4FNSA

Crystal structure of gh36 alpha-galactosidase agaa a355e from geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRLPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 232
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnsA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnsA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnsA02
1LZOA 4H8HA 4NZJA 4OT7A 4MAZA 1P6WA 3IK2A 1S5TA 3L5LA 2E1DA 4NVTA 2IQTA 3CEUA 4K6AA 1L9WA 3P84A 3W7LA 3OVPA 4A2SA 2R14A 1NVMA 1O7DC 3TSMA 1KFCA 3P62A 3VGBA 1CGUA 1NFBA 1GVIA 4X9YA 2HSAA 4NX0A 3W2NA 4E2BA 1MEHA 3QEZA 3LHWA 1H7XA 2XWDA 3BVXA 4DF1A 1TCMA 5AYYA 4HNTA 2FHBA 1ZHAA 3PWAA 3U6WA 4A3UA 2WKGA 4M19A 2V81A 2FFCA 3DKLA 1QPOA 1KW1A 4ATWA 3PBYA 1TTIA 3NPUA 1UCWA 5DBTA 4Z1CA 4HPXA 3UQNA 1E43A 2EAWA 3WJXA 4K36A 1J0HA 3G18A 4DBDA 1UD6A 1BAGA 6TIMA 1HXKA 1G4TA 3VNYA 2V5BA 4UC5A 3LHYA 2P0OA 3BV4A 2Q3OA 3KFTA 3M44A 1W5OA 1AMKA 3GXNA 1MWOA 3GDKA 3VNDA 3UG4A 3UXAA 3P61A 2V2HA 2VELA 1P5BA 3PY2A 1I2PA 4IPIA 3II1A 1TRDA 4MUZA 2ZXAA 2EQDA 3NQEA 2ZRVA 4RV8A 1WBJA 4N4PA 4UMCA 4XB3A 4XBKA 1G69A 4ZVJA 1UD8A 3A5FA 2QF7A 2DIJA 4X3ZA 1Q6OA 2FJKA 1FWTA 4TU1A 1L6SA 1UUMA 2Y63A 3ZWTA 2FPYA 4OKDA 5BOOA 4PEKA 4UQ9A 3LTYA 3IVUA 3T40A 5DY2A 2ZZ6A 3C2RA 1MEWA 4PC8A 2DJXA 2OW6A 4GUIA 2F18A 4UOQA 1VCFA 3NAVA 3W1AA 1XUUA 5KZEA 4HNUA 3GLCA 1CXLA 3P5ZA 2ZICA 3LRLA 1FX6A 1B2YA 4BA0A 4UTTC 4J27A 3VM7A 2Q3RA 4TIMA 1KM0A 1LRTA 3TDFA 3ZO9A 2ZIDA 5CLTA 1CX9A 3D52A 1H61A 1DHPA 3CHVA 1Q6LA 2WKJA 2WOQA 3LDVA 4HN4A 5U7SA 3NQ8A 2ZX8A 2R8WA 1AK5A 5DXYA 3TQ0A 2DZSA 3GIYA 1SW3A 2WVVA 3A4AA 3E12A 4K8HA 4J3VA 2ZA1A 1KGUA 4XZ9A 5GVJA 3UD6A 3MYOA 2VEIA 2YA1A 3P8IA 3M0ZA 3A5VA 3C2OA 2JBMA 5F2LA 2Q8LA 3EJPA 4E38A 4N6EA 6CGTA 1QI5A 5C2XA 3NQAA 3FJ6A 1NF0A 3M1ZA 5A8GA 3D4ZA 4AWTA 2QPUA 2QCLA 3LBMA 4NJHA 5A2CA 4M8UA 1YTEA 3LCFA 4LUJA 5TBOA 4JTUA 5F4SA 4JTHA 1HVXA 2Y2WA 1G6CA 5L6UA 4DEFA 3BUQA 1GZGA 4JTTA 4JY8A 1H63A 4GXMA 4AHQA 2ISVA 1G5AA 3L65A 2TYSA 3KE0A 3NDOA 3O16A 2DP3A 1ODUA 1GVOA 3MP3A 1SZGA 1QPQA 1OFEA 4Y96A 1EPXA 3DH7A 3L21A 3PAJA 4MJZA 2NV1A 1Y7VA 4AIEA 4ZQMA 2NV2A 3RMJA 3CZNA 1ZS2A 1DJNA 2ATMA 3NVTA 2ISSA 1B0IA 3O6CA 3LHUA 1NEYA 2FQIA 1IZJA 3WDIA 1BEUA 2CLMA 1JCNA 1QI3A 3DX3A 4WZHA 3DFSA 4ZQPA 4HKPA 1H7OA 1WO2A 2E8ZA 2B7QA 5I3FA 1IZKA 3M9YA 2GJRA 4JCMA 1IIHA 5CGQA 5BRPA 1SSDA 5F4WA 1LORA 3AXHA 4LUIA 3DHFA 3CT7A 2C7FA 3VMPA 1FXPA 2YJQA 2ZX6A 3WNMA 2ZRUA 1TQUA 3WNKA 1EUAA 1O95A 4M7SA 1NOFA 2V8ZA 4FLRA 1VJIA 4Y8FA 1X1OA 4GE8A 1UUOA 3ABOA 1JCJA 2EEXA 3B05A 1MFUA 2Y62A 3ATYA 1XCWA 3R8RA 2ZUTA 1AW1A 3H54A 2X2IA 3W85A 4LS0A 4CCDA 2E5BA 1VFOA 2ZTJA 5CSSA 4TR9A 3DX4A 5DELA 1U83A 3P82A 5HDRA 2G96A 5I3KA 4JD4A 2ZWYA 4FX7A 1XXXA 3TROA 1OK4A 4D2JA 4FIRA 4BI5A 1I2NA 4XBSA 3BK0A 1F6PA 3K1DA 4LXFA 3UCQA 2YSWA 1BSIA 4PTNA 3TJXA 5E0FA 3WK0A 3M5XA 3W1NA 2BZNA 1M6JA 3BLIA 3KAOA 4XUGA 1QHOA 3LRMA 5I23A 1PHQA 4IMEA 3W76A 4YCOA 4A29A 2VEPA 5F7UA 1KTNA 5E0KA 3UZ5A 1T8XA 2OW7A 1ONRA 5HQEA 5CLWA 1D3HA 4FO4A 1R30A 2ISWA 2RHGA 3GB6A 3MO7A 4AWUA 2BHZA 3M07A 3M16A 1JCLA 3W1XA 3W7EA 4MLJA 3RIKA 4JFVA 3G24A 1WP6A 1G4SA 3LPOA 3RILA 2NSXA 2A21A 1P4CA 4O12A 4RLIA 1QAPA 1TPC1 1I75A 3DFQA 4NNAA 4NZFA 2OSXA 1O60A 2EF9A 2QCMA 2V3EA 5BMXA 3TJLA 3O1NA 3B0UX 3EJSA 1WA3A 1T0OA 4BK9A 5AB3A 3WJZA 1OG0A 1GTHA 4IXHA 2H8XA 3W70A 1J5TA 1C8VA 1OX5A 1KM6A 1TCDA 1YYAA 3NQDA 1TQXA 2FDSA 1AQMA 4U31A 3ZFHA 3VMNA 1A5CA 1K7FA 3M5VA 4H6KA 3EXRA 3BAWA 1VAHA 2BSLA 3EDEA 4AEOA 3W3OA 2Y70A 2WC7A 3VGGA 1J2WA 4DF2A 1UKQA 3AMKA 4C1LA 2W79A 2Z6IA 1P1XA 1SO3A 1WDWA 5T26A 3RLVA 5LKYA 2F61A 3CWNA 2BY1A 1H7RA 4O15A 4UZUA 2YXGA 1O5KA 1OFQA 3GX9A 2F7RA 1TRIA 4GINA 3K8KA 3ATZA 1E51A 3SI9A 1N55A 3S2CA 1TPFA 1PS9A 3KOFA 5BRBA 2QDHA 2ALWA 3QW3A 2YIHA 2PWEA 4FX6M 1DHKA 1G7VA 1KLZA 1I2OA 5DXXA 2FPTA 3GKAA 2B7NA 1L0PA 1LBMA 3GXMA 1JQVA 1W31A 3P81A 1D3CA 4OIFA 2F7FA 3PUDA 3LCIA 3YPIA 4O18A 4OJYA 3CTTA 1LWHA 1S46A 2WVSA 1VR6A 5HNRA 3PC0A 1N7KA 1VH7A 1KTBA 1LOSA 3HB9A 3DKJA 1JGIA 3W7CA 3G0UA 2V9DA 4FMVA 3PG8A 4XWUA 4MZYA 1MVYA 4MYXA 3N9SA 4RKAA 4S1FA 3W1LA 3CB8A 3EX1A 1JF5A 1EWDA 1GJPA 3HG5A 5K4XA 3EJRA 2Z6JA 4PA8A 1O4UA 3L68A 2TPSA 2CLKA 1TIMA 2OCZA 1KXVA 5DCBA 1G4PA 3EWBX 1LM1A 2OZ0A 4JTLA 3PB0A 3VKJA 2VEKA 1ICPA 1RPKA 5A6MA 4NU7A 4UFHA 2WANA 2A6LA 1UKTA 4PEEA 2R91A 2XVGA 1KA9F 1W37A 3G1HA 2O7SA 5FESA 1XKYA 1VC4A 1LWJA 3C6CA 3MBFA 1GCYA 2JGYA 4N9CA 4UQEA 1Q6QA 4B9YA 4M6VA 3SECA 2C18A 4MPQA 2J24A 5G4WA 1DL3A 4RXFA 1K03A 2E6AA 4DO5A 4GO8A 1H62A 3EX6A 2HMCA 4ORMA 2VUYA 3SZ8A 4M5PA 1CXEA 4IXXA 1K8XA 2YKKA 2C1HA 2NXGA 4O10A 1OFPA 4HPHA 3SY5A 1KFBA 3LV6A 4ZZ9A 1OT1A 3PUEA 4UFKA 2BHYA 2WSQA 3S5OA 3M43A 1UD3A 2I9EA 1KBBA 1I4NA 3C4UA 3BLPX 1GYLA 1H51A 3PM6A 5EKYA 2DH3A 3HZ3A 2QCGA 3PB2A 4MZ8A 4GUHA 5CZJA 5G1YA 1KV5A 2FH6A 3KL5A 3LERA 5A2BA 4GKLA 4J3WA 3W7MA 4AAJA 1LDCA 2FH8A 3EJTA 2ZRWA 4HOWA 2WCGA 3OHIA 3A23A 1IF2A 5AHNA 5D30A 5DN1A 1X1ZA 3W7NA 1L2UA 2JKEA 1KXQA 5DY3A 3CIXA 5CG7A 4BF9A 4CNOA 3I6RA 4NQ1A 4M6QA 3W6YA 5FF2A 1U30A 1NF7A 3LCLA 4Y6GA 1ZAHA 3EB2A 3W71A 2JGQA 3W9ZA 1YXYA 