1E40A 1SO6A 3BUQA 3VGFA 3P81A 3QZEA 4AEFA 3G1FA 1RD5A 1OFOA 1O94A 4BK9A 3M47A 4R53A 2ZUTA 2TPSA 3SIZA 2CU0A 1JFHA 3STCA 3EKLA 1TPVA 4Z0JA 3WJYA 3D50A 4O4VA 2JKAA 2BTMA 3GLCA 2PWHA 3LCLA 3IGUA 1RQBA 4LVGA 1KBJA 3UXAA 2F7PA 4JTLA 2ZUWA 5LNWA 3EX1A 2W79A 3BAJA 2TRSA 1KGWA 4XBKA 4XZ9A 3NQ6A 1M7XA 2ZCGA 4JCLA 4O19A 1VRDA 3CU2A 3UG5A 3K8LA 4UQEA 2OMAA 2C14A 5HXMA 4CGTA 3S5OA 2F1AA 2NWSA 3CQ0A 4UC5A 1JI1A 3IEBA 5E6ZA 1O5XA 3G8RA 3CEUA 1XI3A 4NX5A 2YXGA 1JRCA 2Y6ZA 3WELA 5HWNA 3VGDA 3BCDA 4MPQA 2A0NA 3MWAA 3H53A 3OIXA 1CLVA 2GVGA 3CWNA 3DC0A 1UUMA 4IOTA 3MUXA 3L5LA 3S42A 1OFBA 1CGYA 2X1UA 1GWJA 1XH0A 3IRDA 5D02A 2YW3A 1JQVA 2WVSA 1X8FA 2YW4A 1KFBA 4O18A 3LXCA 4K7VA 1LBMA 1SMDA 1EIXA 3GR8A 4XBSA 4FLSA 1VLIA 1XD1A 1WBHA 1TPFA 4LV9A 1Q3NA 4CLMA 2NXHA 2C6QA 3LPPA 1FQ0A 3W87A 4MFDA 3LM7A 1LZOA 2A7NA 4LC8A 1G69A 3FYOA 3KE0A 2YSWA 4AEOA 2A6LA 3QQ0A 4N6FA 1ICQA 3PS7A 1IF2A 3A5VA 2VKZG 3O15A 4UTIA 2D3NA 1VYPX 4BFAA 1M5WA 4GO9A 4TMCA 1K3UA 2QMKA 1OSEA 3WY1A 3GDRA 5CGMA 1PIGA 3DI0A 3ZR6A 1BTMA 4J27A 1WO2A 5AHNA 4I7WA 1DEDA 4LY8A 4JTIA 3T78A 2EF9A 3W83A 3S1XA 1KW1A 4IMEA 1HO4A 3PUDA 2Y5EA 1MW2A 4JD4A 1WV2A 4WF7A 1YXYA 5KMYA 4HNVA 2VC6A 2DZUA 1NOFA 3P61A 5BOOA 4IMCA 4O14A 2QCFA 2ZRVA 3GKAA 1FX6A 1K8XA 3V75A 1SSGA 3ABRA 1EO5A 4NNAA 3HBLA 2BSLA 4UXDA 5A5WA 4UTKA 2X1SA 3P62A 4OBTA 3TA6A 5AOUA 4IMFA 1HX0A 5CLTA 2VOMA 3TMLA 4H6KA 3R13A 1T96A 1I75A 2BHZA 2JKPA 3R5EA 4J3VA 4H2CA 1YADA 2CLFA 2F7RA 5A6MA 1KFKA 1T8XA 2G5WA 1TIMA 2GOUA 2ISVA 3SECA 3VNYA 3KFTA 2Z6JA 1IXPA 3W7HA 1SMAA 1QO5A 4ZQRA 1CDGA 2ZRWA 4UQ9A 3KWXA 3TW6A 3I7QA 3QJAA 4Z0SA 1XSKA 4DO6A 1GEQA 1VHCA 1MFUA 5D32A 5DCBA 4GFSA 3TFXA 3NPUA 5HR7A 3MP3A 5AC6A 4K36A 2V5BA 1JCLA 2BY2A 4OKDA 1JR1A 3C4UA 3WK2A 5F2GA 1RP8A 3BW3A 4O1CA 4DPQA 1S3HA 3F4WA 1DBTA 1SW7A 3O6YX 3W1UA 2NT1A 3KRZA 2G3MA 3NQ8A 4JIPA 4X0NA 1I2PA 3SI9A 3TXVA 4O1DA 2FHFA 1UD5A 1W3NA 3IJ7A 1H50A 2EKCA 2EAWA 3BLPX 3GDTA 1JJKA 3WEOA 3R8RA 3HMJG 3DKLA 4PL2A 1CGTA 3GBEA 3N9RA 1QCWA 1XC4A 3BG5A 3NQMA 3W7GA 1LOQA 5FESA 1KBKA 1P0KA 1MXDA 3N34A 3OLIA 3BK0A 3HIJA 3NQCA 4K39A 5H91A 2GQ8A 1H7RA 1G7VA 3BW4A 4YLWA 1CXIA 1B9BA 1GG1A 3CEPA 4NNCA 3NL2A 3QFEA 3BVXA 5G1TA 4AAJA 4LVFA 4LVDA 4A21A 1F74A 4N6EA 1PHQA 2AAAA 3M07A 1CXLA 4O16A 4M6PA 2ABAA 4JFSA 3GB6A 2ISWA 5FF0A 4O1AA 4UQAA 4MZYA 1S5VA 2JGYA 2GVLA 4BI6A 3LCHA 4UCGA 2DIEA 1RPXA 1YPFA 4RZ5A 3FAWA 1R75A 4PCSA 2E4TA 1ZY9A 3PB2A 3DX0A 3L0NA 2O7QA 3ABSA 3BAXA 3ABQA 3EWUA 2YOCA 1B57A 5A2BA 3WNOA 3S1WA 1W8SA 6CGTA 1OT2A 3S5YA 1NAL1 4RKAA 1VCFA 2AAMA 1FDJA 3LOTA 3W75A 2OSXA 1EP2A 3BVTA 3QH2A 5D2YA 3L0GA 1OFPA 4CCEA 2PRMA 3EX3A 1QW9A 1F05A 2JKEA 2ZBTA 3LV5A 5FF2A 2Y7DA 2YFOA 1KFEA 5D2WA 3PUOA 5AHEA 3UCQA 4OV4A 2CLHA 3S5ZA 3N3MA 1UKTA 3P67A 1QAPA 4GUFA 3UWYA 4FLOA 3G0UA 1PE1A 3HG2A 3S0CA 2J9ZA 1RQEA 3BW2A 1VYSX 3FS2A 1HVXA 1OVDA 4JICA 1K7EA 4JNMA 1YYAA 3G22A 4AMWA 1VAHA 4JTUA 3UY7A 3PY2A 1W0MA 5D37A 2Y70A 5EY5A 2ZX5A 2VR5A 3MHGA 4LS1A 4XWUA 1Q6RA 1GCYA 2RFGA 4NX0A 1QDSA 3ZO9A 1LORA 5AYXA 5I3JA 4O0ZA 3JS3A 1JCMP 2EQDA 2ZRXA 3TE9A 2C1HA 1HL9A 1KM1A 3UY8A 2VFFA 4OT7A 3W38A 2DZVA 2QUTA 3Q2DA 4LTSA 5FF3A 1LRTA 1JXKA 2X2JA 4LS0A 2WCGA 3IVSA 1CYGA 4GINA 2E5DA 2WNNA 3O6DA 4QNEA 1WA3A 2PC4A 1PZ2A 3W9ZA 1AW2A 4ZQOA 1BAGA 3UWZA 2FB2A 1RP9A 4ML9A 1Y7VA 1RVGA 4OIFA 4Y9AA 5J5DA 3O06A 5HNRA 1LBLA 2GJPA 3PVFA 4DF0A 1W3IA 1M7OA 2E6YA 2ZZ2A 3JRKA 4DXVA 5HR6A 3VMOA 3VI2A 3DX2A 1ODUA 1J2WA 4DQWA 1WOBA 2QCGA 2FFCA 3RILA 1B4EA 3HB9A 4IXHA 4MJMA 4X3ZA 3TAKA 3FOKA 2B4GA 3WJSA 4NXKA 1ZAHA 4C1KA 2QLYA 5KZEA 1KGXA 3G24A 3QQ1A 1MO0A 1YTDA 1P6WA 3UD6A 2ZXAA 3M7WA 1DQXA 3M16A 3NPXA 3WK3A 4ORIA 1TPC1 1LOLA 4NJIA 4UNLA 1XDLA 3TONA 3RF9A 1XM3A 3HGOA 3DDGA 2FTPA 3W74A 3FFSA 4LRSA 3IK2A 4CQ8A 2VT0A 4WZHA 5KZMA 1KFJA 3AXIA 4KWUA 1UCWA 2E68A 4LRTA 4FO4A 2YFNA 2TSYA 3DI1A 4Z1BA 3UWQA 1TV5A 1X1OA 4BWLA 2BXVA 4S2BA 1EP1A 1JUBA 3E0IA 3INPA 4J3UA 1OABA 4NT0A 1KTNA 2A4AA 2J88A 3P8IA 3IIVA 4K7YA 2EABA 4OWGA 4TO8A 3NL3A 4O0KA 1TB3A 4RCXA 1QX1A 3T4CA 1DHKA 2H3BA 5HWJA 1SFJA 3S9YA 1PHWA 1HL2A 2ISSA 5KEZA 4RZ4A 1R46A 1UOKA 1GVIA 3SZ8A 2F7FA 4X22A 5F1UA 1KM0A 3NVTA 4RK8A 3EDEA 1PS9A 3HJEA 1BVZA 3L4VA 1QI5A 1LYXA 5CGTA 4RV8A 3L67A 2WPGA 4JFWA 1VH7A 4U3CA 3PAJA 1I4NA 3G18A 4RLIA 3EJUA 1FCQA 3DHFA 5GVJA 2BHYA 4E2DA 4IUOA 5EYWA 5C6MA 4UTWC 2VRKA 4GRSA 4IXXA 1DHPA 2QCCA 4JTEA 5I3GA 4DBEA 3VSTA 3EJRA 3E96A 1VQTA 2QDGA 4PH6A 1J0IA 2V81A 1XDMA 2PWEA 1TTIA 3KEHA 1ME7A 2VEKA 3LCWA 3TDFA 3W7KA 4WY0A 1GVOA 2YPIA 3A21A 3IJ8A 4GQRA 1Q6QA 1XCXA 3WNMA 3GK0A 4AMAA 1RR2A 1WZAA 2FHCA 2X16A 1EP3A 1NF7A 2OZ0A 3L4UA 3RLUA 1L9WA 3PSWA 2B7OA 3OG3A 4HNTA 1LRQA 4GE8A 3SJ3A 1W3TA 2R8WA 1G4PA 1YTEA 4UQDA 4J3TA 1LP6A 1JCXA 3QMTA 4IX2A 1IIHA 3FIGA 2V2HA 1L6YA 4JTTA 5K4ZA 4DPPA 3DFNA 2YIHA 3EDKA 