4FNSA

Crystal structure of gh36 alpha-galactosidase agaa a355e from geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRLPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
total genus 232
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnsA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnsA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnsA02
4U3CA 5FEXA 1JCNA 1U83A 1EPXA 4IMFA 1KV8A 1W3IA 2KZHA 1XUUA 5CSRA 2YKKA 3BARA 3W2UA 1ZJIA 3RIKA 1QO2A 1B4KA 3MI2A 4Q32A 3O6DA 4A21A 4UOQA 3LTSA 3GKAA 5D38A 1O5XA 1DV7A 3QMSA 4JY9A 3EJPA 1AMYA 1GVFA 1OX4B 3TXVA 3ZQ9A 4ORIA 5A8GA 2A7RA 3BVXA 5DO8A 4K39A 4IX2A 4UFHA 1AVAA 3EJSA 1NF0A 3NPWA 3HZ3A 1OG0A 3DFQA 4JTTA 3KLLA 1QHPA 2DU2A 2X16A 3WY1A 2BHUA 1CXHA 2YPIA 1DORA 2ZZ2A 1J0JA 1YXDA 4UTMA 5EY5A 3WN6A 2XWDA 1H7XA 3EXSA 4QJ1A 2NSXA 2WSYA 4QNWA 1B3OA 1KM6A 5AC7A 4AXKA 1Q6OA 5I3KA 5EMUA 3WELA 1N55A 3TSMA 3THQA 2E4TA 1JCLA 1GVIA 5A6LA 3AO0A 3BVVA 4BWLC 3KOFA 4L4LA 2WVVB 1A50A 2ZZ1A 4O57A 1LDCA 3CQ0A 2CHNA 3WNLA 4WZHA 3GZ3A 4CN4A 3TFCA 3G1SA 3E9AA 5HINA 2GJLA 4HPXA 4UMCA 2PRLA 2FDSA 4KWUA 3RNDA 4LRSA 3HIJA 3VM7A 1YADA 2VNCA 2Z0IA 2ALDA 1XSJA 2WSKA 4UQDA 3IGXA 5TQLA 4DBEA 5LNVA 1XGZA 3TONA 2DORA 5HWJA 3INPA 4XKYB 3VFLA 5FF0A 3DKJA 3CZGA 3U8GA 4B5NA 4TR9A 3A21A 3E0IA 1M7XA 3S5ZA 3KVKA 1VFMA 1NF7A 4RLIA 3MI3A 4UMBA 4AVFA 1UH2A 4RZ5A 5I3FA 3TIMA 4AF0B 2WO5A 1I2RA 4PEKA 4CNPA 2VC6A 3CLMA 1G1YA 1UA3A 4AMXA 4JTHA 3W2JA 1JFHA 2DZUA 2E6AA 3N2XA 1KFJA 3K8MA 4LWWA 1XKYA 2FFCA 5FF7A 4K6AA 3MYPA 3SR7A 1QWGA 1SZGA 4HP5A 4OJYA 3VGHA 1WP6A 3W72A 3G22A 2WSPA 1O7DC 2E6DA 3FAWA 4UXDA 4ORMA 3KFTA 3W71A 3WDIA 4K7YA 3MBDA 2WPGA 3DKLA 4UQAA 2FB2A 1BPLB 5D30A 4O19A 3WJYA 4WXYA 2FTPA 3TA6A 1D3HA 2UV8G 1QPRA 1H7WA 4KFOA 3LXCA 3EDKA 3B04A 4PSRA 1TRDA 3UY7A 5I5RA 3W1AA 4U4MA 3GVGA 4JYDA 5D09A 2QPUA 4M7TA 4H8HA 2E09A 1JQXA 1W3NA 5KMYA 2ISSA 4O13A 1G5AA 2NT1A 5E1QA 2QCGA 2F1BA 4X22A 2PWHA 3M1ZA 4JICA 4MFEA 3PBYA 5G5IA 5K9CA 3ZWTA 1TPWA 2J25A 2Y24A 