4UNLA 2R94A 3P7YA 1VLIA 3ABRA 1H7WA 1BVNP 1TPUA 4WD0A 3GXPA 4O17A 3N2MA 1GPWA 3VI2A 3TA6A 4UTTA 2A2IA 4E2OA 3DI1A 1W3TA 3IRDA 4U28A 3ABSA 1TTPA 1QFEA 3KVKA 4EOUA 2QLYA 2QCCA 3AMLA 1QW8A 1PZ3A 3IJ9A 4U3CA 2ZUSA 4UXDA 2BY0A 4JCLA 3HIJA 5G2HA 2E5CA 1DJQA 2BY3A 2BXVA 1CGYA 1CLVA 4QAIA 3CC1A 4K8EA 1MZHA 3CEPA 3VFLA 5BRQA 3O06A 1SO6A 3K8MA 5AHIA 4WSKA 3P60A 4OE7A 4JIQA 5KZMA 5D02A 4N6FA 3CZSA 2VC6A 5EA9A 4FNQA 4QISA 3WELA 2JK2A 3DFOA 4UNIA 5D05A 2DIEA 1B3OA 1B4EA 4UR7A 3BH4A 1CI1A 4MLRA 4JTKA 1ZJBA 1MSSA 4IJBA 1H7NA 4WSJA 2RKXA 3IJ8A 1DVJA 3RNDA 1OFOA 3THAA 4WOZA 1ADOA 1CPUA 3VGDA 1FUYA 1VHCA 4AMXA 1X6UA 1LP6A 2Y24A 3EXTA 3V1PA 4JXCA 4LVFA 5F4XA 4GI9A 3BCDA 3HPSA 4OV9A 1HX0A 1W5MA 2ZYFA 1KFLA 4KKXA 1CIUA 1OT2A 5I24A 5EYWA 1GVQA 5F2GA 1PIIA 4NJKA 5H2ZA 1TPH1 4LY8A 5CSRA 3HBLA 5LHFA 1DORA 3QMRA 2C0AA 1EUNA 4WUIA 2EADA 1YXDA 5BMWA 4JICA 3BAXA 1WOAA 2ZZ7A 1EO5A 4HPJA 3BC9A 3DXIA 1GJUA 1VHNA 2A1YA 5U4NA 1QMLA 4LNYA 2ABBA 4O0KA 3UY8A 3D0CA 3QW4B 5KINA 5E9AA 1YPIA 4H4IA 3ECQA 2JKPA 3G1SA 1AQHA 1G9HA 2E4TA 5A6LA 4OHQA 3EDJA 4UTIA 4B5NA 5KSWA 1W0MA 3WY2A 2X1TA 3O6YX 4GUJA 5L9FA 4UMAA 1J0IA 2YW3A 2O7QA 2E09A 2FTPA 2QDGA 2PCQA 1GWJA 1DQWA 1PJ9A 1XH2A 2ZX5A 4LS2A 4O16A 2G95A 2VEMA 3A24A 3B4UA 5D04C 2QMJA 3WK1A 4EVZA 3W87A 5IBXC 4JY9A 5FEZA 2CZDA 4WX2A 4IPJA 5FEPA 3W73A 3UG3A 1CDGA 3BVUA 3W37A 4U33A 3R12A 1EWEA 3Q2DA 1PHWA 2V2DA 2WVUA 3DHUA 3FYOA 1MW2A 2WNWA 1T96A 1PVNA 1A5AA 1V5XA 4P2VA 5D2YA 3I7RA 2A7RA 1UASA 3AO0A 1OK6A 1SO4A 1MXGA 4CN1A 1LOLA 2B4GA 1G67A 3M47A 4ADTA 2VR5A 1XI3A 4M6PA 3L66A 3QSRA 2D3LA 2ZUUA 3FAXA 1H1ZA 4MVAA 4BR1A 1XFBA 5G5IA 1BG9A 4RCXA 1QDSA 1XBXA 1M5WA 2GVYA 4JS3A 3DC0A 5CGMA 4CLMA 3WJWA 2WVVB 5SWUA 1W5NA 3C2FA 1JR1A 3BPWA 1OABA 4GFSA 2C13A 3M5YA 5HMSA 2ZQ0A 4J3TA 4JFTA 1OFAA 3ZT7A 1OF6A 4QAWA 1BWLA 4N4QA 1G1YA 1KWGA 3GKFA 2QKFA 3I7QA 1VFMA 2YYTA 3HG2A 3NQCA 5TIMA 5LHEA 3TUUA 2VRQA 2XN2A 4J3UA 3TONA 3QYQA 1K02A 1UOKA 2VFFA 2GQ9A 3ZWSA 1MFVA 3KVJA 2P1FA 4RXGA 1ME9A 4NJIA 1TQJA 4UTJA 4NT0A 1Z48A 2V3DA 3L2LA 2Y7GA 3F4NA 1OYBA 3BUPA 5C55A 4DPPA 4J3SA 1KLYA 1JFHA 2FLIA 2GQ8A 2NX9A 4RJEA 1K3UA 1TPDA 1KXTA 4I7WA 1A5BA 2E8YA 2ZRZA 3BAYA 1X7FA 3G3DA 3DHDA 3W2UA 4UFLA 3KX6A 4TMBA 3W7JA 1PE1A 1RQHA 5I3JA 2XIIA 1XD1A 4ZL1A 3LCHA 2QCNA 3KXQA 2C19A 3S1WA 1EO7A 3W74A 3NO5A 3Q94A 5LNWA 7TIMA 3NPVA 1BVZA 4X2RA 3W7PA 3FJLA 2OX1A 1N8FA 3TE9A 3TFCA 3EDKA 1XM3A 4YWIA 5A5WA 1SQ7A 1OYCA 8CGTA 2WQPA 1OVDA 4DXVA 3WNNA 1DBTA 5LNVA 4TMCA 1WBHA 2F1AA 2WSRA 2NX3A 1W54A 2XN1A 4FLSA 4UCFA 2EAEA 4MOZA 4AVFA 3WEOA 1D7FA 1WAUA 2F1BA 3GXIA 1KGWA 1WX0A 5K9XA 5DBUA 2PE4A 4O57A 1R34A 2BWGA 4JYDA 3C8FA 3A9IA 3IGXA 3PVFA 1G4EA 3PS7A 4TO8A 2J25A 3A47A 4JGDA 3LGEA 4ZMGA 4EF8A 1UA3A 2VRKA 4KFPA 2QUUA 3LPPA 1ML1A 1GEQA 3OLDA 3NQ2A 4L4LA 1JG9A 1VYPX 1TPB1 3TC6A 3N19B 2QMKA 4YLWA 1JAEA 4LQ1A 4O8RA 3NXFA 1PS3A 1W1ZA 2Y7FA 4RK8A 1TREA 1W8SA 4XKYA 2A85A 2W0UA 2ALDA 1M53A 1VYRA 3NQGA 4GWEA 2H90A 3QJAA 3LB0A 1XSKA 5D09A 2TAAA 1Z44A 1CYGA 1W9XA 1UKSA 3R13A 3TMLA 5DO8A 2VFDA 5LGZA 1IXPA 1FCBA 3L4UA 2Y88A 5D03A 5DCDA 2V3FA 2ZXQA 3L4ZA 5KEZA 3TAKA 1XBVA 2Z1KA 4B9ZA 4AEFA 5G2WA 3F1QA 3BUBA 2QCEA 4GUFA 1GYNA 5EMUA 4K39A 4UFJA 2GOUA 3GBDA 1ALDA 3BO9A 4GO9A 1B4KA 5DFAA 1IV8A 1ZNNA 5D32A 3VE9A 3GAYA 1AMYA 3BMWA 4H3DA 4YL2A 3O15A 3FA5A 3L2IA 1JUBA 3JRKA 2NXHA 8TIMA 1FWSA 4U2YA 1DTUA 1JCYA 1Z42A 3O07A 5C54A 5CPOA 3L4WA 2VFGA 1XH0A 3W7GA 1ZFJA 2ZA2A 4JX6A 2DZPA 5C6MA 3HG3A 3KL3A 3WDJA 1A50A 5HUOA 1VFUA 4IX0A 4ONVA 3M5ZA 3HMJG 5E6YA 4FXRA 3EKLA 3R89A 2DORA 1QPNA 4GNJA 4RZ6A 1QWGA 3I65A 4DQWA 4PCSA 5HUPA 1VRDA 3TNOA 2XIBA 4W93A 5EPDA 4PFMA 3BW2A 3UWUA 3Q37A 1HL2A 4LOCA 4K38A 3E96A 3W2LA 1JI2A 3M7WA 5KZDA 3WN6A 3BGGA 3KRZA 4JNMA 2BLEA 5AHFA 1O94A 2F7OA 1JDCA 3EWZA 4OV4A 3W84A 3NR0A 3BVTA 2OYMA 1MW3A 1K7XA 1F2JA 2YX0A 1XUZA 4HNNA 2PRLA 1MW1A 2VKZG 2XVKA 2ZBTA 1V3JA 1JXKA 3OLEA 3CZGA 1R46A 1JD9A 3B8DA 2QJIA 3CPRA 4LT9A 4A21A 3NYZA 5AYZA 3TQKA 2FB2A 2EACA 3D51A 1X8FA 3LCWA 3NNTA 3UY7A 5D2WA 2DZXA 1ZALA 4K7VA 3B0VC 3L4YA 3TSBA 1QI4A 3UWZA 3W1MA 4HIBA 3AJXA 2Y7DA 3NPWA 1FCUA 4Q4KA 3USBA 1YDOA 4H8VA 4ZQCA 2D73A 1FWWA 4UMBA 1E40A 5CPNA 3G1AA 1MXSA 5I3GA 4DBEA 1GVRA 1B57A 4X22A 3SR7A 3H55A 1JDDA 1JULA 4JTJA 5CGTA 4O1BA 3L67A 3G8RA 4NJJA 2XVLA 4J3XA 3HOJA 1KCKA 4MZ1A 4DO6A 2FB3A 1VLWA 4LS1A 1OSEA 4Z0JA 3AXIA 1ZENA 1CGWA 1JL8A 1LYXA 5AYXA 3OA3A 1KM4A 5DLCA 4QQ3A 3DI0A 3BG3A 1BWKA 4X0NA 3LV5A 3MBDA 3W7RA 1JUKA 4FNSA 1K8ZA 3LRKA 1MW0A 3STGA 2OMAA 4JTFA 3UYCA 2X2HA 3BAIA 3S0CA 1P0KA 2X1SA 4UQBA 1XDLA 4OQVA 3FFSA 2J9XA 3DGRA 3EX3A 4O4WA 1PZ2A 4WJEA 4JTGA 4AH7A 1ICSA 3IGSA 3W7QA 5HWMA 1VIWA 2ZZ5A 5FF3A 3DHPA 1KM2A 1YTKA 2J6XA 4GQRA 3IIVA 4JYEA 1H3GA 3GYEA 5IBXA 1MXDA 2F7PA 4FIQA 2D0HA 4HOZA 4U4MA 4NI3A 1DQXA 3TAOA 2DZUA 2CXGA 2VFEA 1J0KA 3N34A 3WK2A 3VE7A 1UA7A 3S1XA 4O53A 3NQMA 2CZEA 2QAFA 3GR7A 1THFD 1J0JA 1DKWA 5TD4A 1U2YA 2CPUA 3WFZA 3UEQA 1XC4A 4UTMA 2WJZA 1K8YA 4YCPA 1R47A 3CV5A 3BW4A 5CPLA 3WNPA 2G97A 2E6YA 2DH2A 3F4WA 4RX0A 3TSDA 1LRNA 3EJUA 3LHZA 3PG9A 3TKFA 1TYGA 3ZR6A 