4I9AA 1JVNA 4HSOA 3FW6A 4FNPA 3QF0A 1SQ7A 4W93A 3KLKA 5IBXC 3TSDA 5DCEA 5LHFA 4FLQA 2EEXA 3WEMA 3VNZA 4XKYA 3VE7A 1OYAA 1U33A 3W86A 3P8JA 1H7NA 1B3OA 4U28A 3SGZA 4GUGA 4UR7A 2C8NA 5K9DA 4NZFA 1BLIA 3GXDA 1QNVA 5AHIA 4Y6GA 1MFVA 2A6NA 1YDVA 3L5AA 4Q32A 4M7SA 5DY3A 3WMSA 3BVVA 1JD9A 2B7QA 1PEZA 1WBJA 4PA8A 5TQLA 2VRQA 3BLFA 4QQ3A 4WSKA 3FA5A 1H3GA 2I9EA 3K1DA 1KFLA 4HNNA 5DN1A 2BWGA 2Y4SA 2X2IA 1KA9F 2RH9A 3W71A 2OYLA 4WX2A 4O4WA 1IXNA 3CZKA 1JIBA 2QF7A 4O15A 1H7XA 4KFNA 1ZCOA 5DFAA 1OG0A 2GUYA 1SW0A 2OX1A 4MIMA 4S1FA 1JCYA 2EO7A 3BC9A 1CIUA 1MW3A 3ELFA 3TQ0A 1PAMA 4M6VA 3P74A 3BAKA 2FDSA 6TIMA 2OT1A 4IQLA 1BPLB 3FKRA 2QR6A 1GJWA 4FNRA 2B7PA 2E1DA 3U8GA 2EACA 1H60A 5D04C 1D7FA 3C56A 4PL1A 2E09A 3VMPA 1I2QA 2A7RA 3U2OA 3EDDA 5CZTA 1TPWA 3WY4A 3W84A 1V5XA 2BXYA 3TQVA 5C55A 2X1RA 3LHTA 1KM2A 3TTSA 4YCPA 1UH4A 3TV8A 3ZSTA 1ZAJA 4B9ZA 4O8RA 5J5RA 3WY3A 2H3DA 5IM51 4CCCA 3WK0A 2CLIA 1X6UA 1CXHA 1NF0A 3W7LA 1QPKA 2HMCA 1GQNA 1HT6A 2ZXQA 1LM1A 3BAWA 1X1ZA 3JR2A 1VC4A 5E70A 1XCFA 3PBYA 1T0OA 4ZQMA 3BLEA 2VFIA 3TW7A 2IGTA 2B7NA 4QAIA 2Z0IA 2DZWA 5U7SA 3I7SA 2C15A 1KBBA 4O50A 4A29A 5FI8A 4MB1A 4JN6A 3VGEA 3F03K 2G97A 2BHUA 1UJPA 3BAIA 2YCEA 2XWDA 2CW6A 1TPH1 1PJ9A 1KBIA 4JYEA 1MZHA 1UB3A 1DOSA 3CWOX 2Y63A 1JI2A 4H3DA 5FEZA 5C54A 2D2OA 3W2UA 2ZWYA 1UUOA 4UTWA 3B06A 1X7FA 1WZMA 1MW1A 2WOQA 7TIMA 4UFHA 2VEPA 1EO7A 2XVKA 3UG3A 2B0MA 4HPHA 1ZNNA 5DO8A 1QFEA 5EL1A 5LZLA 2Z1KA 3CT7A 2NV2A 1FWSA 2WVTA 4JX6A 1Z48A 4FX6M 2WO5A 4GJ1A 3OVPA 3P80A 3CZGA 4O17A 1OGSA 2V82A 1H7WA 2Y7FA 4MUZA 1G6CA 2ZIDA 3T44A 4H8VA 4HIBA 2FB3A 1YDOA 3L2MA 3THAA 3LPOA 4A2RA 3HGSA 3N9SA 1HTYA 4UNIA 3TSBA 1PZ3A 4R34A 1A53A 3HPZA 3PWAA 5G4WA 3L4YA 2Y7GA 3IIPA 4S2CA 3W7JA 5CZJA 1TJPA 3AMKA 2P0OA 4FIQA 4CKQA 3HGRA 5HULA 4G1KA 3S6DA 5F4XA 1JGIA 3WDIA 3WJXA 3GYEA 1F5ZA 3W7CA 4Z1AA 3VFLA 3P84A 1ZALA 2NV1A 3KRUA 3OVQA 2R94A 3I6RA 4K37A 3M5VA 2CHNA 3ATZA 3KOFA 2RHGA 2PE4A 3EJTA 4UFIA 4YL2A 3IVTA 1UKSA 1DTUA 3BSHA 2X30A 5A2CA 2CZEA 3BVWA 3W1QA 2CXGA 4GO8A 2YDAA 4DEFA 4E0CA 3P82A 1SFLA 2ZTKA 1NEYA 1OFQA 4UCFA 4LS2A 5G5IA 1MW0A 1NM9A 3TSMA 2DZTA 2C19A 3W37A 2X2HA 3NXFA 1C9DA 4NJJA 2ABBA 4RXFA 2BX7A 3KHJA 3DDFA 3NOEA 1KWKA 1FCUA 4O52A 1UASA 5AB3A 3A9IA 4UOZA 3EJSA 3BSGA 2Y89A 1R47A 1W56A 2E9BA 3VKJA 3G3DA 4MYXA 1D3CA 3IIZA 5CGQA 3W2NA 4JXCA 4J3XA 1M7PA 3FJLA 1D3GA 4N2YA 3O07A 4E38A 1F2JA 3C6CA 2QCNA 1CXKA 4AVFA 1ZJAA 5BRQA 1GVRA 1KB3A 2XN0A 4NI3A 1L6WA 4FMVA 1VFOA 1QWUA 3A22A 3LBCA 3CZLA 1EA9C 1FCVA 3UWUA 3DFSA 1QOPA 4CQ9A 3VGGA 3KVLA 1PS3A 3SW6A 5K7JA 2QJIA 5K4XA 1WYIA 2DORA 4UQCA 3W1NA 1XKYA 1SO4A 1XSJA 2NUWA 3WNPA 2ATMA 3FAXA 2CWNA 4XQ6A 3TC6A 4X9YA 5LNSA 3BGJA 5G2HA 1S46A 4GC4A 1DV7A 5HJLA 1ME9A 1VB9A 3W7RA 3TJLA 1OX6A 2QCLA 3M44A 4HSNA 5U4NA 4FLRA 1L6SA 4GUJA 3NR0A 5BW6A 2DP3A 3EX6A 2TMDA 4YXGA 5KSWA 3NO5A 2F7QA 1Q6LA 1W5MA 3USBA 1XH2A 4AYSA 1WQ5A 3DFTA 2NLIA 1TPEA 4P61A 2I1OA 1F7BA 2F18A 4MVAA 2Y85A 4WOQA 2DZXA 3G1VA 3EJPA 2F61A 4DO5A 1TRIA 4TX9A 3G1SA 1EA0A 4TU1A 1A50A 5HUPA 1H1ZA 2ATSA 3W3OA 5L9FA 1UH3A 3DBPA 1VR6A 4GNJA 1KM4A 2ZWZA 4H8UA 3NQDA 2BY1A 4O1BA 3NQGA 3UWVA 1L2UA 3LLDA 1VZWA 4KKXA 3N2XA 1QPQA 1TQUA 3PM6A 1IXOA 4PEEA 1V3LA 3IIXA 3CPUA 2Y88A 3CHVA 3MP4A 3O6CA 3B03A 4Z1CA 1FCBA 4ONVA 4UMBA 1SZGA 3BGGA 1KTBA 4K6AA 3HF3A 1OHLA 5LNUA 1I45A 2Y61A 3KL0A 3TXZA 1GOXA 1DORA 1PCKA 1W5NA 1T99A 2D0GA 1LOSA 3DZ1A 3DHUA 2ZZ3A 1K8ZA 1GPWA 1OK6A 3C8FA 3NG3A 7TAAA 3W1AA 1VFMA 3LTPA 1AL7A 3TIMA 3I65A 4UTHA 3OLDA 4I7VA 2WSQA 3W73A 1ADOA 1TO3A 2CPUA 1XCWA 1TPDA 3LV6A 2PRHA 3W7DA 4HHPA 4Z08A 1JL8A 3L0KA 1KV8A 1GTHA 3C3NA 3P5ZA 4BZYA 4AHPA 1G1YA 1LCOA 1KXTA 4GI8A 3M6YA 5HMSA 1QHOA 2E77A 1OX5A 3RLVA 1A5CA 4NNBA 1CGVA 3R12A 5KZDA 4HA1A 1EPXA 5AC8A 3D0CA 5I3IA 1TV7A 1KXHA 4AMXA 4N4QA 2XN1A 4UFLA 4M5PA 2J27A 4UMCA 4A2SA 3BLBA 5D2VA 3SGUA 2DJXA 1O95A 3B0PA 2V0TA 1H62A 1KV5A 4ZQNA 1R30A 1NVMA 1K7FA 3GDMA 2CFFA 1YLVA 4CNOA 3DFOA 1PV8A 4BA0A 3VGBA 5T26A 2QAFA 1XD0A 5LHEA 2VFEA 1ICSA 4POCA 3NZRA 4NJGA 1CGUA 1XBXA 1XUZA 4ADSA 5I0DA 1FUYA 3G0XA 4ZL1A 2Z2UA 3STGA 2EHHA 3UG4A 3D52A 1QWNA 3ECQA 2E8ZA 3UYCA 3W7QA 5FF7A 1BEUA 2ZTJA 3ZWTA 2FH6A 3W70A 4RJEA 4LU0A 3B05A 5F4WA 1XXXA 2QJHA 3O1NA 4Y90A 3A24A 3OA3A 1TV8A 4LVBA 3M5YA 2WSPA 5DBUA 1U30A 2F84A 1NFBA 3E9AA 5HQEA 5EA9A 4CQAA 2FYVA 1TTPA 2HSAA 4PSPA 2C16A 3TX9A 1ML1A 5BRPA 1VLWA 1E3XA 1J4EA 4DF1A 3BUDA 1ALDA 2QDHA 4N9DA 1W5OA 2YYUA 1A5AA 2ZUUA 4UFKA 1WE5A 1G4EA 1H7OA 1TJRA 3C2OA 4JTFA 3EWYA 3IGXA 3O8AA 3VE9A 4JDYA 3TKFA 1MEWA 2W6RA 4TIMA 3DU0A 4K8EA 2ZX7A 4U4MA 1R34A 3GXNA 3KVJA 3UZJA 2A2IA 2WV8A 4AIEA 1R2SA 3WNNA 3QMSA 2E5BA 3SFKA 4BI7A 2XWEA 4E2OA 3GX9A 1NSJA 3MYPA 4BI5A 1Z32X 2QCEA 1H5YA 4JY9A 1SUXA 1OYCA 1PL9A 4J9JA 3EWZA 1JCNA 3MMTA 1EHAA 1FWNA 4CN6A 3L2IA 3GAYA 