3KRSA 2VFHA 3A9IA 1CXEA 1UUMA 1UJPA 3CWNA 1QPKA 2FQIA 2TPSA 1WDWA 3SIZA 3BH4A 3LLFA 4JNMA 4Y8FA 1Z48A 2CFFA 3EWZA 4A22A 3P61A 2GVLA 3N14A 1ZALA 1KFKA 4UOZA 2ZA1A 2GJNA 3FJLA 1LBMA 1PHQA 1JF5A 4EVZA 3BC9A 3HPXA 3B03A 1VS1A 4O4VA 3TMQA 4AHOA 3NPUA 3R2GA 3MHGA 3TC6A 1P1XA 1ZJAA 1BEUA 1NOFA 1M7PA 4PA8A 3G18A 2GQ9A 1H7OA 1RR2A 1H63A 3TKFA 4KFNA 2B4GA 2C3ZA 1VHCA 5CGTA 1TQJA 2NXHA 5E70A 1V7YA 1WAUA 5FF3A 1AG1O 4HOWA 4UCGA 3A47A 1YDNA 2JGYA 4ZMGA 4HNUA 4J9JA 5KITA 1JUBA 4ZQRA 1KTBA 3NQGA 1OYBA 4R53A 2FLIA 3P62A 3W87A 2ZIDA 5KZMA 4JGDA 1MXDA 2Q3RA 3BMVA 2C13A 2WCGA 2ZA2A 1GVOA 3ZT5A 2BXZA 4C1LA 2RDTA 4DELA 3MBFA 3NEVA 4BI5A 4O28A 3QW4B 4JX5A 4MY1A 1BSIA 2X1TA 1K7XA 2VRKA 3DZ1A 1TCDA 5H2ZA 3PS7A 2YDAA 5CSSA 3PF3A 2V3EA 5BRPA 1VHNA 2FGZA 3MHUA 2QJIA 4DO6A 2ZUUA 1EIXA 3SGZA 1QWUA 3W3OA 1XC4A 1KGUA 3FYOA 1NEYA 2YIHA 2VUYA 3O05A 3LCHA 1G4PA 4ADTA 5LHEA 2ATMA 1OX5A 3P80A 3NPVA 1UD6A 3GXPA 1U30A 1QAPA 1TV5A 4HOZA 3L65A 2Y61A 5BOOA 4LT9A 2RKXA 4JX4A 3LRMA 2F7FA 2JKAA 2J9XA 1QNVA 1PHWA 2QDHA 4MFDA 2QCEA 3ZSTA 3WY4A 1TMHA 3GXTA 3HJEA 1O60A 1R47A 1G6CA 2VFFA 4BA0A 2YR1A 3ZR4A 4UZUA 1CGVA 4J28A 3P67A 1QOQA 4GNJA 1FCBA 4QM1A 1MZHA 3S9YA 2TSYA 5KTLA 2A2IA 1W1ZA 1HL8A 1LLWA 5D05A 1WZKA 1HFBA 2ZWZA 4MYXA 3TJXA 2BXVA 3LHVA 4TX9A 1HL2A 3N9SA 3D4YA 3UXAA 4H8UA 2ZXDA 1CW2A 1SPQA 5E6ZA 2B0MA 3W38A 1K8YA 1VYRA 2H3DA 1MW2A 3KXQA 3O6CA 1DHKA 2TYSA 4NT0A 1G94A 3IJ8A 2C7FA 3QH2A 4LS2A 2DH3A 4YWIA 4WD0A 1VLIA 1CGUA 5EYWA 1ADOA 1DKWA 4RXGA 2V5BA 4O17A 5G4EA 3FYPA 1I2QA 1W3TA 4AWUA 5ABTA 4EWND 1W8SA 4NJJA 2GVGA 2OCZA 3LI1A 1KLYA 1O5KA 3HO8A 1PEZA 1OB0A 1BLIA 5U7SA 1GYNA 1O94A 4ZL1A 5E6YA 4HKPA 3A22A 3W7DA 5I3HA 2OSXA 1H3GA 2BHZA 4OIFA 3EX1A 1S3HA 6TIMA 2OYMA 2DZWA 3RK8A 2H8XA 2R14A 1CPUA 2GJPA 4ALDA 2ZX6A 2FPTA 5LGZA 5D37A 1IZKA 1K03A 2XFWA 4GI9A 1R33A 4KWVA 3BUQA 2EEXA 1TV7A 1F6KA 1TMQA 2ZYFA 1QI4A 3Q37A 3G8RA 2OYKA 3O6YX 1H7RA 4QSHA 2VFEA 3WNPA 4N02A 2CPUA 1UH3A 2WC7A 4A29A 2C16A 5AHLA 2I1OA 4UTTA 1KW1A 