3W72A 1PIFA 3KWXA 3HG4A 4GI8A 2A5HA 3OLGA 3G0XA 2OSWA 3W22A 5K4ZA 3HPZA 4DF0A 1QR7A 3S5YA 2WPBA 4NUWA 3E02A 2D0GA 2FHFA 3HGSA 1GTEA 4O4VA 4NJGA 1GVFA 2EO7A 2X2GA 3VU2A 5HWNA 2RDWA 5CPMA 5KTLA 1L6WA 3O6DA 5CZTA 5AN7A 3VSVA 5HPOA 1TO3A 2NZLA 3BLKA 2TRSA 3QQ0A 1GJWA 3QH2A 2Z0IA 1WE5A 5HXMA 2A7PA 3LLDA 3LX9A 3RU6A 1H7PA 1RR2A 4GUGA 4PCFA 2LLEA 3STCA 5I0DA 3G1FA 1TPEA 3TFXA 3BMVA 5LNRA 3LCGA 4UQCA 1PAMA 1RQEA 1ZCOA 2ATSA 3DX1A 3TIMA 4I7VA 5BNKA 4WOQA 2CFFA 5FEWA 1XV8A 2Y4SA 3G3MA 3FIGA 2QPSA 1XCXA 1FWNA 3MHGA 3IIZA 3TK7A 2E5DA 4N9DA 3CLWA 3TC7A 5E93A 1JJKA 3BUIA 3LI1A 5FF0A 4KMQA 1EIXA 1KM3A 3OLIA 4HNVA 5D2XA 1YTDA 1CXFA 3ZSSA 5K9CA 5HR7A 2G3MA 3C61A 2WSKA 5F2IA 2D2OA 1Y0EA 4JDYA 4WXYA 2TSYA 4BI6A 1S5WA 3LHVA 3IIPA 4JIPA 1C9DA 4JX5A 1EA9C 1SMDA 1B9BA 4AXKA 3GDMA 4O0ZA 5LNSA 3IIOA 1TTJA 1EP3A 3DFTA 1PPIA 3L0GA 3RF9A 5E1QA 3LXCA 3WY3A 3B06A 3L4VA 2C3ZA 1SO5A 1RP9A 4JYFA 4Y90A 1AW5A 3M6YA 1OYAA 1SMAA 3S5ZA 1S5VA 4UTKA 3QQ1A 5CZ0A 4FNTA 3HPXA 3N3MA 1R2TA 1SZNA 4QJ1A 4S2BA 5CXPA 2CW6A 1CGVA 1CGTA 4ML9A 4O11A 1QWNA 3MUXA 3W75A 4AHPA 1RD5A 5K9DA 2OYKA 3E49A 1UJPA 1JF6A 1QPKA 2OT1A 3N73A 1JUEA 5AFDA 4WY0A 3PBWA 3TCEA 3W2JA 5TQLA 2Y85A 4LPCA 4UFMA 4YMZA 3ZOAA 2RH9A 1OF8A 3LCXA 3BGJA 1SZEA 3EWUA 3NQFA 4KWVA 1KB3A 2C6QA 4O52A 3INPA 3CZEA 1C29A 2ZZ3A 3AJ7A 3FYPA 3ZS4A 1NSJA 3DU0A 4LW7A 3QGVA 1WOBA 1SU5A 1XSJA 1PCKA 3SJ3A 3S1VA 5AHMA 3N2XA 3KLKA 3CPUA 4C1KA 1V3LA 3FLUA 2FPVA 1XD0A 1LCOA 1EH9A 1BLIA 4GRSA 4MB1A 2B7PA 2H6RA 3TQVA 3CTLA 1D3GA 4KWWA 2RFGA 1SW7A 2CLEA 3FKKA 1JXJA 1Q3NA 5K2ZA 4AF0A 1FDJA 3CZLA 4MFEA 2FGZA 1XGZA 4FF7A 2QUTA 2YW4A 1OB0A 3LXBA 1LRQA 3ZSTA 4RZ4A 4HSOA 2W6RA 2X16A 3DZ1A 4AYGA 3CGTA 1EEPA 3LOTA 4OGZA 1FWRA 3WMSA 1T99A 3S6DA 3HJZA 1FCQA 2ZXDA 5F1VA 3NL6A 4LRTA 3UZJA 2WVTA 1V3MA 2E6DA 4P61A 3IVTA 1H60A 4Z1DA 3GNNA 2BTMA 2CZFA 3G1DA 4PCTA 4AMWA 1JD7A 2ZA3A 1HTYA 5K7JA 4Z0SA 1M7XA 5D2TA 4H2CA 1AW2A 4ZQNA 1BTMA 3MJYA 3VMOA 4CN4A 3A6OA 3W7HA 2YDAA 2NWRA 3U2OA 3W7OA 4R34A 3GK0A 3WDHA 3P5YA 2YFNA 1UD4A 4UCGA 4JR5A 1RP8A 2YA2A 3W38A 3IGUA 2NXIA 2C8NA 3FOKA 2OYLA 1KBIA 3OVQA 2ZZ1A 3TTSA 1OFBA 4J7RA 2P10A 4OU1A 1MO0A 1JIBA 3KRSA 4G1KA 1OJXA 3W7KA 3VSUA 4WF7A 1RV8A 2NX1A 1XH1A 3NZRA 2DZVA 4Q32A 1Q45A 4R7JA 1F73A 1P0NA 4UUIA 1E3XA 4WQ6A 2G3NA 4EWND 4AWSA 4O1CA 1FY6A 1V7YA 3UPBA 1K7EA 1NM9A 1TPWA 3K8LA 3MP4A 4XTIA 2AGKA 1O5XA 4UTUA 2ZRYA 2UV8G 4PL1A 1WYIA 4FX8A 3F03K 1EA0A 2EJ1A 2DZTA 3T44A 1G7UA 4JEQA 3ZQ9A 4CCCA 1AL8A 1RQBA 3E0IA 4JTSA 3EDFA 1TV8A 5CKSA 2C15A 2YZRA 2VENA 4ICNA 2EKCA 3W2KA 3TU9A 2C14A 1SSGA 3RK8A 3NPXA 3EDDA 3FEMA 3NEVA 4IMCA 2QAPA 3BLEA 4QSHA 1HG3A 3CIWA 3IEBA 4CVWA 4UQDA 1PIGA 1TJRA 1YADA 3VGHA 5KITA 3DBPA 1C8QA 4LRSA 3THQA 2AMGA 1H5YA 1VCVA 3DFNA 3G22A 2XFWA 4JL1A 3I7SA 2QR6A 4CGTA 3CM4A 2Y5EA 2PWFA 3ABQA 3GNDA 3TH6A 3MP5A 1W56A 3MHUA 3W7IA 2WNQA 1LLZA 4HSNA 4XKYB 1HO1A 1ZJAA 5AHEA 5MHBA 3QF0A 1H50A 3DFPA 1UB3A 4HT3A 1I2QA 3FS2A 2FIQA 1GOXA 5FF7A 3SFKA 4TVUA 1GQNA 3GBEA 4AYSA 3S1UA 3N9RA 1TPVA 4XQ6A 2GVJA 3G8EA 2F2HA 1U33A 3VNZA 2BX7A 1EP2A 3L5MA 4Z08A 2ZCGA 4H8UA 3MWAA 4ADUA 3VSTA 3W7DA 4EIVA 1F76A 2WNZA 3NM3A 3GXDA 2GJNA 1CGXA 4UR8A 1A47A 4GI6A 1Z32X 1TQSA 3WENA 3L0KA 1AVAA 1L6YA 4IGHA 3HGOA 1A5SA 1FDYA 2J9ZA 4MY1A 1ZY9A 4GBUA 3W1RA 1RPXA 2A4AA 3G1XA 1QWUA 3HF3A 4IX2A 4O13A 2QCHA 9CGTA 1LLWA 2PURA 4O19A 4AMAA 3L4TA 3FAWA 4JFWA 4I7UA 4H7VA 2NUWA 2JKAA 4QITA 4FLQA 3A21A 2F7QA 1VZWA 4BWLC 1HT6A 1IXQA 2D0FA 3SSJA 3PULA 3LI0A 4N2YA 4BZYA 5D33A 2V82A 4R53A 3M41A 1QX1A 3W1TA 1PEZA 1TQWA 3W23A 1UD2A 4LVGA 4LTSA 5FF4A 4UTWC 4FNRA 2NT1A 3MI2A 4POCA 1QHPA 1UH3A 1TTQA 5DCEA 4ZQOA 2EPHA 3HGJA 2NWSA 4QIUA 1YDVA 1SPQA 3WFAA 4GC4A 1ZAJA 4O50A 2VOMA 3QM3A 5LNUA 6ALDA 3UWYA 4Z1AA 1OX4B 2RDUA 4GIAA 1GG0A 3G1YA 3SW6A 5F2MA 5EL1A 3NA8A 3R2GA 1Z41A 1WZKA 1R2RA 1R75A 3LLFA 4FHAA 3UG5A 4IUOA 4QNWA 1CXHA 3KLLA 4N9EA 4IMFA 3T7VA 1F6KA 2VFIA 2DU2A 1TV5A 4AEEA 1HUVA 1VJSA 2Q8ZA 4J9JA 1IIGA 4LVAA 4J28A 1LBLA 2E68A 1FXQA 3C2VA 3LM7A 2I1OA 1KV8A 4O1AA 2AAMA 1EHAA 2FYVA 4Z1BA 1LOQA 5EMYA 2CHNA 4AIOA 4MJMA 4W9TA 3P80A 2CZ5A 3OG3A 5F1UA 1HL8A 4ORIA 1SW0A 3PBUA 3O05A 3BG5A 3LBCA 1PL9A 3EXSA 2WKLA 3GXFA 3CZKA 3QFEA 3L0NA 3SGUA 1DV7A 3NGJA 4MY9A 2CLHA 2J27A 3KVLA 3B0PA 3GXTA 1QOQA 3MMTA 2BY2A 2TMDA 3R5EA 3BAJA 4JFUA 4PSPA 1WXJA 1VB9A 7TAAA 4RR4A 2X1UA 3VGFA 3WEMA 1Q6RA 5EY5A 1WZAA 4R33A 1QW9A 1OX6A 5HULA 4MKNA 3UERA 4AHOA 2Z1BA 1XCFA 3Q58A 5C5YA 3E9AA 1F7BA 3UPWA 5A2AA 1W5QA 5E6ZA 1VPXA 4WY0F 4Y9AA 3DX0A 3FW6A 1IXOA 1EP1A 1I2RA 3IVSA 1D9EA 4KFNA 5J5DA 1RVGA 4IWWA 3TX9A 4KWUA 1OX4A 3NL5A 2E6FA 3L5AA 3OIXA 2WV8A 1VGAA 2H3BA 3PF3A 1UH2A 2BHUA 3W1PA 1CW2A 2YFOA 1ME7A 2QEZA 3TW6A 4MIMA 3UWWA 2HTMA 1YPFA 4E2DA 3NQVA 3HJEA 1UD5A 1LROA 4JTIA 4FEZA 4UFIA 3MHFA 5G2IA 1SFJA 2FE0A 2CLLA 3L2MA 3DDGA 4GQQA 5IM51 4O1DA 2J88A 3T55A 1G94A 5H91A 5HWJA 4HHPA 4LWWA 1QO2A 2YPIA 2QCDB 2KZHA 2YCEA 3O63A 1UBSA 7CGTA 4X9SA 3T78A 3U8GA 4JFSA 1VQTA 1FCVA 1EX5A 1HNYA 3EKZA 4N02A 1TV7A 1WQ5A 5HR6A 3TTYA 1YDNA 3LTPA 2XWEA 3GZ3A 1OHLA 2ZDRA 3B03A 3WJYA 2PRHA 