4AHOA 3W1PA 2F1BA 1G5AA 4HPJA 2VFDA 5CZSA 1V3MA 4MOZA 1TQJA 4ADUA 2XN2A 1UA3A 1MEIA 2H8XA 1KLZA 3N2MA 2WVVB 3CM4A 5I3FA 3BUBA 1MWOA 1W9XA 5DXYA 1K03A 4FIRA 1BVNP 2KZHA 1E3ZA 5D09A 1DKWA 4GUIA 1SZEA 3HGJA 3LDVA 3TU9A 2R91A 1U83A 3BV4A 1OFRA 1QI4A 5AYZA 3MBFA 3UPBA 1SPQA 2G95A 4ALDA 5LKYA 1IZJA 3TH6A 4JYDA 4CCDA 1TPB1 1TCDA 3G8EA 1VHNA 2WKLA 2RDWA 3L4WA 4I7UA 3AJXA 3NQ2A 2TYSA 5AN7A 2VFHA 3QC3A 4J3SA 4LT9A 3BCFA 2QAPA 4FB7A 2CZ5A 4FX8A 4IMDA 2WSKA 3E02A 5CPOA 2E8YA 3DHDA 4O10A 4UZSA 1XUUA 2NWRA 4AWUA 1HFBA 3Q94A 3GKFA 1SR9A 4Y8FA 4JL1A 1OFDA 2GJRA 1SO3A 1XBVA 2PRLA 2LLEA 5G4EA 4CNNA 2F2HA 4U33A 1M6JA 1KTCA 4M56A 2FPTA 2YR1A 2ZICA 3EEGA 2WNWA 1ME8A 3MHUA 3WFZA 2HTMA 3P5YA 3TAOA 1ICPA 4M19A 3F1QA 2ZXDA 2GVJA 1XFBA 3HQ1A 4QISA 1JUKA 4AIOA 5HUOA 3KRSA 2BXZA 5H2ZA 1R2TA 4QJ1A 2Q8LA 2EGZA 3DENA 4JTJA 1E43A 5EBUA 2OW6A 4J3WA 4HOXA 1IXQA 2CZFA 1TQTA 1BSIA 2X1TA 2ZA1A 3IIOA 3ZS4A 4WSJA 4EF9A 1QW8A 1AQMA 3CV5A 4A22A 3R2GA 1C8QA 3W07A 3VO0A 1GVFA 2C0AA 1YXDA 1KXVA 3WY2A 3MI2A 4GXMA 3W1LA 3UZ5A 3QRHA 1VJIA 2PWFA 1ZENA 4GKLA 3HPXA 3UQNA 2DH2A 4NU7A 1V3JA 3MHFA 4MLJA 3FEMA 4CN4A 4IWWA 9CGTA 3HZ3A 3VX0A 2Z6IA 4GUHA 1AMYA 3VM7A 1H63A 1N8FA 1WX0A 5E93A 4UTUA 2QPUA 4AF0B 5D05A 4MAZA 3LRLA 2VENA 4TR9A 2C7FA 2WVUA 1L0PA 5F1VA 2OW7A 4AYGA 2EPHA 3ZT6A 1OB0A 3W2JA 1QPOA 3LHYA 1O7DC 2VNCA 1RQHA 5LNVA 2E6AA 3AO0A 4ORMA 1VGAA 2QUUA 4JX4A 3PBVA 3EX2A 3UERA 5ABTA 1B0IA 1VCVA 1OK4A 2UV8G 1GVQA 3OHIA 2V5LA 5LNRA 4NVTA 2Y62A 1SSDA 1V7YA 4JFUA 3BARA 3W7NA 3PR2A 1XSIA 5D2XA 4YCOA 2Q3RA 3LGEA 4UFMA 4AF0A 3LTYA 3A47A 3TMQA 4LWWA 1BF2A 2BY3A 3H54A 2J9XA 4ZZ9A 2QCHA 4JEQA 3PC0A 5CSSA 2ALWA 1THFD 4KFPA 1TTQA 4R33A 3GDLA 1A5SA 2D73A 2WCSA 3M1ZA 4JFTA 2PWDA 3WDHA 5DCDA 2NUXA 1O4UA 4MLRA 4JTSA 2WSRA 4JL2A 3BMWA 5G2WA 5AHLA 3LXBA 3L68A 2NX9A 1JAEA 5LSMA 1ZJIA 3KAOA 3CC1A 3KXQA 4CNPA 1QPRA 5C2XA 1LLWA 4UOQA 1HO1A 3VU2A 4IJBA 5E6YA 1WDWA 4LUJA 3RMJA 1OFAA 1V3KA 3WNKA 2FPYA 4WQ6A 3TCEA 1DVJA 3EXTA 3BH4A 3L66A 3NGJA 1BG9A 3UXDA 1UKQA 2ZFAA 4Q33A 2CZDA 4LPCA 1CX9A 3LLFA 3QMRA 4NJHA 2BY0A 4JTHA 3SY5A 4OQVA 2BZNA 1SO5A 5HINA 3ZFHA 4EVZA 5CLWA 3CB8A 3M5ZA 2H6RA 2TAAA 3BO9A 4QIUA 2O7SA 1YDNA 4IPJA 2GQAA 1TQWA 1EUNA 1WAUA 4QSHA 4NXSA 1AQHA 4PTNA 5HPOA 4JTKA 4UZUA 2J25A 5MHBA 5CPLA 3LTSA 3FJ6A 4MFEA 2V9DA 3LI1A 5F7UA 2ZX9A 2A1YA 2ZRYA 2Y7EA 1MEHA 2QCMA 5EPDA 1LBFA 2GJNA 1LWJA 4CN1A 3LHWA 2ZDRA 5BMXA 2D0HA 1TQVA 2RDTA 4KWWA 1VJSA 5TD4A 2EAEA 1TPUA 1R2RA 3NZ1A 1H61A 4UTTA 2WC7A 1FDZA 1S5TA 4K38A 4EOUA 3NPWA 2FH8A 1TYGA 4IPIA 5AHFA 2JK2A 1FWTA 5EKYA 1O5KA 2GQ9A 1BKSA 3QM3A 1UD2A 3CLMA 1F6PA 2OYMA 1JDDA 5CXPA 1LWHA 1QOQA 1W5PA 4O57A 3PBWA 1HTIA 3W1RA 5EMYA 1DJQA 4E2BA 1GVSA 1FXQA 3OLEA 5G1YA 4NUWA 1GJUA 2DH3A 4B9YA 3NL6A 1RZMA 4WXZA 4N9BA 1P0NA 1FY6A 1YTKA 1XH1A 3QGVA 1IV8A 3W23A 2V8ZA 1AVAA 4M6QA 5EMUA 2NSXA 1QWGA 2JBMA 2OCZA 3L9CA 3LCIA 3LCGA 2NXGA 2QJGA 2YA2A 3QW4B 3PULA 2WKGA 2ZUVA 4Y96A 5F2IA 4BR1A 2QV4A 5D30A 1C29A 1K02A 4W9TA 1GG0A 3O63A 3IGSA 2ZZ6A 2GPTA 2YKKA 1C8VA 1PVNA 4FXRA 1WOAA 5DXXA 3UWWA 1QI3A 1KGUA 2OYKA 2QPSA 2I14A 3GZ3A 4RR4A 4P2VA 1CXFA 1JUEA 2FGZA 2XVGA 1EX5A 2E5CA 5D33A 4WXYA 1KWGA 1FDYA 3II1A 2A21A 3GBDA 1KM6A 2CLLA 1UD8A 2V3EA 3HG3A 3BVUA 3ZOAA 2QEZA 4HNUA 3BMVA 3ZSSA 1Q4NX 1IIGA 3LCFA 1Z42A 4CVWA 1RV8A 4UTLA 3EXSA 5L6UA 3B4UA 4UUIA 3M41A 4R7JA 1TMQA 3THQA 1TQXA 1GT8A 3WJZA 3S2CA 1EB3A 1WP6A 1OT1A 3NQAA 4LQ1A 1G7UA 4JR5A 4U2YA 1I2OA 3W7IA 1P4CA 1G4SA 3WNLA 1VFUA 1O60A 4MZ8A 4HN4A 1JQXA 4UMAA 2PURA 1G9HA 3GNDA 3NAVA 1PPIA 4KMQA 4WLCA 1AL8A 1EWEA 3BVJA 3EWBX 4IMGA 5FF4A 1R33A 1J0HA 1MXSA 3BUIA 4AHQA 4H8HA 1ZHAA 3EWWA 3L4XA 1AMKA 3HG5A 5K3VA 1AK5A 3HG4A 4DO4A 1W54A 2VELA 3BUPA 4BF9A 3IVUA 1J0KA 3VX1A 8CGTA 1AW5A 6TAAA 2RDUA 2ZZ4A 1D3HA 1JG9A 3ZWSA 4RX0A 5SWUA 4KWVA 8TIMA 2DZSA 2VFGA 3S1UA 1HXKA 4UTMA 3DFQA 1KM3A 3ABOA 3O16A 5AC7A 1DJNA 5TIMA 4FX7A 1PIIA 2J6XA 4DELA 2ZA2A 3C0JA 2QUVA 1EH9A 3NYZA 1Y0EA 3WN6A 2WPBA 5E9AA 3HPSA 4JY8A 1GZGA 3ATYA 5F4SA 3GR7A 4AH7A 3M5XA 4HT3A 3GXPA 4PCFA 3A5FA 2QCDA 4WY0B 3LRKA 3LB0A 3LHZA 2GUUA 2QMJA 1MXGA 1I2NA 1WXJA 4FNQA 3C61A 5CKSA 2R14A 5I24A 5E0KA 1CW2A 3HO8A 4JFVA 1EWDA 4XB3A 1HUVA 3CIXA 1GYNA 3BG3A 1VS1A 4UTJA 1TTJA 2NX3A 4OGZA 3NPVA 4LW7A 3TQKA 2H90A 1CPUA 2YGYA 2HS6A 3KVKA 3Q58A 2WNZA 3V1PA 3OLGA 3BG9A 1U5JA 3C2FA 2RKXA 4NJKA 1F6KA 1HL8A 2WSYA 1W1ZA 3NM3A 1JULA 1XBYA 3G1XA 1N7KA 3IV3A 1LTDA 3NL5A 2QCDB 1XL9A 3W7OA 1JDCA 3KL3A 4HOWA 4O11A 1HWWA 3W1XA 3CZEA 4A3UA 4TVUA 4ZVJA 1ONRA 3MO7A 2FQIA 3EDFA 1PCWA 2V2DA 2AMGA 3TOPA 2NXIA 2DU2A 3EKZA 3TJXA 2PWGA 3W7MA 4JGDA 4GWEA 2A85A 5F2MA 4PEKA 3DHPA 3NQ7A 5I3HA 1A47A 3KX6A 3FLUA 2OT0A 1JXJA 4AXKA 1JCJA 2FHBA 3TFCA 3D4YA 5DELA 1P1XA 3H55A 1ZFJA 2DJLA 3CZSA 5A2AA 3A4AA 3T55A 5LGXA 2V2CA 3GDKA 1W5QA 