4EF9A 3MI6A 2NLIA 2RDTA 2QJHA 5ABTA 3P8JA 3BLBA 2GQAA 4CNNA 2ZUWA 4LU0A 3GAKA 3EWWA 1CXKA 4DELA 3NM1A 2Y89A 1J4EA 2GJLA 4CQ9A 1FDZA 1OFDA 6TAAA 2QCFA 4O14A 1JRBA 4O28A 2ZE0A 4MYAA 1U5JA 2PC4A 3WY4A 2V5LA 3QMTA 3W86A 4TX9A 2VFHA 4CQ8A 1HFBA 1KTCA 1LTDA 2A7NA 4KFOA 3BSGA 4HOXA 3BVVA 2WCSA 4NNCA 4XTDA 3KVMA 1FBAA 5AC6A 2CLFA 1TQVA 4ADSA 4CCEA 1HWWA 3UNDA 2QV4A 2YYUA 2CWNA 3W07A 3IJ7A 3B04A 3I68A 3S5NA 1PCWA 2WNNA 5HINA 5CZSA 3BLFA 4CKQA 4FNUA 3BSHA 1MEIA 2J9YA 2YOCA 1TB3A 3IV3A 1W3NA 3NL2A 1KWKA 3NZ1A 1F05A 4O54A 2E0PA 1SZFA 3C3NA 3TMQA 4HA1A 3C52A 3A22A 2H8ZA 1VCGA 3ZT6A 1VYSX 4ALDA 3ANYA 1R33A 3BARA 3W2MA 4UZSA 1BF2A 1JCXA 1WV2A 1TMHA 1RZMA 2QCDA 1ZAIA 3GTNA 2B0MA 5FEXA 3KEHA 1UH4A 2NUYA 2CU0A 3EWYA 5I3IA 2YGYA 1A53A 4LVDA 3C56A 3K30A 1R2SA 5BW6A 4BI7A 2Z2UA 1KFKA 3T4CA 4LV4A 4E0CA 2ZUVA 1F74A 2EHHA 1AG1O 5I3HA 2C16A 2ZX7A 4HP5A 3PSVA 2QJGA 1W5PA 4OBTA 3BCFA 3TOPA 2BXYA 2DJLA 4OWGA 3LTSA 5AC8A 3ZT5A 2QUVA 4K37A 2XN0A 3EJQA 1S3HA 4IMDA 3PR2A 4IMGA 3STEA 5D38A 5LZLA 2WO5A 2V0TA 3O8AA 2OJPA 3WY1A 3GDRA 4FB7A 1V3KA 1CXIA 1OGSA 1M7OA 3BVJA 4CQAA 1TSIA 4MY8A 4AB4A 2CLOA 2ZWZA 3DAQA 2WSYA 3BG9A 3BUDA 1SUXA 4GJ1A 4QM1A 3HQ1A 2PRMA 1SFLA 3QRHA 1SR9A 1I45A 2I14A 4PH6A 2WPGA 5E70A 3SIZA 1JDAA 3RLUA 4WY0B 3HGRA 1JVNA 2NUXA 4S2CA 2GVLA 2IGTA 1W3IA 1M7PA 1KBKA 1XDMA 5KMYA 1DOSA 3P74A 2ZZ4A 2ZZ2A 3BW3A 3DX2A 5G4EA 1FQ0A 4NX5A 3V75A 3BAKA 2PWDA 2E9BA 2X2JA 3LXAA 3NL3A 3WK3A 1WPCA 4MFDA 3D4YA 3DENA 3OVRA 1KXHA 3S9YA 2Y6ZA 4FLOA 2ZFAA 4JX4A 4LC8A 3FKRA 1BPLB 3CWOX 3PSWA 2B7OA 4WXZA 4DO4A 4LC6A 3ZR5A 4A2RA 2V30A 4WLCA 3JR2A 3TV8A 3HO8A 2VXNA 2EGZA 3S8HA 1F5ZA 3VM5A 4JN6A 3VO0A 4AF0B 3OEXA 1OFRA 5D2VA 3VX0A 2Y7EA 1KFEA 4M56A 3TW7A 2ZTKA 3CQ0A 2VNCA 3ZR4A 3SGZA 3H53A 2GUUA 1ZJIA 2ZRXA 3NQ6A 1GT8A 1YLVA 2YA0A 1TQTA 1XBYA 1HL9A 2BXZA 3WNOA 1JCMP 2VT0A 2YR1A 4UIOA 1GG1A 1TMQA 1IGSA 1QCWA 2GJPA 3QMSA 1YXCA 4NNBA 3WNLA 4N9BA 4BWLA 5I5RA 4CN6A 1NAL1 4NXSA 2G5WA 3VCRA 5AC7A 1LBFA 3VGEA 1EB3A 3QZEA 1JQXA 5G1TA 1H1YA 2X1RA 4ZQRA 2GPTA 1QPRA 3N14A 4UTWA 1XL9A 2GVGA 1TJPA 2CLIA 3UXDA 3UWQA 1WZLA 1WZMA 1E3ZA 1HTIA 4JL2A 2ZX9A 4LVBA 3TXVA 3EEGA 2PWHA 5LGXA 2A6NA 3EX2A 4AW7A 2FHCA 4U2ZA 1BKSA 3KL0A 4JTEA 3MYPA 4PODA 4K7YA 3QC3A 4IOTA 1ICQA 5FI8A 2Y61A 3RFAA 2HS8A 2GUYA 5J5RA 4I9AA 5AHLA 5K3VA 4UOZA 3NG3A 2D3NA 3S42A 4JDBA 4UTLA 3WJSA 1QO5A 2OT0A 1KBJA 3EX4A 3IIXA 3STFA 3UWVA 1I8JA 4PL2A 5AOUA 2DZWA 2ABAA 1GVSA 2WSPA 3JS3A 2PWGA 2V2CA 3G1VA 3NQ7A 2A0NA 4QNEA 4A22A 2NT0A 3L4XA 1KM1A 3QPYA 3GR8A 5EBUA 1AL7A 3CLMA 4RZ5A 1JRCA 3C0JA 3TXZA 1KGXA 1HO4A 3GDLA 4FXSA 4M7TA 1JI1A 3OBKA 1KM5A 4IQLA 1Q4NX 4UNKA 3PBVA 1XBZA 4L4MA 3KHJA 1VS1A 4CNPA 2AQWA 4DPQA 4BFAA 2E77A 2OSYA 4PSRA 4NXKA 4Q33A 4FNPA 3W88A 3EWXA 3W1QA 3L9CA 3PUOA 1PV8A 4YXGA 5LSMA 3GDTA 3ELFA 4LV9A 3P67A 3VX1A 1IXNA 2EABA 3MW7A 3W1UA 4UQAA 3NOEA 3GVGA 1KCLA 3G0SA 4UTHA 2HS6A 2F84A 5HJLA 3QPZA 1ME8A 3C2EA 2H3DA 3KRUA 3D50A 1QNVA 2ZXBA 3BVWA 3DDFA 3QSTA 1DEDA 3W83A 5D37A 3MI3A 1QOPA 2X30A 1XSIA 3CU2A 3TR2A 3LHTA 2AAAA 1KFJA
chains in the Genus database with same CATH superfamily
2GGHA 4PMDA 4QMEA 5BO1L 1SXNA 1S5TA 4J2MA 4YQXH 5L9DL 1TZIA 1L8PA 1USZA 3NFSL 3EYSL 5FKAB 5CPSA 2A1WL 4PJXE 4C5ZA 2E2TA 2J71A 1DSFL 3SYQA 1QK2A 2EDTA 1N7QA 2YAOA 1IFGA 3BT2L 6TIMA 5DJ8B 3H2PA 3CMOL 1J0MA 1CFTA 5IVXF 5B1KA 4HWBA 2LFEA 3VNDA 3UG4A 3P61A 2V2HA 1P5BA 2Y63A 1A7OL 3WQFA 5BOOA 4JO8A 1Z5LA 3T6XA 3LS4L 4JFDD 1PLBA 2CNCA 1SQ2N 3LEVH 1KEMH 5KZEA 1MFBL 3X41A 1FZJA 1G4RA 3IAQA 2A4EA 5DRXA 5L2KE 1UIPA 3TDFA 3O2WH 1TG8A 2ZIDA 1RJYB 2PF8A 3UAFA 2PW2A 4S23A 4AZ5A 3E12A 3JWOH 3IFLL 4NKMB 5DQJB 1FNLA 4XZ9A 2OMWA 5IROC 3A5VA 1UUQA 2R2BB 3FC8A 3M1ZA 3FTSA 3LBMA 3EXLA 1YPXA 4NJHA 2PO6C 4JTHA 5IR1A 1SJEA 1GZGA 4REQB 1G5AA 2HJLA 5H37H 4HC1L 3MP3A 5A8OA 2WD0A 3N1PC 1UEMA 4GRMB 5I9QC 2NV2A 1OGAE 3EJJX 5DD1L 2E7FA 2ATMA 1RK0B 1BZEA 2IBBA 1KTLA 4DGIH 1JZ5A 1U92A 4HPYL 1GPOL 5D70L 5EBMA 3WBXA 2EIMB 1G01A 3CT7A 1S9WB 1J1XL 3DKHA 1TQUA 3H7BA 3I02A 2ED6A 5FSEC 4FLRA 2ICEC 1MFUA 1TFVA 2Y62A 4TTUA 3H54A 1V7NH 1JUFA 2ADJA 4ELMA 1ISYA 2BOCB 4L1DA 2FGLA 4M1CC 1T0MA 3CHSA 3S36H 4GD0A 4WHCA 1I2NA 1F6PA 4UM8A 3LQMA 1PZSA 5I23A 5G4OA 5KYXA 5IJVA 4HMNA 1Z69A 2NTFB 4ODVH 4O9HH 4OM1H 2J2ZA 3CS2A 4M6MH 4OV5B 4WW2C 4WGWB 2OSXA 1DBKL 4BKNA 1N64L 3QG7H 4HEME 1T0OA 5AB3A 3K2IA 5BUGA 4KCVA 3FX4A 2HX9A 4PJXF 1O9VA 1TCDA 2DZAA 3NQDA 1K7FA 3M5VA 5EOTB 1VAHA 3LQGA 2Y0FA 3CVHA 4TL4A 1EGJA 4OZGF 3U9PH 1K8DB 1MHEA 2YXGA 3ATZA 5DD0L 1H9DA 1QMUA 3T3MB 3PGCA 2CBIA 4IIQA 3HPJA 1K1XA 2A9NL 5DXXA 2PDGA 1A7BA 3LQAL 3GSWB 3MNMA 4Y1AA 3SQSA 1XF4A 5J11B 3RL2A 1DXFA 3CTTA 3ESMA 1LWHA 4DAFA 4HT1H 1T41A 3UJJH 3W7CA 2E9IA 1MVYA 1KF9B 1KBGH 2OXGA 2CESA 2DBLH 4F2MA 5HI4C 3V0UA 4ODUA 3Q45A 4X99B 3TPUB 2IWGA 1TIMA 1KXVA 4TUOB 1ZPTA 4CUCA 3D5HA 3VFUA 3SPCA 1ICPA 1B0RA 2R91A 1NAML 4WU5B 1LWJA 5A6JA 1FYTA 3MUJA 1IHIA 4N9CA 1KC7A 1EEZA 2YD4A 5DVLA 1YJDC 3B7UX 1F8TL 3JZUA 3TNMA 2EINB 1U8NA 4ORMA 3HI5L 2QV5A 2J43A 3V6BR 1RUPL 2W9MA 3WSUA 1I4NA 1VFBA 5CSZB 1FNEA 1JRHH 1WQVT 4IIEA 1IVUA 1ES0B 4F2ME 1D5IH 3GH4A 5AHNA 3CN3A 2NY0D 5HHOD 2WWCA 4M6QA 1ZHKA 1U30A 4G7YL 1O5DT 4IFRA 5AB1A 2A0LC 1RVFH 3M0IA 1SQMA 1CLZL 1GPWA 4GQ9L 1U8MA 1V0KA 3D48R 2OCCB 3JSSA 4FFVD 3IRDA 4R4ND 4TTDD 1TTPA 2B1AH 2HXAA 5HHQA 3E0VA 4KOCA 3QHOA 2EDKA 1ONEA 2ITEA 2EKJA 4QAIA 3PZ9A 5BRQA 2CH8A 3GRWA 3HN5A 5ALBL 1MRFL 2LHAA 1ZIBA 2VYRE 4LFHD 4HNOA 1X5ZA 2AL2A 3L95B 4FNQA 2JK2A 1SLWA 1VBHA 4Y4HA 3ARFC 1OFOA 2JKRM 3B56A 2JKJA 2AQTA 4AMXA 3HPSA 3IFNL 4LCWD 1KACB 3TYFA 3DUUB 1MLBA 2CUAA 2HTBA 5AOKA 4J35A 4WFED 4ZMXA 1MFNA 1A0CA 2BT3A 3SCWA 2ZZ7A 4S3AA 4ELMF 2A83A 2ICSA 1A3RL 1J01A 2K3TA 1FV1B 1KCZA 4MNGB 3UY8A 2HT2D 2VE6A 5A6LA 3T4AC 5D55A 3T2LA 1W0MA 1JTPA 4UMAA 2ZOTA 1VACA 5BO1H 2EXYD 3ZY7A 4YLQT 2ZX5A 2A74A 1IT9L 3A24A 2CA3A 3O6ML 5DJAB 4XBJA 2W60B 2BGNE 5FEZA 4TV3A 5D7JB 3BQ6A 3WD4A 1LL7A 1Q9WA 5J1AB 3OKKB 3QISA 1BFOA 2I9LB 3CFDA 5DK2B 4BR1A 2ZUMA 2FTAA 3QZWB 2VR6A 1ZS8B 4Z95L 5D2LB 3T4YB 4I4WB 4QAWA 3Q06A 3V10A 3FJNA 1EAQA 4AUYA 3KM8A 4NASA 3MJGX 3WIFB 3WUWA 1O68A 1WNOA 1A7OH 3F64A 2PXYD 1F56A 2L8AA 1NC4D 1MFVA 3KVJA 5EEUA 5D96B 3LS4H 4KDTA 4P57B 4DTGL 1FIEA 3QEQB 1SPDA 3F4NA 3N04A 1G7LB 4X0KB 1NAKL 2RDYA 4PBFA 4HUUB 4TM9A 5DHVB 5I3JA 1TLMA 3PP4L 3UPAA 4YDLC 4WKHA 3FOMA 2OMUB 3TBYA 5GRYA 4K94L 4HJGB 4LLWA 3ML9A 3E7JA 2G8ZA 3FJLA 2G0WA 1K72A 1AHKA 2NYYC 1JFQL 2EVIA 1D6ZA 4UV7H 5LHDA 4DXVA 3QIUC 4UFCA 3QXDB 4TMCA 3NESA 3KOYA 2NQ3A 1P6AB 5JPMB 1HL5A 1D7FA 3O3BA 2PE4A 2BWGA 3JYCA 5DD1H 2R0WL 3N1MC 5CPQA 1K5WA 2IOMA 2AITA 1Q6EA 5AKSA 4NJ9L 4PJ5A 3GIVA 3U4FA 4C56A 1MMYA 4D6DA 1GPOH 3PWPB 2Q3ZA 1W8SA 1BA9A 1RJRA 4XBEL 4U6HB 2ALDA 1VYRA 3GHRA 1J1XH 1XLFA 3KW8A 3P1VA 4WV1C 1UKSA 3PZOA 3R13A 4AGLA 3BUYA 1A7QL 4PW9A 3RNKB 4OZFH 3HPFA 5HGDB 1S7SB 2VKWA 4OOUA 5A8QA 4X7TA 2Y5SA 3WZ0E 4XN9A 3SE9L 4GIEA 3H9SB 4F7PA 1N70A 3VGAC 2DZPA 4KROC 5FF6B 1P6BA 4PUBL 5T5NG 4JPGA 4FXRA 3H4GA 1PVHA 2Q6WB 2DLIA 3EJYD 4HBCL 4LSDA 5HUPA 5KAQF 1DBKH 1OK8A 2W07A 1N64H 3GSNL 2QR0B 5LXEA 2CJSA 4E8GA 3F4DA 5AHFA 2HX7A 2CALA 1F2JA 2X0HA 4UWQB 3MRFB 3K2UH 2DIBA 2QQLL 3BDYL 2VURA 4ZTPH 4OZIA 1S7UB 3B0VC 3TSBA 4PJFE 1TYRA 5DD0H 4ANUA 4ZQCA 3C2SA 1MXSA 3LMYA 4LLAA 1NOAA 5F1SA 1VF8A 4FOUA 4UTAL 4NJJA 4JANA 3RWEA 4Z0JA 4L1TA 4LARH 5H2BB 3S3SA 5ANMB 1CFMA 3TO4A 2O5NA 2AMUA 2QHAA 1Q7QA 2CLZB 3UYCA 2BCKB 1XDLA 4O4WA 3T6CA 1RH9A 4LASL 4Y19D 3IIVA 4PBEA 1NZRA 3GYEA 2ODHA 1ACYH 4PTDA 1JHTB 3TN0A 4BSVA 4A6YL 3WK2A 4RAUA 1T66D 5I0XA 1ICTA 1F8TH 3Q2WA 2P5EA 5EN2B 5HYSB 3S2LA 4PWIA 2DZEA 4XNAA 4I18C 3WNPA 1T2XA 2WGQA 2CBUA 4PR5B 3W72A 2BERA 2H2SC 2M2DA 1BZ7A 3GPEA 3SDCA 2CERA 2Q8BH 2PUQT 1PX4A 5SV3A 3ZZSA 5CP7A 3GMNB 4DKFL 1Q1JL 2PSNA 1R3IL 3Q13A 3LCYA 2FBJL 4G7YH 4F7TB 4A7UA 1N3NB 4V28A 1ML0A 3NGBB 3KZ8A 3G1FA 2X28A 3P2VA 4L4OA 4DPBX 4I9WE 4Y5XB 2EDBA 4XMLH 3P11L 1YNPA 3NZ8A 3D39A 1NQ6A 2IDTA 2K4AA 4N2BA 1OM9A 3C60D 2J75A 5ALBH 1MRFH 4ZE4A 1U8OB 4AZIA 1XLIA 3MNVB 4PRDA 4QHKI 5HYJB 1I8MB 1S4IA 1BFSA 2ZOKA 5D1QA 3MBEB 4Y90A 3UAJA 1M1XA 2HJFB 1I8AA 4N2OA 2XVNA 1X4YA 2OX5B 1LQBC 4XB7A 1M7JA 3W75A 4AHPA 2NSMA 1Z9NA 1EFXA 4DJMA 5DA4A 3AZTA 3S34L 5E5UB 1ILSA 3EWUA 3C09C 4JQXC 3FYPA 1SU5A 4PU2A 4W9CC 4RISL 5BUAA 3CAQA 1KPVA 1M7IA 4PJFF 4U3SB 1OP5K 5ITBL 2FRGP 1QLEL 4IFOA 4K4KA 2LW3A 4JO3L 2X3CA 4MFEA 1IT9H 3O6MH 2Q9OA 5EC1A 3D3VD 2NQZA 4LCQA 4RZ4A 1A64A 4XAPA 4DHLA 4N8PA 4ZGYA 4OGZA 4XPHL 1U3HB 4Q9RH 3DYPA 4MB5A 3CNKA 1M1SA 1LE5B 4K7PL 2R1KA 4LRIA 2CKNA 3IN0A 4FZEH 2ZA3A 1TEYA 3QJQB 4L8BB 3JZEA 4ZUVA 4P2QE 4YSRA 2YDAA 2NWRA 3U2OA 4R34A 1TTAA 1FA2A 4KRPD 1OHQA 2ZOWA 5ENWA 2B4CC 5AB9A 2NXIA 2K7PA 2IJ0C 3GSQB 4P4KB 4L4VE 4FFTA 5FSDC 4WGXA 1FLTX 1JV2B 2CD0A 3D33A 3AGVA 3DC8A 4HHAA 4CJ1A 1FY6A 3CUFA 1VCAA 2QZRA 4UTUA 2Z1WA 5DI8B 2IFGA 4QHLB 2DZTA 1XKJA 3GGWA 3PRZA 3VYPA 1WXYA 4J4PD 4HSAC 5DVPA 1NQKA 3EGXB 4RX4D 5DYFA 3R18A 3FQYA 4HYTB 1U1JA 3N0PB 1VP5A 4K94H 2PGRA 3PJUA 1UB3A 4L05A 2FIQA 3ZZQA 5LA1A 1U58A 1E1CA 3G8EA 2ESCA 5C08A 3GH7A 1GH7A 5KS9A 2OV0A 3L5MA 4P2RB 2EUVA 5ICYA 1IYXA 2XSXA 4UR8A 1GGCL 3WENA 1X7TA 2I60L 2WAHA 4O13A 1QWUA 2R0WH 2NQCA 4L37A 2PABA 2JKLA 5C7ZA 3F7YA 1UVQB 4ZK8A 2C3GA 3QZBA 4BWUA 4B5ZA 1KLUB 4ZYKA 2X1IA 2FO4A 1IXQA 4E2VA 7PCYA 5IB1B 4OVUA 1PEZA 3B9VA 1TQWA 2O93L 3O4OB 2PDHA 2VXSL 2EO9A 1YEJL 5GGQH 2OTUB 1E9ZB 4PJGE 3ZKMC 5ID1B 5C08E 1QZ1A 4PIBA 2X40A 3U30B 1JXFA 1Z41A 2MPAH 3LMZA 2AK4D 4HUXA 1YNQA 5LAPA 3OP2A 1LMIA 5T9BG 3FGCA 3RWJB 3LM7A 4O1AA 5HK4A 1QO3A 4YHYC 1E4IA 4ZW7A 3KPQA 4PN2A 3CHEA 3P80A 3MVSA 4XMKL 1BAFL 4HLZH 3PDOB 1KSIA 2DDQH 3UTPD 2MSPA 5I3DA 2VZVA 3E2VA 2O5ZL 3IMTA 4FQ1L 5KYUB 5FO7B 5AEAA 3ES7A 5MHSD 5F8RC 1L9RA 2O6PA 1VIZA 1VKFA 1WZAA 1QW9A 2AEQH 1T2JA 3EGDA 1CTMA 4P4RB 5FO8B 1W5ZA 1OAKL 1IBGL 3DX0A 1EP1A 2GCYA 2HFGL 1TA3A 3UBGA 3CIQA 3QHZL 2XU9A 2WV8A 3PV6A 3S9ZA 4WEEA 3B7SA 2L7UA 1LP9B 4FQHB 4Q7BA 5E5MB 3NQVA 2CO3A 1JK8B 3MHFA 2HX8A 1DQJB 1OL0A 2R29A 2WGNB 1OSZB 4X80L 3TCSA 4GQQA 5I6NA 3T55A 1G0DA 3N9GL 1E5BA 4NHUB 1QO2A 2JIEA 3LA4A 4UTAH 1D5ZA 1FZKA 5HR6A 5HQLA 2B15A 1BVKA 2DS4A 4G7EA 3UTSD 2PLKA 3BLBA 5C0RL 3EOBB 4CD6A 2VXQA 