3VGHA 3E12A 1VYRA 1FWWA 1M53A 4OV9A 4O54A 5CSRA 2AQWA 3NM1A 3DAQA 1SZFA 1CXEA 1OX4B 3I7RA 3W2KA 3LX9A 2XIIA 4QM1A 1KLYA 2ZZ7A 3DKJA 1XGZA 1KCLA 1E51A 2ZE0A 4JDBA 4RZ6A 5A8GA 3SSJA 3D4ZA 4C1LA 2PCQA 3QSTA 4XTIA 3MYOA 2CLOA 4LUIA 4XUGA 3G1YA 1UD4A 2ZRZA 5KTLA 3QPZA 3DGRA 1QHPA 3VNDA 2J9YA 3C2EA 4IGHA 3MBDA 3QW3A 1MSSA 3ZT5A 5C5YA 3LERA 3DXIA 1GTEA 4GI9A 4FEZA 1CI1A 4FNSA 3QPYA 3WJWA 4UQBA 3FYPA 4MZ1A 2YYTA 1I2RA 4JYFA 2GJLA 4RXGA 2E6DA 3MI3A 5FEPA 3G1DA 3LBMA 5FEWA 4K8HA 1DL3A 3K8KA 3K8MA 2NT0A 1UD3A 4OJYA 1JRBA 3NQFA 3DX4A 1OFEA 4WOZA 2BLEA 1LRNA 3ZR5A 4OE7A 5I3KA 7CGTA 1LROA 4N9EA 3L2LA 3RIKA 3GXIA 3SR7A 4XKYB 1FBAA 2H8ZA 3GXFA 5D03A 1TQSA 4FHAA 2Y24A 2AGKA 3WK1A 3LCXA 3G0SA 2ZZ5A 3HOJA 2YA0A 4FF7A 2XFWA 3GXTA 3B04A 4ATWA 1H51A 4NQ1A 2NX1A 4FNUA 2X2GA 2D0FA 4O28A 1XV8A 4JCMA 2C13A 3WFAA 3GIYA 1G4TA 3CTLA 3VSVA 3S5NA 3MW7A 2WANA 4Q4KA 5HWMA 2JGQA 3NQEA 1ZS2A 1G67A 2VEMA 3QYQA 4LXFA 2FLIA 3L65A 5CPMA 2F7OA 1FWRA 3O05A 1IGSA 5AFDA 1JF6A 1VPXA 3F4NA 4OU1A 1GJPA 2E6FA 3L5MA 4MY8A 3OVRA 5CG7A 3IJ9A 1TSIA 3RK8A 2OSYA 3LHVA 3CZNA 4XTDA 3M9YA 2D3LA 3EXRA 3FKKA 3W88A 1FXPA 4H7VA 1J5TA 3OEXA 5D38A 1Q6OA 3W6YA 2CLEA 4FNTA 2CLKA 1IZKA 1B2YA 2ZUSA 1WZLA 1BWLA 1F76A 2Q3OA 1P5BA 3CGTA 3VMNA 3B0UX 3STFA 4AWTA 3B0VC 3KLLA 4UR8A 1PIFA 4MY9A 2DZPA 4UTTC 1JD7A 1OF6A 3N19B 1BWKA 1SW3A 1HG3A 3NA8A 4M8UA 1CGXA 4BWLC 2IQTA 4DBDA 3ANYA 3B8DA 3L4TA 4X9SA 1UH2A 3TROA 5KITA 3TR2A 1VCGA 4JS3A 5IBXA 3A6OA 5DY2A 3W2MA 2WJZA 4LVAA 1K8YA 3K30A 3STEA 4UIOA 3EDJA 2Y2WA 1G94A 4N02A 4QITA 1MVYA 2YA1A 5K9XA 3W76A 4EF8A 3W2LA 1CGWA 3GTNA 3CPRA 1AG1O 3DH7A
chains in the Genus database with same CATH superfamily
4JQIA 2X05A 3IDJA 3LKQB 2IXUA 4JIHA 3AY2A 4IPPA 1DBKL 3MRDB 3P7YA 4UUJA 1AANA 1QPNA 3G5XB 3ULAB 3N91A 4ALAC 1P2CA 2HUEA 2AK4D 2VE6A 3B7UX 3BP6B 1S4IA 3HOGA 3I74A 4PS3A 4DIXA 2QGYA 5E03A 3UPWA 2NZLA 1KFWA 2C18A 5CP7B 1MMUA 4DX3A 1J0JA 1IBGH 2WBKA 3UAJA 5FXCH 3N14A 1EC8A 3AWOA 1PYWA 4ABQA 4GW4A 4PUUA 2ZUQB 3R7RA 3KHDA 1MCIA 1QQDB 4MWAC 3OMAB 2WB1A 3EJQA 3TN0A 4Q6XA 3TBSA 4PV9B 1T6WA 3IETB 2V5MA 4LP8A 2C4FU 5B1JA 3P3UA 4XTRC 1RL1A 2DJSA 4L4TE 3VYOA 5I1JL 4P2QB 1KPVB 2CA4A 5CEYA 4M7TA 3KWVA 5DMMA 5DBTA 4AZ6A 4YHZH 1MDRA 2PDFA 4UT7L 3OBEA 1KPUB 1FI8C 4B9GA 1AHWA 2YEVB 3P14A 1HIMH 5EU5B 2IBGA 1TA3A 4F3HA 1TCRA 1L0YA 5GRUH 2GI7A 5CGYC 4P2AA 4ZMGA 3LKPB 1U95A 3GM0A 4WFHD 3D3VB 1K7XA 3DVGB 3QCTH 4PJ8C 3U82B 4J35A 2VQUA 4E3VA 3FPYA 3AXHA 4QXUL 3WS3B 3QQ3A 3ZL2A 3JT0A 1AIZA 3GKWL 1TVLA 4BCEA 3S4SB 4AWSA 4O2CA 2Q8ZA 8XIMA 4WDIA 5ESVA 1CCZA 2N3JA 3RRSA 4M3HA 3T7VA 2KLRA 3TN0D 1ZV2A 2BVPA 1HNYA 2H0FA 4FHJA 1OOAA 3OKKA 1J5DA 4B5EA 4BFKA 4OVVA 4NZJA 3S8GB 2Z1VA 5CH9A 4IX0A 3PZNA 3LBOA 5KSUB 5F88A 4J1UA 3KCOA 4G43B 1TJ0A 1O75A 2C3WA 5EU6E 3T3PF 3TO4A 1ZQ5A 3KCWA 3L5WA 3W1MA 1NWRA 2VLRE 2G96A 4ZQCA 1UZ1A 4JDTL 4EI5C 4N4PA 1VFTA 3VXTA 4J7RA 2QKFA 1H0IA 1IM3D 3SZ6A 3E0VA 4HTYA 5E5MA 4ICNA 4QG6A 5CPNA 2R69H 2PYEB 3WQOA 2A9NL 3CTTA 3EYSH 3HFML 4NN7B 1D7KA 2VITB 3BAYA 3NEVA 3O0FA 2LLNA 4HHHA 5C9RA 2ID5A 2BT3A 1QR4A 3KTXA 5FM8A 1S9KC 3X41A 3OYZA 1V6XA 1W32A 4BYHA 2HPIA 4XN8A 3L45A 4UNKA 1YEEL 1UD6A 2B1AL 2IAMB 4NEIA 1B4KA 4Z1YA 3QEHB 1OJXA 3N6QA 3T40A 4WW2A 1XHHA 1QMLA 1LK2A 4QF1B 1HVQA 3E6FB 2FVLA 4K7FB 2EYRA 3NJ3A 1GHFH 2GK2A 5KJ4A 3D69B 3NCOA 5IIEA 4HKPA 2DZEA 5ECVA 2C71A 1KNOB 3WS6C 5AEAA 3BRGC 2EXSA 2MPAH 4RL3A 3PUEA 4JANA 2VXNA 1A6AA 5FSEC 2XV2A 2EG6A 2VN5A 1CLKA 3U6WA 2WQVA 1JZIA 3P60A 4AQEB 3W1TA 1WITA 2WHKA 3BE1L 1G6RB 3DRQB 4OF6A 1FIGH 1TEGA 4GAYB 4QCIA 5GGVY 1H1YA 4QYOB 4LV4A 2GY7B 1J86A 1H7PA 2FR4A 5IDZA 3X12A 2OZ4A 4GIAA 2C91A 4H0LC 5DJZA 5IQMA 1TRDA 4ZJ9A 4NNPH 4G9FE 3WEZA 4KK9C 4PODA 4JGJA 2HDJA 2DKUA 2PYFA 2AXWA 2FQDA 4XMLH 5SWSA 4B16A 3ZMEA 3TIEB 4RFNB 1XBZA 4YEEA 1ISZA 3NDOA 3TTOA 1DVTA 4FQXC 3MI6A 1HH6B 4N7QA 2EJ1A 2Z64C 1CQYA 4TVCA 1OV8A 4IDJL 2JV6A 3F62A 3TVMA 3B2DC 1IGTB 1KNWA 3CO4A 3KM8A 4FP1A 2JE8A 2A7PA 1TEFA 1Z42A 4OJCA 3B0XA 1KJ3H 5AOMA 1NDVA 3M0JA 1DFXA 4KUZH 3VD1A 1YPZE 5J5EA 3PWNB 2W91A 1ITCA 5EFIA 5A6IA 3NIDF 4FG0A 3UEQA 2X6AA 1TU2B 3RFAA 1QG3A 1N9EA 3NM3A 3WL0A 3NNTA 4Q8PA 1CTNA 3KL5A 2C3ZA 4CMMA 2XIMA 3GJFB 4S11A 2QJDA 3ROOB 1JPST 2Q3AA 4C56B 2XPGB 1X7SA 2VDOB 2YEQA 3FFCE 4HH8A 4R4FH 4GYFA 3IDIB 2ODOA 2NCMA 1AJ0A 2XUWA 1IEXA 1ZLVH 4IBYA 1LLZA 2IFFL 4LJ3A 4B5NA 4HCFA 4GP5B 2QVKA 4WWKB 4MZRA 3CNKA 4DEPC 2DWEB 4IKIA 5B4MD 4GAGH 3U4FA 6ALDA 1OAKH 4ATTA 4C57C 3QI9B 3HI6H 3M1OA 3D85B 1YPZB 2CZNA 2ZQ0A 1F73A 2KDGA 5F70A 3PG8A 3NCBB 5J9PA 2Y72A 4PJGE 5FA3A 4X5XA 3EXJA 3MRQA 43CAB 3V35A 3SGEH 3IDYB 1E5AA 5EC1A 4I7ZC 3WS3A 4G43A 2RUSA 3W7PA 2OSWA 3L4ZA 2F74B 5SV3A 4AX6A 1QO2A 1MCPH 3EYOA 3GM8A 1R7OA 4X5PA 4E8GA 2G3IA 4ZQPA 4YVUA 2DMBA 2DQWA 1OG6A 5HDRA 2WVVA 4LLMB 5LXEA 