1RCXB 5C07B 3MLZL 3PXLA 4MYAA 4EN3A 3PWGA 2UUDK 2VFHA 4NNXB 3KHDA 3OMAB 2OPJA 3CXDL 2Q3AA 1T6WA 1HE8A 4Y2OB 4A6YH 4ZJ9A 1SYVA 3BZ5A 3QUHA 2XQBL 5T3XD 2OGJA 5L4FA 1BYBA 1VCGA 3ZT6A 2CRYA 1RIHL 4ODWA 4L3CB 3GTNA 4NQCA 4H13C 4YSAA 1Q65A 5B3SB 1A5KC 4XOEA 4GH1A 4OBTA 3LQLA 3OG2A 1BOGB 1Q1JH 3ZT5A 2QUVA 4OCSH 4R3SB 2HT3D 1H5VA 2AXJA 4CD8A 4A7SA 1AQDA 5F0MB 2V2XA 4HNLA 1K6QL 3KYKL 4XBPA 4M03A 1S38A 1B3IA 2P7TB 2FL5A 4G72B 3DAQA 3IDXL 5CHNB 5D7KE 4QI3A 4ZX5A 4PJGF 2I14A 1UZ1A 2F53A 1H19A 5KS9F 2WPGA 5AVXB 3HGRA 3P11H 4J6RL 3IMRA 1REQA 1FFPA 3MRHA 3ZKXC 1NGWB 3IKKA 4NY2A 2BRWA 5DEJA 1GS6X 3PWUA 4U1GC 5HYQA 3NL3A 3CLFL 4W8BA 1XF1A 2Y6ZA 3LKQA 2ZFAA 4FOKA 2NV9A 5AAWA 4ZFGH 1YIXA 3RR1A 2R69A 4B95C 4QRRA 2EYTA 4FXKC 1E5CA 5CJXA 4HCLA 2LFGA 2WIIB 1QVOA 5D2VA 1YEGH 2YAQA 3DUHA 3CWGA 2E27L 5JPNB 2ZJSL 2IBZY 5DYOB 4O0QA 5E6IB 5CLZA 2VT0A 1GG1A 1TMQA 2YB1A 2JB6B 2J6WA 1SM9A 4NNBA 3QDJA 1K9FA 3QZLA 1RY7B 4UTWA 2FVNA 1NCIA 5F6HI 1FFRA 2DYPA 2CLIA 4QCFA 2X0VA 4RISH 1HTIA 3KR3H 3HHMA 4OZFB 4U2ZA 5AW4B 1QLEH 2Q76A 3UTTB 2F8IA 4RAVB 1DXIA 1E72M 4J3OH 1KDIA 3KBWA 3WIRA 4R4NC 4TTDC 2BP8A 2F8OA 1PKOA 3HI7A 4DIXA 2WHKA 4JM2A 4CQCA 1TVBA 3VYNA 2X7LB 2WSPA 3M0VA 3GZPA 1E9PB 3ZIYA 3MDJA 4Q4IA 3A4XA 4K7PH 4RZ5A 1T1ZA 5JO5A 4L29A 3GDLA 1T89A 2BNUA 5F88A 1HIMH 4C6MA 1WSST 2AQWA 4OT1L 1N26A 4FF9A 4P9HH 1ZANL 3SBWA 4YHPA 1AODA 2YD8A 3GDTA 5F6IC 4QS5A 3I74A 4LYRA 3W7WA 1CVRA 1MMXA 2DSKA 5JORA 2PDFA 3BYYA 1NCDL 5KVEE 1QSVA 2YXOA 2Z1XA 3R8GA 2MCPL 1KFCA 3VAVA 2HT2C 3UP6A 1H7XA 5TK2A 1EV2E 5DX7A 4HNTA 1KW1A 3RVVD 3O9NA 3BFWA 1POJA 3UQNA 1S9VB 2HTLD 4OBRA 3LHYA 2NOYA 3KH4A 1U8LA 3PNWA 1AMKA 3HURA 3EB4A 3B2XA 4P5KA 1Q0XL 4MUZA 5DS8B 3ZMNA 4D0CA 1B4JH 1Q6OA 2J21A 1A7RL 4NN5B 2EH7L 4PEKA 1KJVA 2C7UA 1XGTB 2WZPA 1FWHC 1E2WA 3NAVA 2X4SB 2OEJA 1N7MH 4FA6A 4PBDA 4ZW8A 3CBWA 3AICA 3VM7A 4QOKA 1LRTA 2PXYC 4JFXB 1YEJH 5E2UH 1TEFA 3JUGA 4GSQA 3GB7A 3LOWA 1GQLA 3FUDA 5HPCA 5DUJA 3QRBA 5GVJA 1I1FB 4DNLA 2HK0A 1QI5A 4IIZA 3LSOA 2QPUA 4M80A 5A2CA 3PTQA 4CMHB 2VDQH 4FFYA 3KPMA 3JWDL 1QLFA 3APTA 1ODUA 3MRQB 3RMJA 3LM3A 2OZTA 4R7OA 4JAMA 4X6EB 4M1CD 1IZJA 4KJQD 3RLHA 5CWSA 1KDJA 3GS0A 1SOSA 3AXLB 3WNKA 2QPEB 1W3KA 5E8EB 5B38A 4PWEA 1VLXA 5XIMA 1A3LL 3N41B 3US1A 3OJGA 4NJAL 4AW4A 4WVXA 2KT6A 1HOCB 5DFTA 3O9WB 3N9GH 4GGBA 4YCOA 3QQ3A 4K1WA 1LO0L 1ITXA 4JPKH 3WS6A 4H9XA 3TS8A 4JM2F 4I90A 3DFHA 4NKDA 5AG8A 1UOVA 3NSJA 4FQXB 4IQDA 1Z9SA 3V5DA 3EFFB 3VMNA 3EJYC 3INUH 3W3OA 2WC7A 5K1VA 3FDWA 3FCSA 1P1XA 4W81A 4G2DA 3RJXA 4ZW3A 4GINA 1GYWA 2Y72A 4EEEA 3BIKA 4UQ3A 3QW3A 4UBDD 4XD5A 1W3YA 1RIHH 5ELIA 3NSYA 2AFNA 3N15A 1RLWA 2Z1PA 4TUFA 1W31A 3RM9A 3LCIA 4AK1A 1ISXA 5ESQA 2P48B 1O7VA 3Q05A 1R3LB 4NIKB 1KTBA 4EK7A 2V9DA 1IGYB 3NIGF 3BVDB 1K6QH 2APWA 3KYKH 3H2NA 2CLKA 5HGAA 3HVNA 1XF3B 3IDXH 4L8DA 2OZ0A 1AO7A 4LBUA 5IOPB 4QO1A 4M51A 2XY2A 1MMUA 3MUGB 5JHLH 5EIVA 4CU6A 4X5WB 4GAAA 4F5CE 4W8LA 1GAFL 3OR6B 1GC1H 1XGDA 3Q2LA 1QYGL 1FL5A 2J1YA 4D6EA 3WTYA 3S2AA 4EE2A 1T66C 1P6CA 2VR3A 1FNFA 4RFOL 3PIQB 2FZ9A 2YKLL 3VXQB 1TE1A 5IMMA 1IF2A 5D30A 3URQA 4G9PA 4XN2A 4L23A 2O9TA 4U1HB 2E27H 2ZJSH 1IKNA 4Z3IA 4Y6GA 5DF0A 4NHCL 1YXYA 2DW5A 4PRHB 2M8XA 4PMXA 3E2RA 3O6KL 5DCCA 1HHGB 4PS8A 4MKMA 3URAA 4OJCA 1SXSA 3QHFL 3J2PA 4GKZA 2WLIB 4BKLB 3GJEA 3T2PA 3WUFA 2R1MA 4PN6A 2PODA 4HA4A 2DSVA 1POKA 4OE7A 2X4NA 2IO5A 2IQDA 3TV3L 1UI8A 3ETBJ 3BH4A 2CLVB 1AKJA 3MUUA 5BXSA 1CDHA 3RNDA 4KNTA 3VGDA 1YPZB 1KLGA 2AEOA 5C0BA 3C60C 3MOAL 4LVFA 5C0IA 4PG2C 4KGJA 1J05A 3HQOA 3HBLA 5LHFA 4OT1H 1WS7A 1N5AB 1I9RH 2EEDA 4HPJA 3BC9A 2VR7A 1OTSC 5TDPB 1ZLWH 3OBEA 2YQ3A 3VH8G 3CMJA 3DRQA 5T1DL 3ARTA 4PGLA 2GW5A 4FXGB 3LEXB 3HVDA 3ABMB 2F74B 1FZOA 2BV9A 1KRCC 2VABA 1GWJA 1PZ5B 3OQ8A 3VFNA 1PKQE 3S4BA 3KBSA 3NSCA 4LS2A 1VBRA 2MCPH 3KHOA 4ZMQA 1KPUB 3B4UA 5DLML 2C1PB 5C0BE 5AZEH 5E8NB 4GBXC 2XBTA 3TZNA 4IHOA 1N6VA 3HR5A 1UWQA 4GW5B 1NUDA 4RNRA 1YW1A 1PEWA 3ARBC 3M47A 1QALA 2ZUUA 3DJTA 1K6WA 2R4RL 3U4AA 2IALA 4ES4A 4CLMA 1B5TA 3C2FA 1W16A 1XL4A 4UM9D 3CH9A 5JOPD 2EVFA 1OFAA 1JGLL 5D7LB 1KIRB 3BPNC 5LHEA 4XK2A 4YQXL 3WQCA 2C3HA 2CR0A 4PMQA 1A7RH 4JPQA 2EH7H 3WQPA 4RXGA 3RNQA 1J9SA 4GIRA 4LLYA 3UTTE 3LPGA 1II4E 4DPPA 4ERGA 2F8VA 3HZYB 2ISDA 3W7JA 1ZSDA 3W56A 1NFAA 5FYKD 3ZLGA 1UMYA 2EIBA 4FHBD 3N9KA 3S1WA 4M7ZB 1PG7H 4J4PC 4PS4L 3FT4A 4X8JA 1ZTXH 5TFSH 5I17A 3DSNA 1A9BB 3PAVA 3AISA 1Y18B 4Y8AA 4PGEA 2IIJA 4ACTA 4FLSA 4NQTA 4TQIA 3LEVL 3BXWA 3CHRA 1DUZA 4AVFA 2HPTA 3PNRB 1KEML 3GMRB 1K4HA 2WXNA 4JYDA 5D9PA 3A9IA 3PS7A 3WFBL 4MJ6B 4M02A 5C0DB 4N8UA 1FSKC 3QC0A 3X13B 2QELA 4XKYA 1YDPA 2GFBB 4OUIA 1H0DA 2O4EA 3VFSA 2H90A 2QFRA 3CIAA 4KROD 2CFDA 3QDAA 5CAYB 1ZV5A 5D1ZA 2NVCA 5ADPH 3TAKA 4PD4K 5FJTA 3VXOA 2PZ0A 2QCEA 1N0LA 4Z7WA 2GOUA 4GXUM 4DQAA 4NJAH 4LPXA 4RGNE 1I31A 1AMYA 3BD4A 1KIUA 3WLSA 4YL2A 4Q6IA 3QTPA 1SOXA 3G5VA 2HCVA 4G8IB 4W68A 3V5FA 1LO0H 4DGIL 4IJTA 3RFZA 4IU2A 4MJ5B 1BD0A 2GAZB 3U1QA 1J5HA 4WJ5B 1BG4A 4G1MA 1WBXA 2VO8A 1OSPH 1LURA 3M7WA 3BDBA 2J73A 2BLEA 1V7NL 4OV4A 3NR0A 3CL7A 2VDLB 4NCDA 3CHQA 3VG0H 