4YN3A 4J28A 4LC6A 4AEHL 2IS7A 3V0GA 2Z91A 4C54A 1Q2RA 5CU5A 3L3GA 1DQLL 1EBAA 1QSEA 2AXGA 2FNWA 5CLZA 5J3HC 2D22A 3UESA 1I3UA 2XIJA 4UAHA 1EUAA 3NJJA 5HHXL 2WC3A 3QT2A 3DFPA 2X03A 2F9BT 2BIHA 3C2RA 1CD1A 3WF0A 1WBXB 2HTBA 4GSRA 2BP8A 1BXUA 3ZPDA 2FWUA 1UXSB 3LHPL 4MY1A 3RHGA 4PV9A 2J4WL 5JHDD 1D9EA 3PNWB 4EKJA 2BGQA 4HK0A 2QL1A 4E9XA 2ZXBA 2D7PA 1TUPA 3DX7A 2Y1HA 4NQQA 1E40A 2A83A 4XZNX 3WQ6A 3OBAA 1SIIA 3VGFA 5CN2A 2XH7A 4AEFA 4DP0X 1TR9A 3NSJA 1NFIA 1SLWA 4FZ8H 5GGVH 3G1FA 2X3AA 1FH8A 4W7UA 3RMEA 2Z31B 3QYMA 2XKSA 5CD5D 4K35A 2YPVA 3SKNB 4LT7A 2LLLA 3F7VA 4A2MA 3BEVB 4ZX4A 4DH2A 2CZVA 3WLIA 1CL7H 4F5CE 4MNHB 5IQ9B 3D50A 4LEEA 4NM4L 3TV3L 1SIHA 2X2UA 4N2OA 1N9PA 1E4XI 3IU3B 4NQCA 4S1QL 1GIGH 2R1KA 3GLCA 3IGUA 2P8CA 4JQ4A 2VZOA 4NQDD 1KBJA 3UZXA 5LNWA 4JMNA 2ZUWA 4MXQD 3NT0A 4L0PB 4APQB 2NY0C 4GXUM 2W79A 3IE9A 4M93C 2FLMA 1SOSA 2N7AA 3BAJA 4DQOL 4P46B 3S98A 3TEUA 2GLKA 2C3GA 1M7XA 1RY7B 2AK1L 4M6OL 3V5DB 1E6JH 4JCLA 3LIZL 1VRDA 3AT8A 2R56H 1NS0A 3BW9B 3K8LA 4BZEA 1S3RA 3L3OB 2F1AA 2XQ0A 2Y1ZA 4TPRH 1H0DA 3ZDYF 4DVBA 5CEZD 2R0WL 4XC1L 3RHWF 1JI1A 2Z7YA 1O1ZA 3IEBA 2DAVA 1TIUA 3G8RA 3AABA 3CEUA 1W3HA 4GKNB 1KLFA 4NGHL 1I9IL 3K5SA 4XGZA 5JOFA 5DS2A 1NQ6A 5HWNA 3JV6B 4ES9A 1A0QH 3H26A 1SJAA 3BYTA 2JIEA 2ENPA 1NMAL 3ZTNL 3QVAA 3K71A 2HRGA 4H9ZA 3IJLA 4GMSL 3OIXA 1X4XA 1YMHB 2JF7A 3MV7D 5D8JH 4V1YA 4LAKA 4K73A 4P48A 4Y5VA 3U9PH 5AAMA 2OK0H 1GORA 3S42A 3C5SA 3KGTA 4AT6A 3W6MA 3CMOL 1MMFA 5GPRA 2GWGA 4GQGA 5E99H 5IEKA 4OFYA 1S7VB 2ZAHA 3HE7C 5L6YL 5HNNA 4DGVH 2CG1A 3PFUA 1CTOA 3MLYL 1UWRA 4PJXE 3IRDA 1QSZA 3R0NA 4PD4J 4CILA 3I6LD 4N2BA 5DC2A 1GEHA 1XLGA 2WVSA 5BZDA 1WF5A 2YW4A 3QQ4B 5CCHE 1KFBA 4H7CA 3UTPE 1KRCC 4HA3A 3UAEA 2XTKA 2O26U 4YNYB 4BZ2L 3ZYZA 3IDGB 4A8RA 1SMDA 4ABUA 1DIOA 4ES4A 4XBSA 4ZOEA 4FLSA 1GW1A 3P0XA 3GKWH 4P07A 1KPRA 1XD1A 4I90A 3JTTA 1OP3K 4LARH 5FYJU 1Q3NA 2VZTA 2AXFA 2Y3AA 1Z9SB 2CR0A 3IGFA 4X8GA 1K4GA 1K4HA 5HJGA 3MRLA 1E8YA 5JORB 3BEWB 2QDEA 1KFAL 1QFOA 1DSFL 1HOEA 2FO4A 3MCKB 5KBMA 3UXFA 3GS7A 5KVFH 1QSFD 1K8CA 1UROA 4HSAC 4YHIB 3APMA 2KX9A 1U91B 2JKRM 2MKLC 3FT2B 3MA9H 4C4BA 2YSWA 4YIWA 1YUHB 2IXQB 4HCGA 2V68A 4RMRA 3EOUA 1YNTF 1IF2A 1S7WA 1UJ3B 4X6EA 5AAPA 4HYVA 2VKZG 3O15A 2HJPA 4UTIA 5AKRA 5FA5A 4BFAA 1IBBA 4J4PD 4TMCA 2X6UA 1K3UA 1SM3H 4BQ8A 2QMKA 3ZK0A 1PIGA 1COBA 3DI0A 3HLAA 2WXFA 4Q6YA 4RDQF 3HR6A 4AC4A 5IROD 3PWPD 3ZLGA 1P5UA 3DUSB 5C3LD 1U2HA 2BZ7A 4PG2A 3LQLA 4QXTB 1X4ZA 5CM1A 5I7GA 3S3GA 4U1HA 5DYOB 1MRDH 1PTDA 4K7PL 4WO4D 2EF9A 4JTIA 3T78A 3HS0A 2IOIA 1I9JH 3CK0H 3S1XA 3FQYA 3TM6A 2FYYB 4ZZKA 1I7RA 1I9EA 1QBML 4B27A 5CZVL 4N3UA 1YKWA 3PWIA 3V1HA 3EIFA 2X4OB 2H9AA 2CR3A 3PUDA 3IDMA 3TJHD 5KYNA 4C6DA 3TU6A 4G1NA 1FAIL 4RFNC 3Q43A 1YXYA 4HNVA 5KMYA 2A4CA 3URAA 2PO6C 4M7LT 5BOOA 4O14A 3V0TA 2NUPA 2VN3A 1A8JH 3EW3B 5IGXL 3V0JA 1IEAB 3ZJ6A 1NOAA 4DFIA 4IOIB 3GNMH 1F8TL 3AIUA 3AWNA 5L9DH 3ABRA 2YAHA 5FA3B 5F4WA 3C60C 3N2TA 4RZCB 5ESAA 2OEMA 3VWJA 4UTKA 3O4LA 2X1SA 1H2JA 2AHIA 4J39A 4HJWA 4OBTA 2D3JA 3U6RA 1HXYA 2LHAA 5AOUA 1R1CA 3I9IA 1VIZA 5LXXA 2J1YA 2D7MA 4Z7UE 1T7LA 2VOMA 2WMGA 5ACZB 4PW9A 5C71A 2BERA 1IKNA 2VLKB 1J9YA 2CJ3A 4EKXA 3N9GH 4H2CA 1Y6KR 2R2HA 5TJWK 2HT4C 3AXMA 3P02A 1KFKA 3SODB 5TGBA 2DBLL 4NP9A 4V1DE 4Y2OA 4XBGA 3PXJA 1FWEC 1T8XA 2OO6A 5C0BA 1TIMA 2Y22A 4FQ1L 2VZ3A 5HHQA 4D9QE 4W9IC 4AE0A 4R7NB 1NPNA 5LO7A 1SMAA 3CH0A 1NAKH 4B5UA 1QO5A 4UQ9A 3KWXA 1UR4A 2X9ZA 2W65A 1XSKA 3B5HA 5DHDA 4DO6A 1MFUA 3AXKA 3NZPA 4B5VA 2H3XC 1OOWA 2OCJA 3HG1D 3GIPA 3G6JE 1U8QB 3AHTA 3HA0A 4LU5H 5HR7A 2CKNA 1MMYA 4OJAA 1SOKA 2A9AA 1U5VA 4M48L 1NMBL 1JCLA 1ZB5A 4K36A 15C8L 2HVJA 3WK2A 3BW3A 4ZFOB 4WEEA 3K3QA 3O11A 1NFAA 3GJEA 1M03A 3SRHA 2VKXA 4DPQA 3TA3C 4GNVA 3RB5A 3QXAB 4DP4X 5I0YA 3F4WA 4JFED 1ADQA 3GWQA 4ZMZA 3O6YX 3W1UA 5L8LB 5JDSB 3KRZA 4HQQH 1MDAA 4LALA 5KSBA 1I2PA 3SCVA 4PMRA 4MA3B 4KEMA 3DIVA 1KB5B 4HJEA 2FHFA 3RZCD 3GK8H 1QWKA 1EFZA 1CFTB 3LVEA 1TX2A 2R24A 4X50A 3NSFA 5DRZB 3UPCA 1W3NA 4D9LL 1AFSA 2I9LB 3IDIA 4Z1PA 5PAZA 3S2MA 1H50A 3HURA 2V2TB 1RUPL 3F7PC 4GKSA 4GO6B 4P4KB 5E56A 2EG8A 1FIGL 3N40P 2VITA 3KGUA 1GVEA 3ZTJG 4PV1C 3K5XA 2Y2TA 3QUXA 1OTTD 5B7ZA 5FYKE 1RWCA 4IEFA 3N9RA 3WMLA 2UY6B 5A94A 3U46A 2IF7A 5EZJA 2V5SA 3N42F 5T3XD 3W11D 4EAEA 3W7GA 4Y16A 3CQKA 2VCOA 7REQB 1KBKA 4DPCX 4JPIB 4OF5A 3B3BA 3CAWA 3NQCA 5TNVA 3P69A 2QGCA 4IYKA 2FO1A 4PMQA 4XBJA 2GQ8A 4RBPH 4XIAA 1HEZB 5FIPA 3BW4A 1RBOB 4J2PA 5TE6L 1YX1A 1UOWA 4F15B 3W28A 5BXSA 1GG1A 1RHHA 1WFNA 1VPOL 3S37X 2PCEA 4NNCA 5EB8A 3BHBB 4LVFA 1EERB 3TJHC 3B9VA 1KJ2B 2MUCA 2Z92A 4M7ZB 3WLWD 2OOVC 2FZ3A 2WBJA 3ET9F 2GJZA 2NY3B 4M6PA 1BQKA 3F2LA 2ISWA 2VAJA 2ZXWB 4V2BA 3RP1A 3VSQA 4Q97A 1S5VA 5CSYA 4BI6A 1J8RA 3ME0B 4JQIL 2IDFA 2DIEA 3JSSA 3CWGA 3T0WA 2VDHA 3GIZH 4UCGA 1RPXA 1CFMA 4DWSA 1T22B 1R75A 4UIMB 4DJDD 4W68A 3DX0A 4X4KA 2X4QB 4G7SB 4BF5A 1C08B 3S3PA 4UNVA 4M43H 2A1WL 3MJ8B 3PUUA 4H88L 4XOAA 2CBTA 2NYYD 3CSBA 1P7QD 1B57A 4LUTA 2BPBA 5LWYL 1MHPL 3FQXA 4PD4K 1KZQA 2KS0A 3F6IA 4F33B 5CFAA 2BGNE 2CDGA 3IUDA 3A4DA 1DJYA 1OAKL 3S5YA 3VNJA 1VCFA 2AAMA 3W75A 4OQTA 3MWXA 2APTA 3V10A 3MCKA 5JW5B 1JXFA 1W1B1 3QH2A 4IIGA 2NNFA 3TEXA 4KKBD 4LSQL 4OZFA 3L0GA 5D2YA 5C0BE 4FAAB 4XAZA 4V11A 5TH2A 2EUVA 2JKEA 3AITA 2Y7DA 2BOBB 3KXFD 3BH8B 4NGHH 2PR4L 4ZNCD 3IRZA 4X5RA 2WMHA 3PTDA 1TE1A 3FONB 5C3IA 2OP4H 4A38A 5C70A 1NU5A 2CLHA 3VFVB 4Z7WF 3Q6GL 3N6JA 4FXGC 3CNYA 2I07B 4GMSH 3N3MA 3P67A 5LLIC 4IM4A 4KFFA 1UR8A 4FLOA 5ENWB 3B43A 5IQLA 1ZGLB 5D1XB 4ONGL 3U9PL 4KJQC 1DQLH 1NBZB 2H2PD 3S7GA 5IB1B 1NSSA 5RUBA 1OVDA 2D03H 4UT7H 4AIZA 2V2XA 3G22A 4AMWA 3MTRA 4QGYA 2FQGA 2DD8L 1W0MA 1EEZA 2NR6D 2VXQL 3PWLA 1A5KC 5D37A 1Y18B 1C9SA 3LN5B 3WIAA 3X1EA 3UGEA 5KBLA 5CUSL 2WQDA 5G4HC 4Z2IA 1X1IA 3FSOA 1NFDF 3I3EA 2VSKB 1X5MA 4LS1A 2Q6WB 5D70H 2E1WA 4PJHF 1Q6RA 1DWHM 1KY6A 1RLWA 1Q5MA 2ADGB 3ZO9A 5AYXA 1S7RA 3MZGB 1MCWW 3OZMA 1EV2E 3QUZA 3MGTA 3ZLFA 4JB9L 4L9LB 1ETA1 5SWZA 4W86A 1GZ1A 4OT7A 1JGEA 2PO6A 4PJ7F 3NK3A 4TQHA 3W38A 2DDQH 2GJ6E 5EPMB 4IRSB 4LAQL 1DBAL 5F0MB 2BFVL 1L4IA 3AQZA 2NRDA 1SXNA 5D2NC 3JVFC 5J0BA 1CYGA 1Q0YH 1TVBB 4GINA 3P4NA 3UBXI 2PDBA 1Z89A 3NBJA 2WNNA 1I1RA 2JCCF 2NTFA 1JPMA 4QNEA 5DQPA 5C7VA 4JFDD 2NCEA 4G9FB 4Y4FD 4NKDB 3ZKXC 4ML9A 3SEPA 1L3WA 1Y7VA 4UM8A 2FWLB 2OMXB 2XU2A 3P4OA 2VCCA 1QRQA 3O06A 5HNRA 1Q7MA 2GJPA 4P5MA 2NQDA 3SJVA 1W3IA 1OM0A 2E6YA 3ZJAA 2DQHL 5C92A 5I8CA 2ZYRA 4OCWL 1BZDA 1NGZB 2W4XA 3QJFA 1B9ZA 5K93A 3TA4D 3MRDA 3VMOA 4Q9QH 1U3HD 2PP8A 2VGGA 3T6ZA 3DHMA 4DNHA 2F53B 1H4PA 4DQWA 4WFFD 3H21A 2G2RB 2Z3FA 4RGOH 2KAUC 5C0AB 2QCGA 3FA4A 4MJ5A 4IIDA 2DKSA 3GFYA 4MJMA 4QHRA 2A5UA 2FBOJ 4QHUB 3PP4L 3WAJA 5JPNB 1NELA 1FC2D 5IJBC 4BDVB 1US0A 1T21B 3P4NB 3IDNB 1ZAHA 2O9RA 2Z7ZA 1MWAA 3GJFH 2ZONA 1M05B 5DJ6B 4QWWD 4WW1B 1YTDA 2ZXAA 4KXBA 4NQVB 3UROR 2XSAA 3M7WA 4IIBA 4XPBH 3WF1A 3D33A 4NJIA 1OD9A 4A7SA 1FGNL 5IB5B 5GS0H 3B1UA 1EHLH 2FBRA 1XDLA 4YEFA 2CIRA 4GYPA 4YHNA 3TFCA 3W74A 3FFSA 2E76C 4LRSA 3WLNA 1MRFH 3DHJA 3H2QA 5KZMA 4KNUA 3KCPB 4ZUTB 2EUWA 1IGYA 4LNCA 4L1DA 4LRTA 4ZFCA 7ENLA 2W67A 2EYTB 2TSYA 3E6HA 2VMFA 1DYUA 3AW5A 3ZHLA 1EP1A 1HP4A 3E0IA 4LLWB 3P3SA 4C6QA 4Y4KB 4J3UA 1YSOA 3K13A 4JRYE 3Q67A 3HMWL 4KXAA 4F92B 1KTNA 1XEUA 3IIVA 3PGDB 5FKAB 4KTEL 2YRBA 1NBZA 1O9WA 4ALAH 4EMZA 3GNOA 4TO8A 1U0QA 4PB3A 5BUPA 3RO6A 4KI5C 4H9MA 4I18B 1CLOL 5PCYA 5TQ2H 3GU2A 5CG0A 4IG2A 1SFJA 4X8JB 2WTRB 1P43A 3ATBA 2NX5B 3WIFA 1M1XB 4NUQA 4O4YL 1GVIA 1C12A 1W0WB 4NT0A 4KZCA 4RZ4A 3SZ8A 2IANA 3D39D 1S38A 2I26N 4X22A 1EMTL 3M1CA 4L8SB 3WLJA 4YO0B 5ABDE 3NVTA 4A3RA 1PS9A 1X97A 3B9KC 3HJEA 3DA0A 1BVZA 3HHSA 3L4VA 4QRRE 3L5XL 5HHNB 1QI5A 5DUBB 1P0SE 5CGTA 1KXTB 4D2NA 1D6YA 4JZJC 4JFWA 5H35A 1EJSC 3OPZH 1CLCA 4J3BA 4U3CA 5I8OH 5CEWA 2PLKA 4G6MH 3TCSA 5D1XE 5GVJA 3DHFA 2BHYA 1DSYA 2QVIA 3BSZH 4XP1H 1UR2A 1AY1H 4RE3A 2CFDA 5DFVD 1R3SA 1Q8MA 4OZHE 4U6YB 3WS6A 5JDJA 2QV2A 1ITBB 1MF2H 2VRKA 4RMQA 4XPAH 5D7SH 3S88L 3PG2A 5I3GA 2H3NA 4RWHA 3QXTA 4RIRA 2OGYA 3TIEA 3N12A 4DBEA 3AWFA 1GGTA 2XV3A 3WQEA 1F02I 2FTWA 3U36B 2QFRA 2BM3A 4Q22A 4KCVA 3OG4B 2D3VA 3QCVH 3QISA 2XFFA 1J5OH 4H25B 3RUGA 1A7PH 1LE9A 1Q2SA 3BKMH 1QLFA 5ALCH 4B3EA 2W9MA 5A6JA 1TTIA 2QELA 1ZDSA 2IAAC 1OY0A 1FVCA 2G0WA 3W7KA 4WY0A 5CZKA 1OCJA 1WZ1H 1FFOB 2KERA 3ZDXB 3F7RA 4CDHA 3IJ8A 2YPIA 5CC7A 3T07A 1VGKB 5HPMA 4JVPA 4BELD 3QNYB 5I6KA 1LQ2A 1WKDA 3AIWA 3F04A 4OV6F 5A1AA 2NXZD 4IJRA 5BU6A 3MBXL 4NYUA 5C9KA 2ATKA 3JVGA 4JZJB 4BK5C 1S3TC 1KTDA 3DMMA 1LRQA 1LQBC 3M45A 2HJFB 1HKKA 3AB0B 2OXGA 4QRRA 3LIZA 3U0WL 4DKEL 1W3TA 2R8WA 4HSQA 1YTEA 4W4QA 5FAGA 2R2BB 3U4KA 4JTCA 5MKGB 2X28A 4ZOAA 2ICES 3GGWB 5D7KD 3STZA 1KRMA 1LP6A 5HHOB 4DTGH 1O6SB 3IMRA 1JCXA 3QMTA 4IX2A 1S9XB 3VXUD 3FIGA 3BD4A 4KESA 4U10A 2W0PA 3ZXAC 2D9CA 3N4EA 5DANA 1EJRC 1QRNB 1R5IA 3BO9A 3SOBL 2OG9A 3DFNA 3VIKA 2QVTA 3EDKA 5E8NA 3HI1A 1E72M 4EIZC 2E2VA 3FW6A 3G04A 4LIQE 4FNPA 1Y65A 5DA4A 1S39A 2EO9A 2XBZA 3KLKA 4LCCC 4BFIB 4JREC 1Q85A 3TSDA 5IBXC 4HAKA 1TJGH 2FX8H 3KNBB 4JO4H 2C9AA 4HS6B 5JU6A 4R90L 1RUKH 2OSLB 2R4RH 5C7ZA 3TJEH 1YC8A 1GTNA 3LAFA 4X7TB 2HX8A 3W86A 3KPSB 1H7NA 2NY0D 3TN6A 1AKJB 2XINA 4K2UH 4UR7A 3PZMA 4LLDA 4OFDA 4PJHA 4EN2A 2WCAA 1FO0L 2Q7AA 2XZQL 5AHIA 1N68A 3D3VA 1ETZA 1WEJH 5FDYA 1KQYA 3Q8EA 2YCIX 4R0LA 5DY3A 1JZHA 4TQPA 3WMSA 5J89A 1NARA 3ARVA 2YXWA 1TYJA 1QD0A 1PEZA 2K9FB 4HG4J 4YGVB 3BLFA 1KIRB 5T1DL 1RZPA 3DIFA 4OGYH 1N64H 4WSKA 4DJEA 1UUNA 1GKOA 4AQ1C 2I9EA 4TV3A 3UT0A 2J8TA 2VVNA 2JCWA 4HNNA 5DN1A 3BQVA 4FJYA 3E9UA 1YPXA 1EAQA 5H2BA 3RX8A 4BH7A 2W60B 1DVQA 4Z7UF 1KA9F 1OSZA 