2HLAA 3IYLW 2BVUA 3S36L 2UWEB 1NSUA 3AYRA 4WEMB 4XNUH 1ADSA 3WH8A 2CO4A 3ZHLA 3QIBA 3LV3B 4HIBA 3L3GA 3L1GA 3XINA 1OCOB 3IGKA 4MNQD 1VKXA 4ODVL 4OM1L 4KCUA 3P3UA 5KSAA 3MGTA 2Y0SA 5DURD 5FW8A 1OF2A 1OCWL 2DQJH 4KCTA 3IDUA 3P02A 3VE0A 3N43F 1W4NA 3AALA 1EGUA 2QPFA 3TBVB 4JPWH 4XC1H 4X4YA 4R5VA 5JH2A 1VCBC 3NFNA 2X1SA 2IPFA 1XLEA 2H2SD 3IGSA 5IMLB 3U9PL 4EDXB 4NSKB 2HKFH 5I6XB 1PFOA 2CLPA 3N34A 1JWSA 5DRZB 5DHVH 2PI6A 1XYMA 2ERJB 2V5JA 4AENB 2PU1A 4AH2B 2X4RB 3C9NA 3ARQA 4J1UB 4F37K 4FG4A 1QRNA 1GAFH 2DH2A 1L2QA 3DYOA 5DUBA 4HT1L 5EO1A 1QYGH 1TYGA 1XYCA 2ED7A 2VWTA 4DOHE 5CR8A 1KBGL 2DBLL 3S5YA 4W4OC 2YKLH 1GTEA 2MOVA 3VU2A 3O6DA 4U3AA 3QQ0A 3QH2A 3WFLA 2UY6B 2A7PA 3NP3A 5AOZA 3LX9A 3S4SA 4PW3A 1RR2A 1UG9A 3O6KH 3EG9A 5GRZA 2HT3C 2Y4SA 5EB9A 5ECJE 1OB1A 1DP0A 3OLIA 5DO2D 1VFFA 1RI8A 1ZDQA 5HR7A 3C61A 4PQXA 1DQQA 1CFQB 2YUWA 1ZMYA 1HJXA 2VDQB 2H4EA 4JFYB 3SRHA 4GMSL 2OL3B 1UA6H 2HFEB 2D2GA 1RVFL 2YRBA 3GMPB 4PCNA 4HCIA 3CSBA 1JN6A 4MDIA 3ITLA 4ML9A 4CNIA 3BGFB 1NBYB 4JQ3A 2OT1A 2OZ4A 4UWMA 4YWGL 3QUXB 4Z7WF 3VWJB 4ORGA 3NQFA 2MTPA 2HNHA 5T1DH 4HS3B 1BZQK 2Z3FA 1GGOA 3GRGA 1SEBA 1XSJA 1UR0A 2MCG1 4WEUD 4C1KA 2JALA 3O0FA 5KN5B 4JFFD 4EAYA 4UTBH 4MX7A 1BLIA 2NX5D 3D4GA 1XGZA 2YW4A 5IQLA 3KNBA 4PJXA 4GP8B 5J9PA 2HJPA 3UZJA 4XIMA 3STLA 4CBPA 1IM9A 2HG5A 2ZWKA 4BEIA 1JD7A 3MRKB 4NS0A 1NDTA 3APYA 1PZUB 1LWRA 4R4FH 2NR6D 2YFNA 4PRHE 4JR5A 1S3RA 3AAZB 1QJWA 2J77A 5J8OA 4E0RB 2YUVA 1SDAB 3RWFB 3GU9A 1P2CB 3OYXA 4Q32A 3GSNA 1DR9A 4QRPD 3VRIB 4U1IB 4I48A 2AGKA 5FCZA 2ZRYA 1NC2A 4JEQA 2YPKB 2APVA 3CUIA 1RQBA 4AQ1B 1TV8A 1LEGA 4ZFFA 3W2KA 5L2KA 3FEMA 4QSHA 1YADA 5EZPA 1C8QA 5EU4A 4H41A 3P2DA 2QR6A 3ZDYB 2FVKA 4MMHA 1OQOA 5CEZH 3TH6A 4P2OB 4PMUA 5AG9A 4GVFA 4PS4H 1D8CA 3WLWD 5C0CB 5FJJA 4AJ0A 2QGYA 2BP1A 4Y5VC 2FZ8A 4AX6A 1HCZA 1E27B 5T1LA 5GGTA 1W8GA 4EZLA 4KRMB 4N7QA 1F1AA 4H8UA 1E4HA 4PLKD 2ZPKL 3RVVC 4N3UA 2CBOA 3P9WB 3ZKMD 1OGAA 2CQVA 3UG8A 3DOSA 2HTLC 1RPXA 3G1XA 9CGTA 4NAFA 3WFBH 2Z26A 3SJVD 4QBXA 3FO9B 1P9MA 5F1OB 1S3TC 2Q1EA 1KKOA 1LM8V 4LVGA 3IPBA 3OA5A 3MI2A 4POCA 3OX8A 5A2KH 2IXQA 4TVCA 3G08A 2Z31A 1C82A 4UV7L 1N7NA 3PJTA 2ZD0A 3SW6A 4R7WA 2GJZB 2VDRB 3O6FB 2YAFA 4H7ZA 2JKIS 3RIFF 4DZHA 1CQYA 4F80A 4AMCA 2VUKA 2W38A 1RCQA 1X1NA 1WG3A 2JKSA 4ATLA 5LDSA 1HKWA 4P23D 2JKNA 4FR6A 1H3XA 1IE4A 2HRHA 2Z7KA 3OG3A 1OQFA 1QXLA 4L1HA 1LUCA 3PFRA 5KSUA 4KI5D 3L1FA 4HEMA 3E0FA 1FVDA 2J27A 4N8VA 1RKRA 4BHUI 2Z0BA 3ISWA 3Q9QA 4MKNA 4AHOA 1XCFA 5A2AA 4G6JL 1AJ0A 3NSDA 3SRFA 4KJQC 3P3RA 1VGAA 5LIKX 4QYOB 4ZUUA 2WMIA 4N0FA 2VM3A 4RE4A 1UD5A 2WXMA 3BKMH 1D9KC 4NZ1A 3QYMA 4FKEA 3HG1B 3BWAB 12E8H 5IFJA 1OCWH 1UUNA 3LTPA 5JHAA 4EF9A 2XFXB 2COVD 1M41A 2WWDA 1KKRA 4L3ED 4LBEB 1FDZA 1M3JA 2WLKA 4Z9KB 3SDAA 2GJ6D 3K2UL 3KGRA 4Y5YC 3WY4A 2BRPA 1VPQA 3KTCA 1ZWIA 4ZTPL 4Z76A 4EPDC 3R79A 3AXMA 1GYCA 5AC6A 2HPIA 2JWYA 4W86A 4H8NA 3UBXA 1O75A 3BLFA 3T6WA 1XXDC 1N5YH 3B8YA 4P49A 2CG1A 1QSED 1V8HA 2N7BA 1ZE3C 3QPKA 4LZKA 4MMZB 3EIFA 5CU5A 4UOJA 4LARL 3BZEB 3F3HA 2ADIB 4BI7A 4PRPB 1CCZA 1EFZA 3C6LD 1FO0H 5EU5A 4AIBA 3D7PA 2FZBA 3MOBH 3ATFA 1EK3A 1JZEA 5TH2A 5EDSA 4UBDC 4BH8A 1S3HA 5D38A 3HKFA 1MQPA 1ACYL 3DGCR 4FB7A 1OGSA 5B21A 1BZ9A 3MGAA 4I5BA 5D4QA 3EF7A 2CLOA 1S9YA 3CK5A 3MJMA 1SUXA 3RPIB 4J8RA 4WK9A 5ENLA 2Z1SA 4QY8A 4KO9A 2GVLA 1L4IA 1T7YA 3GUGA 5G4EA 2OCFD 1EBGA 4NX5A 2XG4B 3HFTA 2PWDA 2Q8BL 3J7HA 4MSWB 4XP6L 4UOW0 1LK2B 4LC8A 9XIAA 1PQZA 4GMSH 5AFAA 1XGUA 3VNMA 1A4MA 2MKLC 3SGZA 1XINA 2NY2D 3RRSA 3MPCA 2Y1YA 1QCWA 3QMSA 4AVOA 4YWGH 4XMLL 5I5RA 5KVGH 3TVAA 3DGGA 2P8BA 4R8WL 2QVNA 3WHE0 4M6UA 2O5YH 1UUSA 3LN4B 5EOCH 1E3ZA 4QG8A 3KJ4B 4PREA 3I6KB 4C55A 3WTTA 5DMKB 4IOTA 2ZZUT 5L8KB 4ZDHA 3GMLB 4Q74A 5J5RA 1GGBH 4ERSH 1V6WA 2A99A 2LTQB 1QO5A 1BAWA 4YHNA 2YJLA 3BI9X 2BP5M 1EMTH 3RXZA 5I16A 1XL6A 4N0UB 1ZSHA 4V1DD 2PDLA 3GMMB 1JWUA 2Z6FA 4U1LB 3GR8A 1PX3A 3OS7A 2LU5A 5CCJA 1R5IA 1T0NA 4WQOA 4ZMLA 3V6OC 3BKJH 3S5LB 4UDUB 1WTGT 3IF1B 3EWXA 1VPOH 2FT6A 1E2VA 1XWYA 4ZXBD 5DJDB 1QTPA 3MRPA 4H9UA 4NQXA 2IPUG 2HH0L 4QLLA 4K7PY 4NIYE 1F4WH 4NVTA 3L5LA 2XKSA 4Q9RL 2IQTA 4XNQB 3CEUA 3IGAA 4K6AA 4OFQA 4GMEA 1O7DC 2F54D 2KQMA 1S5IH 4FZEL 1ITQA 4E9WA 5K59E 4X4ZA 4AK2A 4LHUA 2LGNA 3X40A 1QPOA 4ATWA 5JBFA 2CIRA 3KOWA 3L3HA 1BAGA 1BEYL 3QARA 5F3BB 1UB6B 5JQHC 1KELH 3S0PA 3WFHB 3EUDA 1DWFM 3GXNA 4XVUD 2ZPKH 3QNXB 1SXBA 2BSBA 4IG2B 1ETB1 4XB3A 2YCJA 4H26A 2XBZA 2X7VA 2ILLA 3TA4D 3O8XB 3IVUA 1FG2B 2N0MA 2Q71A 3WQ5A 1E67A 3HV9A 2F18A 4XPBH 1R6VA 1FX6A 2Z2AA 2E28A 3PHSA 1RCYA 1AXSA 2B16A 1H8OA 5LYRA 3LN9A 1E7VA 2IWKA 3QAZB 2JCCB 4B60A 2PNCA 1ZT4A 5FUCE 1WC7B 3M0ZA 4ALAC 5F2LA 5HYFA 5IUCA 1DVFA 3VDCA 2YZ8A 3VD9A 1NEZA 5TBOA 3MBWA 5DJCB 3A6CH 3OO2A 3MV7E 2GGJA 4EV2A 5C0EA 5CCGE 3LPFA 3A4FA 4D9PA 1AC0A 2PLJA 1OCRB 4GUOA 3VILA 3C5JA 5TQ2H 2XWBB 4L0ZA 3GUFA 5GGQL 3BOFA 3OGRA 5DUPH 4PYSA 4X8XA 3KDPB 3OGVA 4A8IA 3GLEA 4PGZA 4GC3A 2J72A 3QXVA 4GHRA 2NY5H 5B7YA 3CFTA 6PCYA 1A6WH 2B9AA 1EJTC 2MPAL 2UXFA 4G6JH 1VJIA 1RUSA 3B05A 3I3DA 3CFCL 1JGVH 5DQJA 2ZUTA 1INQB 2X6UA 4KHTL 