1PX4A 3OG6B 5E94B 1HSAA 1MJJA 1U8JB 1K1WA 3DVNA 2APSA 3SGGA 3HZVB 3GTHA 5DUBA 5C0IA 4O15A 2HB0A 2HLFC 5F9OH 1SM9A 4F9DA 2Y7QA 3FT4A 4ZMLA 1ZCOA 1C7TA 5DFAA 4DGYH 3SCTA 4YYFA 2VZVA 1SW0A 2XTJB 3VFNA 5DJDA 4AJ0A 4MIMA 1NCWL 3KS0J 4S1FA 1EXHA 5LIUX 4GT7A 1CIUA 1MW3A 2XZZA 2IAMD 2HWGA 4XG1A 3TP4A 5JBDA 1XYLA 1NH6A 3BIKB 3RJDA 3F5JA 1QZ1A 2XQYK 2BH0A 2WTPA 3X42A 4XAFA 5E2VH 5AVHA 3UZQB 3QNFA 4JQVC 1L9OA 5D71L 4OM0H 5CGYD 5KS9E 1GGIL 1GJWA 1GOFA 2A6JB 2B7PA 3MRGA 4L3FA 5HGHA 2JF6A 2PDMA 4XAPA 1H60A 4JHVA 1F4XL 4MS6A 1ZGDA 5D04C 3WBWA 3RVXC 4XN1A 2IG2H 1YMMB 2E7BA 3DBXA 1DYZA 5E2UH 1OM3H 1J88A 3VMPA 3WE6A 1SY6A 4RA0C 4KZEH 1E15A 4WI2A 1UXWA 4A2GA 12E8L 4U1HB 4MASA 5DYOA 1T5XA 3PWGA 3TQVA 1DYSA 5C55A 2JQXA 4CJ1A 3F85A 3UZYA 2ADIB 5I0XA 2NVDA 2HK1A 3QZWG 4PWHA 1UH4A 4C4UA 1LF9A 4OCRL 1ZAJA 2WLLA 3NIFF 1AH0A 1UACH 5CJXC 4MWAE 4CCCA 2UWFA 1DL7H 4Q7NA 1X6UA 4ILSA 4ZCWA 3W7LA 1DANT 1QBLH 1PUDA 1OGTB 2HLEB 1OGAE 1AQDB 3WX7A 3DYMA 1XGUB 3N0PB 1HT6A 3B3IA 4I2XE 1LM1A 1XLHA 4Q8BA 4ZQMA 1WT5C 1LP9F 1ZAGA 2ZJSL 4TQEH 3LPFA 1JPKA 2QZQA 1BIIA 3SDAD 3TW7A 2ODHA 2IGTA 5BZXA 3FCGA 3EFFB 3U9UA 1VF8A 2DZWA 4C1NB 5CBIA 2GTWA 3I7SA 1SXZA 5IBUB 1CDYA 4O50A 3GS4A 3MLUL 3AAZB 1REIA 5LCVA 5TFSH 2DPKA 3N1QC 2G97A 3F03K 2BHUA 1U6AL 1XZ0B 2YMXH 3QO1A 4LSTH 3SBQA 2NUTB 4KTRA 1G5GA 4PVLA 5FACA 4ZBJA 1JF1A 1PJ9A 3WKNA 1JDEA 1K6AA 1KLGA 1TPH1 1RH8A 3SYCA 4K8RL 2XFXB 4QTFA 4P57A 4X9HA 5K59E 5HVWA 1UB3A 2Z1SA 1PKOA 2GG1A 1TNNA 1EDTA 4H3DA 5ERWA 1P0DA 2Y63A 4OFCA 2DDQL 2CPCA 2P43B 2ZWYA 4UQ3B 5DWUL 1UUOA 5HJBA 4RBPK 5EOTA 2MPVA 2P80A 4F3FB 3DURA 4F9PC 1UFUA 2J73A 2Q9OA 4PJ7B 4YHEA 3ERXA 4IIFA 1WZMA 4UOW0 4JDZB 5JMOC 3ABLB 3KCPA 1FFNB 4K9EL 1A14H 5GRJH 2VEPA 1OCBA 4LEXL 2CALA 3FTGA 2WLKA 2I60L 1BKHA 1LP9B 3TGXA 3SE3C 4NO0B 5TQ2L 2B0MA 4IOSD 5LNGA 4LSVH 5CCKL 1NSNH 2Z1KA 2H6OA 5GZND 4JPKH 5IB5A 3ARFA 2NV2A 1FWSA 4WJEA 5D9OA 4XK2A 2OX5B 3DC8A 4BUGA 4PRBB 2V2WB 2CUIA 4F37F 4GJ1A 5KVEE 4QLKA 3BWWA 2V82A 1SF3A 1H7WA 2AANA 3AHXA 1NCOA 1NLDH 4NCC2 1ORQA 5GSVB 4RGND 1MREH 2ZIDA 5EULV 1MEXL 3C9NB 1F58H 4MD0A 4NENB 1IGMH 4OFPA 1X8CA 4HIBA 4ZS7L 2ZNXA 1D7BA 4NO5A 3GMRB 3HGSA 1HTYA 3LKNA 1MCPL 2MCPH 4GSDH 3IJ6A 5BS0A 3TSBA 3C5ZA 3HN3A 4ZFGH 1A53A 1P6CA 2FZNA 5C0CE 5ICXA 1J1XH 4U3SA 3QPXL 2J8UF 3L4YA 5D72H 5IF0B 4WTQA 3TPUB 3ITXA 4PRTA 3WJJA 5FYLD 4MNMA 2DSKA 4NHVA 4H19A 4JM2B 5T1LB 5FLVA 5DMKA 2OYPA 3KBSA 4JX0A 5I6LA 4A7GA 1QFUL 4G1KA 2I9TB 2RGMA 3F7VB 3WJXA 4FTDA 3D18A 2VDQL 2P3ZA 4TNWK 3AS2A 2NV1A 4CKVX 1IGWA 2XTJD 4LF3A 2HPTA 3U48A 4Y16D 2E75C 3V0HA 3VWJC 1P1MA 3MO4A 1VFAB 3P3RA 1WKEA 3G5EA 2B77A 1O7VA 4X0VA 4JR9H 1P7HL 2XTJE 1EC9A 1T83A 3PJLA 3PNWA 4GISA 4J3OD 4UFIA 2JEQA 2FL5A 1B9KA 2VXSL 3IVTA 3GLAA 3IFOB 3L9EA 4FQLL 4HKJB 4NNYA 4PJ5A 2X30A 2CZEA 2SODB 4GO8A 2P7TA 1N7QA 5GJPA 1Z0MA 1UB5A 3M0KA 1KIRA 2VR7A 2JKTM 2W94A 35C8L 1KC5H 4NQCE 5T1KD 4LS2A 3MACL 5G5IA 3NRPA 5JIDA 2VC2L 2X2HA 4TQ8A 4C83B 2YJLA 3EJZD 3RZCA 3NXFA 2ADFL 3OX8B 3ULUC 3WA3A 2YR3A 4QHKI 4NJJA 4RXFA 3TA3D 2BINA 2BX7A 1XWVA 3D2UD 3DDFA 4K8RC 5DHXB 3KHJA 1FCUA 3NCWA 3E5PA 5FA4B 3ML9A 3L3DA 3LZRA 4LFHD 1XIDA 2J4GA 3U57A 2CBMA 1EGJH 4AEIH 3QI9D 3QUZB 4W9CC 1XF5B 2GL5A 3EPNA 3C6LC 1IVVA 3WQGA 2E9BA 2X88A 2CIKB 4U6TA 2ADGA 4JFHE 3G3DA 5I16B 3R25A 3OYXA 3WQ4A 2AERT 3NN8A 3NDZE 3L3OA 3FJLA 2YGPA 3M4HA 4K3HA 4OLYH 1Q90A 5JHDB 1OARL 5EUOA 2CRYA 3ARUA 4KO9A 3AQDA 3C6CA 4IGNA 1U58A 4LE8A 5IV2B 1KB9J 3Q01A 5ETUA 5BRQA 1GVRA 1RURL 4QLWA 4OLVH 2F6KA 3QHNA 3HMXL 1EDGA 4HK3J 4ZX5A 3RKDD 3UZQA 5A8NA 1JWSB 1QKZL 2YWYA 3T2LA 5ALBH 2OPCA 1IGJA 3MJGX 4JPIA 1E67A 1A9EA 1G7LB 3W2DL 2OK0L 1ZGLA 1KENL 1K9DA 3LBCA 1EA9C 3CQFA 1AZRA 1Z5LA 4RFOL 5LG6A 4UZGA 2PDIA 3VGGA 2AV1A 1PS3A 3T5WA 3SW6A 5K7JA 2ATPA 3UETA 3QE5A 4GRWH 1SEQH 2Z31C 5HYJD 2DORA 5IY5B 2E24A 4JPVL 4U1LB 3EHBB 4A4AA 1A4JA 1SO4A 5K1NA 1J6OA 4Y2WA 2NW2B 3ABGA 3FC8A 3RWEB 5HYSB 1XINA 2NZ9D 5FUZH 3CU1A 2VLMD 4P5RA 5DUPL 3TC6A 2G8ZA 1YY9D 2PP7A 4PR5A 5I9QB 5LNSA 2PGRA 1V7WA 1OTUD 3TEZA 1FFQA 4M62L 2R83A 2R8SH 4IFOA 3D34A 4N3TA 3W7RA 1VB9A 2ZUXA 1UZHA 3MLZH 3TH3T 4M1RA 1FFOA 1A6ZB 3S34H 1C3FA 3TJLA 4PFEA 4P2RD 3XIMA 5INCB 4YXLH 4Z3JA 3ECVA 2LU5A 4Z7OB 4DJFD 5BW6A 3AUOA 1QLRA 3P0YH 4N2CA 1UQSB 2O55A 2TMDA 3BURA 1P4BL 3DCPA 3FU3A 2Z7UA 1XIJA 1W2PA 4GSXA 1Q6LA 2OJZL 2VEFA 4QGTA 1UKPA 3FFDA 4YPJA 4X7SL 4AYSA 5I17B 1YMMD 4ML4A 3SM0A 1FP9A 3UMNA 5CD3A 2NLIA 1G0YR 1S6NA 1JZFA 4TLSA 4XBEH 4U0QB 3IJEB 5JMFA 1FQ9C 1PZDA 4P61A 1JV5B 5MP6H 1MQQA 4B97A 3MOAL 1EFXB 3D85A 4WI3A 2F18A 2N1TE 2O5YH 2R1YB 2XPZA 3HRZB 3NFSL 4ZMVA 4LP4A 4WOQA 5DD0H 3L54A 4E9RA 3B8VA 3NO1A 3P93A 4W8LA 1AUSL 2F61A 1G6RL 1LK2B 4TX9A 1NSXA 2JJUA 1FZKB 2XHYA 4NM8H 1Q4WA 5CIPB 2CHWA 2YUZA 1BF8A 2E46A 2PTUA 2XIDA 3FULA 3MUUA 3QUYD 5L8JB 1A50A 3FB8A 1DQVA 1FFPA 1FRGH 3JQOB 2GDQA 5IFPA 3G04B 3DBPA 3WBDA 4REQA 5LN8A 4G6AC 3C2SA 1ECZA 3ACTA 2D4FA 4JJHA 1EGVA 3HV9A 5JNYB 1QFWM 3RAJL 2G5BB 4ZFFA 3NQDA 3UWVA 2UY6A 3PJUA 1FCGA 4JN1H 1OQXA 3C5QA 4FQCL 3LLDA 4KKXA 1R3YA 1TQUA 2WTRA 5G5DA 5SX4H 2CBVA 2ZG2A 3GHEL 3SDAB 3TBYB 1E55A 3GNML 3I10A 3JVAA 5HQEA 3ZLHA 4UQIM 1V3LA 3IIXA 2X3BA 3CPUA 3ZJKA 3BPNB 3LD5A 3O8XB 4MDIB 4NUMA 4TVPD 5JZ7C 4DP1X 1PO9A 1KLUB 3B03A 3MP4A 1FCBA 4XP6L 4MXWH 3T4AB 1NFPA 1RUMH 3GSNB 4K71C 3S5LB 1HP5A 4CBPA 4CC0A 4Q4QA 4UMBA 4TVPE 2VYOA 4UT6A 2X4SB 5AWNL 3GG1A 5LNUA 3AWGA 2IPKA 1FGNH 1WVZA 1U8HB 3TXZA 1U3YA 5DURD 5HDQH 1DORA 3TOYA 3OTRA 1G9ML 3FH7A 2CUHA 2WNKA 3WO3B 3AUWB 1EF3A 2ZZ3A 3KP1A 3ARXA 2BSCA 3R0MA 4FULA 4R7NA 3GINA 3SO5A 1HHKA 4WY7H 1OGAB 1BREA 1FG2A 3NG3A 3Q6FA 1VFMA 4XT1C 2YPLE 1TQCB 2WZ5A 5L7XL 3QAQA 4S0TD 1H3PH 3FN9A 5F97E 3CUXA 3I65A 2A74B 1PYMA 1FO0B 3SN0A 2A9BA 3OLDA 3GQFA 4G2DA 3NEOA 1ENUA 3HMWH 2DLEA 1A4MA 3QB7C 4LVOB 1QEXA 2WKOF 2YRLA 1MQRA 1A6AB 3GUTB 3VIOA 5F6HJ 3LMJL 1MPAH 4PQXA 5IJKC 2J7GA 1MI3A 1YHPA 5HJ3B 3CJPA 3SDAC 4KVNH 4HHPA 4QCEA 4QRTA 4KXCA 1AVLA 3UC0H 1GTHA 2H41A 4NUPA 1UB5B 1KV8A 3P3BA 4FQQB 3P5ZA 3MKVA 1G1YA 1LCOA 3W29A 4XNZC 3VXMD 4UINH 2ZAIA 1AKPA 1KXTA 4GI8A 3M6YA 4E3TA 3RHWK 2WXHA 1MDLA 1MYRA 2E9LA 1A5CA 1H8NA 4X4ZA 2OKMA 3V9FA 1OJPA 2BASA 1OAXL 3F01A 1AR2A 4W5ZA 1NLDL 4Y9NA 1TV7A 2FGBA 4GKTA 3HLKA 4I8DA 1W91A 1W0WA 3MGOA 5FUOL 4W84A 1WS8A 3CQPA 2VVSA 4CADA 3BKJH 3E3QE 3TNMA 3LQAH 2XN1A 5T1JA 1HXJA 4HWEL 4M5PA 2WSDA 4AZ5A 4BKTC 3BSZL 3EBAA 4HIXH 4XP1L 1TLKA 2FUTA 1Z7AA 4WIQA 4YJ5A 5AZEH 3QFYA 1FVDA 3AXXA 2CH8A 2DJXA 4ZTOL 2O5ZH 3B0PA 2Q7NA 4AENA 5IR1A 2J7DA 1FORH 2HFGH 3GHSA 1ORQB 1N0LA 5GSVA 1KV5A 5MF5A 2QS8A 4ANKA 5KVMC 1NVMA 2WGXA 3IF1A 2VWSA 3PZTA 2HZHA 3GDMA 4QDPA 5DSCB 1L9TA 1AQDA 1EJFA 3N85L 4ODSL 3HG1A 4PWKA 3VGBA 4BA0A 1E4MM 2XNAB 2QAFA 5JUEL 5H8PA 1XD0A 4GCXA 1EGJA 1LWRA 1XR8B 5A7EA 2OX4A 2WAQA 1T1WB 2KH2B 5ALCL 7PCYA 1B3VA 1ICSA 1TX0A 4N2AA 3NZRA 3ZKND 1TZ9A 3B3DA 4F9LA 4YFEA 3ILPA 3JZ7A 3CCHA 4V1DA 5DS1A 4OTKA 1BZ9A 5C0CB 4FDWA 3MLSH 5FGCB 2WWNA 3VUPA 4LLYB 3C60A 4YHYC 2JCCE 2VDRL 2TSAA 1X6NA 5I0DA 3PZ9A 2JI2A 1SN5A 3QPQC 1IGFL 2IH3A 2XRAH 3D52A 5LBSH 3IB4A 4PJ9C 4EXKA 3AFJA 3F5WA 2KZ1B 3H7BB 3OXRB 3ZYIA 3ECQA 2BW5A 2OMUB 1KJMA 4P9MH 4W6YB 3TCLA 2CR6A 1JGLL 3IF1B 4APQA 2Z0BA 1D9KA 1U3HC 5KBKA 5MENE 3FYIB 1AZ2A 2EIJB 2DPEA 5C0GA 1JPTH 2MEJB 4X6BB 4F3FA 1LL4A 1XDTT 2A1WH 3K6OA 4H88H 1TPXC 1I8KB 5IW6B 2GSIB 4I9WE 1TZZA 2HRPL 4PJDA 1CE1H 3RPIB 2DT2A 2DQ6A 1IC5H 1S9WA 1LMKA 2IAND 4D0CA 4EIBA 2F84A 1MI5D 2HJLA 2NOYA 2RFXA 3ZX1A 4PG9B 3OGRA 2J74A 4P57B 1E8XA 1RZGB 3MXWH 4CA4A 3RFZB 3ZKSD 4KKCD 1PKNA 1IRAY 1DJXA 1ZCRA 2F53A 4NN5B 5J3HD 2J7FA 3BZJA 4EN3B 3PP3K 4MWAA 1TTPA 2NW0A 4I0PD 3CDYA 3B2VH 3HE6B 2VH5H 2HSAA 3V7PA 1F90L 3TX9A 4ONFH 1LEGB 4Y7OC 5BRPA 1H6UA 5I1GH 1WCBA 1WMNA 1E3XA 3K6DA 4W9KC 4P5MB 3N41F 3KBPA 5FO9A 1JWMB 5IHUL 1Q1JH 1CFQB 2XWBA 3UJJH 3NOIA 4XZWA 2XUCA 3ZM8A 4M93B 4ZAKA 3C2OA 1FZJA 3Q6GH 1QOXA 1WBYB 3IGXA 2J1KA 3BSMA 2BS8A 4YBQC 3UTTE 1P5VB 1X5XA 2HAZA 4L4TD 1WAWA 4QRTB 4KKZA 4HMNA 2PCXA 3ALXA 1RLCL 5CSGA 2QSVA 5CMAB 1JZ2A 3KVJA 1BMWA 3UZJA 4MQSB 2VMJA 3U83A 4BJLA 1T89C 5T1KA 2OFJA 1E7VA 3QMSA 5EPMA 4XCYB 4NJAH 4BI7A 4OCSL 3P77B 1SEQL 4EO5A 1PDYA 4KETA 2Z92B 1ZPTA 1VBGA 1QFWH 2HWZH 2BMKA 1Z32X 2WY3B 4FQHA 4H5SA 5E6ID 5IG7A 3BHBA 5F7BA 4AC2A 2QCEA 3T6CA 1JPGB 4X5XB 2F6UA 3T81A 1ZT1B 3GDBA 1JCKA 4LNVA 3HZKB 4W4OC 1JCNA 3F5KA 3MMTA 5FJTA 3H6OA 3IFNH 2VKWA 4IRZH 1RCXB 3WTWA 1EHAA 2F8OA 3QI9A 3IDXH 3QOMA 4M81A 5M17A 2PP3A 1UM6L 1AO7E 3EX3A 3W1PA 4OU3A 1W16A 4WUUD 2Q09A 5EBWA 4HPJA 1ZLVK 1V3MA 1QRNA 1R5IB 4M5TA 5GJSH 3PQYB 5TQ0H 1YEFH 5EEWA 1E0OB 3WTSA 4A6YB 1NICA 1PY0A 1K4CA 1HQTA 2I32A 4NL1A 4KFMA 1NBYB 3CM4A 1PZBA 2JXMB 4CMHB 1CU4H 2JEPA 1YEGH 1NGPH 1W9XA 4KTDH 4UQ2B 4YSPA 4KH2A 5DXYA 2I9LA 3CN4A 4JFDA 2KZHA 4EAYA 3GMPA 2KUTA 3QDGE 4OZGB 4HK0B 4AXWA 4DETA 2RJHA 2HNEA 3HGJA 3LDVA 5DD0L 5EN2A 1L0XA 1AZUA 3WGUB 3V4PH 3EBGA 3QUMH 2HKAA 2BP8B 1QI4A 1IGTA 3H3PH 4ODVH 3QXDA 2ESCA 3B2UC 3MBFA 1SYVA 5CILH 4LOUD 4A7VA 3MXVH 2GWNA 4HA4A 4G1MB 5AW0B 5DD1H 1LL6A 2A73B 2P44B 3R0UA 2DUZA 1QFPA 2NDFA 1QSEB 5JXEC 4G72B 3G8EA 3NFPA 5HNTA 1EFXA 1IUZA 2WQUA 4MAUH 1VHNA 4ZXBB 1HKWA 2MQGA 3L4WA 4AIUA 2QJIA 3MRPA 3RLHA 1NMAH 1QLFB 1OD0A 1TV3A 2IW0A 3NQ2A 2VX7A 1PWLA 4WHTB 3KHOA 4Z95L 3NSNA 1R3KB 3KH4A 4HF5L 3UTQA 1WNOA 1QBLL 1T22A 4FX8A 4IMDA 4FXFA 3OC8A 2E8YA 2TSBA 3EADA 4MXVE 1ZHKB 1EHLL 3BQ6A 5ABFA 3GEFA 2WV3A 4UZSA 1FOBA 4AWUA 4KPLA 3I02B 3S9ZA 1ZK9A 1RHHB 3OKDA 1P1ZA 1XW8A 4S2SA 2HUHA 4JL1A 3GYRA 5CKGA 1OFDA 1PBYA 2PRLA 1GZHA 1ICTA 4XE0A 3BZGA 5G4EA 4ADJA 1UZGA 4W6WB 1M6JA 2YR1A 1D8CA 3QWOB 1LM8V 5DRWA 3ZE2E 4D9RE 2PDL