2IANB 3Q1EA 2WLJA 1QVBA 1JWMB 1QA9B 4PJFA 2R2BA 2GZXA 5I74B 4N5EC 1L7KA 2WQ8A 3UCQA 4JO4L 3RI5K 2DDQL 4REQA 4X9FA 4U7KA 2FWSA 2VEPA 2BNQD 2WYTA 1GTFA 4AWUA 2Y73A 3HRPA 5H8UA 3W1XA 2IG2H 1L9TA 4GXVH 4NNAA 2G3ZA 2AEQL 4NZFA 3ZBMA 2PGFA 4DH2A 4XG1A 2EF9A 4R26H 1WMOA 3EJSA 3R4DA 3REVB 3S96B 4A7QA 4R2GB 3K6SA 4N0CD 5HGHA 3P4MA 4N2LA 1QFWH 4TRPH 2Y70A 3RJQB 3B0XA 4KKBD 3TTEA 2L4OA 2W79A 2BOCA 1H7RA 4UZUA 2RAMA 1K8CA 1E51A 1XVSA 1P0SE 2ITDA 4JFED 2A38A 3OKDB 4XO4A 2K6YA 2EYRA 1D3CA 1A5NC 2NTFA 4DXKA 1AD0B 3GU1A 4F0LA 1F4AA 3G0UA 4FMVA 5KW9H 4JFZL 1XZ0B 1WT5C 1FWIC 5I8OH 2QADD 3NSNA 4RZCA 2YBVA 3VKJA 5EOTA 3WLHA 1CDIA 1EEQA 5HNTA 3ZJKA 1UC6A 1UXWB 4YHEA 1ND0B 1RZJH 3QDMD 4INFA 1K8DA 2MHAA 1HP4A 2PZNA 1ZUAX 4RXFA 4PJCB 2F9BT 3QI9B 4CC1A 4ZO6A 4XP6H 2AI0H 3MUZ1 5AZ0A 5EFDA 1CI5A 1MCDA 2NNCA 3HG1E 1D6UA 4KUCD 3AWGA 1I7ZB 4N85A 4RESB 4OCSL 5A16A 3PB2A 4HW6A 3AT8A 5DXWA 1W2KT 2FH6A 1YMMB 1G7HB 1EHXA 4OCNC 2Y25A 1T20B 3S7GA 3GYCA 3FQUB 4MXWL 1I8IA 2IH1A 2V5SA 1HGYA 1H7WA 3TPUA 1P7QB 4R8WH 4DUXA 5JIWA 2A9MH 4IJRA 4WU5A 4UTCA 1L6ZA 4B5EA 2YD7A 4GW4A 4UXDA 3T3ME 4JCLA 1X97A 4ZFGL 1WAAE 4TUKH 2LE9A 2WM0A 1TETH 1OTSD 3WJLC 1HESA 1YEGL 3SGJC 4ICXA 3EXJA 5CSZA 3IDMB 1H7NA 1I6NA 1DVJA 4PRPE 5DO2C 4OV9A 4TXVB 3WF0A 2WXPA 3BN9D 3AMDA 4P2QA 5E8OB 2C0AA 4DKAA 4WUIA 4XAFA 3KR3L 4GBXD 4IGBA 4L4VA 4XMWA 4N2CA 4QHUB 3ESPA 1TOXA 4O2FB 2CCLA 4URKA 1BQLL 3ARBD 3NDZE 5BRZD 4LCYB 3E5PA 3DO7B 3RL1B 1SYTA 2HH0H 1BJ8A 2VDLL 2DSUA 1QEXA 3BWZA 1NGYA 4OI7A 4QDMA 1ZTXE 3B34A 2IMRA 1EERB 3P0WA 1H5BA 1JZIA 3L95A 3W87A 2AJVH 4F92B 2DI9A 1HIML 3LN5B 4PI2A 4K3GA 3MJ7A 1G7JB 1ED3A 2O6DA 4P9HL 4P2VA 5D2YA 3DOIA 4DIAA 3DUUA 1EDQA 1LOLA 4M6PA 3WHXB 2Y8VA 1BEYH 1NJ9A 1T22A 1BG9A 4WTQA 2A9AA 3C8KB 3VPLA 3WO4C 2Q6ZA 5AC5A 1H49A 5LIUX 5BZWA 5FJUA 5F96H 4E42B 1EIBA 3V7AG 4C6QA 1AHMA 1ODAA 2PW1B 2IC2A 4NZUH 1CO1A 2NR6C 4RDWA 4NERA 1Z48A 1E9QA 3STZA 4LF2A 1DO5A 4Y4KA 5DJAA 1OHZA 1V3IA 1RY8A 2J56A 3FQXA 2YSSB 1L6PA 4N90E 5BW7A 1PKMA 4PJGA 5IDZA 4LHQB 2JTDA 4OD2B 1FO0B 3ZRCC 5DK2A 3T8MA 1E3FA 4MNGE 3QZWA 2WZ6A 1K3ZA 2BZDA 1B4JL 3TFCA 4OKVB 4YWIA 5D2LA 4A4AA 3T4YA 2WQPA 3WF4A 1W8OA 2XH4A 3JU2A 5TDOB 1W54A 4WWOA 3AFBA 4RUBA 3OC8A 5GGRB 3T3MF 2RUSA 3N06B 4RFNC 3WIFA 3WLWC 1YNTB 5LWYL 1R34A 4Z7UB 1JNJA 1JPST 1N7ML 3BLDA 1E0XA 4JFQB 4P57A 3LPPA 5E2UL 5L88L 4PLKC 4XGZB 5CJ8A 3CPLA 1G0XA 5E6SB 4UT9H 2A85A 2PWUA 1IC4H 1M53A 3PBMA 3U5UA 4HUUA 5GS0H 1Z44A 4IIDA 4GY7A 1FAIH 4NOBA 1AD4A 4YGAB 4HU4A 3CFCH 2WCOA 5D2LE 3ZXAC 4KHTH 3F1QA 2VDQL 3L1EA 1GYNA 1PWMA 3GBDA 2OL3L 1A6UL 1TWWA 2ZONA 4WRHA 4JO4H 4QYAA 2FIKA 1LOHA 2NY4B 5AY7A 5TE6L 1UM6H 4ELKB 1X7IA 1ZFJA 3QEQE 1KIPA 1A50A 3UBFA 4IX0A 1E1EA 3ONCA 3DV4A 1QWGA 4DN4L 1MI5B 4U1KB 4P23C 1ZRUA 4BA8A 3AHVA 1JZFA 4KTRA 1R5WB 2D7QA 1NCBL 3V18A 2BPBA 4HNNA 3SCMA 4KI5C 5I5MA 2V0AA 2QJMA 3UTQB 1S7SA 2JCCE 3ZL2A 2MCMA 3VFRA 3EAKA 3MRCA 4K7VA 3L4YA 2KHAA 1A5MC 3SY0B 3NPWA 1MRDL 4JPKL 4OQTH 5CMAB 3TBSA 3H6JA 2H9AB 1GVRA 3OTRA 1LGVA 2FO1A 4K3ZA 2WWOA 3AY4A 4M6OH 5FF6A 3PWPE 2KZBA 4Y4FA 4PP1C 2YMTA 3DVIA 1A21A 3PZQA 4JFZH 1JZ7A 3INUL 1A80A 4KX9A 3UT0A 5F71A 4NKOB 1ICSA 3MRFA 1RY0A 1U22A 1MXDA 1UA7A 5J6HB 1S7UA 3DVNB 2IANE 3H9SE 1U2YA 3UEQA 4G42B 4APXB 3K5RA 5CBJA 3IMBA 3W22A 5H2BA 3F7LA 1QABA 4XO7A 4O4VA 3WU1A 5CPMA 5HPOA 1F42A 3MNWB 1NWSA 4Q9QL 2VLKB 4MXWH 2AQ3A 4CEUC 2ESVD 3BOLA 1YEDB 3ROOB 1FG9C 3CQHA 4YHGA 4HJEA 3NTYA 3KVPA 3C6LC 1SOQA 1TUXA 5JHLL 1PTAA 1PAMA 2I27N 3CJPA 3FCGA 3FO2A 5D2LF 1XV8A 2YUXA 3RHGA 4S11A 1GC1L 1TNMA 3C2AH 2YEZB 2JKXA 3U46B 4V2XA 2VDRL 5ANME 4PR5A 4Y16B 5CN2A 2EEFA 2XWRA 3E8VA 3WBAA 1IGJB 4RMSA 3BHBA 4KKRA 1WAPA 5IQ7L 3FN0H 2GWNA 3GMNA 1R2TA 3MUXA 4F7TA 2XN9D 1JUEA 4P8WA 4UFMA 2W3ZA 1MHCB 4NZ3A 3SDDB 3CZEA 3DU0A 1BQLH 1NCTA 2NY2C 4ONFH 3OXSA 2VDLH 3EFOB 4MD0A 3QUZD 4IPPA 3HE7A 4JDEB 2VR2A 1F2QA 2DT3A 4NL1A 1U8OA 4KQ3L 4BWWA 1I8MA 3AXKA 4M1RA 5CFAA 2MUCA 2F6XA 4W9FC 2WVTA 3EYQD 4PHZA 2HJFA 1I9RL 2OX5A 4L6OA 1S2AA 3MB9A 6REQB 4NT6A 1R24A 3N25A 5FUOH 3R0KA 4J5TA 2ON3A 2PP0A 2PF0A 1UD4A 1KMGA 5AVHA 3GWJA 4HUKB 2I07B 2PR4H 1OFBA 2CXEA 7A3HA 2VC9A 2BOLA 4OGQC 5AZEL 3IGFA 4BFKA 3T44A 5DZLA 5HYJE 3URNA 1EX1A 4O2CB 3V5OA 3IJEB 4ZXBC 5CZXC 1HG3A 5AKTA 3IEBA 5K9QG 5HVFB 1EDHA 2C3VB 3GSUB 1SJVA 4JL1A 2E7BA 4BWTA 1YAIA 4A3QA 1MG3C 4AYSA 2OR2A 1UZ4A 2F2HA 3VNZA 2BX7A 3EO1A 1U3JA 4QXTA 4P4KA 4EIVA 1JV2A 2AGJL 1NWUA 4CJ0A 5LWYH 4GYKA 3MRIB 4HX1B 1LLWA 3S97C 5AOIA 3O45B 4QHLA 2FCBA 4KKAC 4XVUC 5L88H 3D2TA 4M8QB 4BY3A 3EGXA 1DN0A 1MZRA 2NT1A 4JAWA 1ESWA 1PG7L 1ZTXL 1ADDA 1KT2A 5TFSL 1TQBB 5BS0B 1EBHA 3H6AA 3Q6FB 5ABEA 3EA3A 2J5LB 1SN5A 5SWZB 4JQIL 4Q7IA 3L5WA 4Q4EA 2OL3H 1A6UH 3FH8A 2G3XA 5TDNB 4MCZA 3TT3H 3VA6A 4MWFA 3UGXA 2XPYA 2JIXB 5TE6H 5MI0B 2PCFA 1T7XA 5D6CB 4B6ZA 4DN4H 1D9KD 2QQNL 3F01A 4YFDB 2HP4A 4HKBA 5IB1A 1WV7T 2RFXB 5ADPL 1NCBH 4D9LH 1QZNA 1OX6A 1HYRC 4WZ9A 5FAAA 3K81A 2OTUA 1W1TA 3BP7A 1DZBA 5ID1A 4YXLH 4P2RE 2CMRH 4PJ8B 3UWWA 2HTMA 4JTIA 2V4LA 1MRDH 3NVQA 3L2MA 3N6HA 5H91A 2QCDB 5HJGA 1D6VL 1OSPL 5I2IA 4C6BA 4RNFA