4LOCA 1E3ZA 4LNYA 4OT7A 5IBXA 1IGSA 4S2BA 3CIXA 3S6DA 3IIVA 3W75A 3M43A 4M7SA 2V9DA 1UBSA 1G4SA 3NQMA 1H7NA 1T0OA 1TPVA 1W9XA 3UQNA 1LWJA 4E38A 2EGZA 4K37A 3W1RA 3ZT6A 1I8JA 1D9EA 2RDWA 3W37A 2V8ZA 1GWJA 5I0DA 3G0XA 3PB2A 4GJ1A 2O7SA 1JXKA 2DP3A 4Z1DA 2OSYA 3PUEA 4UTJA 2ZICA 2NX9A 4MVAA 2ZZ3A 1G9HA 3LM7A 4M8UA 1ONRA 4RX0A 3N73A 5DCDA 2B7PA 3GNNA 1Q6QA 3W85A 2ZA3A 2OYLA 1FX6A 4LV9A 2ZX7A 4JX6A 2ZUVA 2F7RA 2GQAA 2D0FA 4JD4A 3NNTA 3O15A 3L2IA 4ICNA 3AMKA 1TQTA 1KM5A 2PRMA 4FIRA 4O14A 4WX2A 3W1TA 3S42A 4N9EA 1R2SA 5G1TA 4A2SA 1SFJA 1H62A 3NQ2A 1UASA 4UC5A 3IGSA 1OF6A 2VT0A 3ZS4A 3EJTA 1UKSA 4HPJA 1NSJA 3GYEA 2V5LA 5AYZA 3SY5A 4FIQA 4U31A 3BAYA 1Q6RA 2TRSA 2Z1BA 3M5ZA 1OFBA 1QX1A 1L6YA 3JR2A 3UXDA 1JGIA 2ZFAA 5F1VA 4ONVA 3KE0A 1OT1A 3IIPA 4GO9A 1XH1A 1T8XA 3V75A 1W5PA 4ZQMA 3L2LA 1DTUA 3H54A 4CCDA 1QFEA 4NXSA 1T99A 1LRNA 3UZJA 5FEWA 5C55A 4UUIA 2JKEA 4MUZA 5EMYA 1GG1A 1WZMA 2BY0A 2PWEA 2Y2WA 3P81A 1LRTA 1N7KA 4UTWC 3WNNA 1LBLA 1PIFA 3M07A 1XFBA 1BWKA 5IBXC 1CXKA 1BWLA 1RVGA 5AC8A 1GTHA 1H5YA 4J3TA 1BG9A 1UKTA 3G1XA 5CZTA 4YCOA 1LLZA 3LXBA 3BCFA 3CWOX 4DEFA 4Z0SA 3SGUA 3QRHA 3LI0A 7CGTA 1VQTA 2Y63A 5D2XA 1Y0EA 2F61A 1XBXA 3BAWA 3TH6A 3I7QA 3S5YA 1SMAA 3G1YA 3OA3A 5HMSA 2WVUA 4WF7A 2BWGA 3IJ7A 1W5MA 2R94A 4ZZ9A 4HSOA 4JN6A 3KRZA 3L67A 3D51A 2Y7DA 3DFNA 3OLDA 2WKGA 1XI3A 5G4WA 1NVMA 2A7PA 2Y4SA 3LV5A 2OJPA 4PCTA 1S46A 2VEMA 1GEQA 1JUEA 2CLOA 2CZ5A 3PBWA 4ML9A 7TIMA 1MW3A 3HF3A 4GBUA 3YPIA 3BLEA 3WJXA 4K8EA 3LHZA 4GQRA 4DF2A 5K4XA 3MUXA 1WO2A 1YXYA 3G0SA 1HX0A 4DO5A 3DU0A 1DBTA 4O52A 4O50A 3UWZA 4N4PA 4DO4A 3LERA 3FAXA 2FYVA 3FKRA 3PB0A 3EKZA 1TO3A 4NU7A 1PCWA 2F1AA 5GVJA 1WQ5A 1JUKA 1K8XA 1QHOA 1F7BA 1TTIA 3NL3A 3CZKA 1C8VA 1PCKA 3SJ3A 2YGYA 2Y88A 1XSKA 3CM4A 1VIWA 1IIGA 3EX4A 1JDDA 4QNEA 2B7QA 3L9CA 4O0KA 2BY1A 3KX6A 2JK2A 3QFEA 1FQ0A 1PL9A 3W2KA 4IMEA 3UWUA 3TFXA 2V30A 1UOKA 3H55A 3FA5A 4IUOA 3NZRA 4JTIA 4LVGA 1DJNA 1OT2A 1UD8A 1KLZA 3FIGA 2BZNA 2DZXA 5AFDA 1J0IA 1MSSA 1Q3NA 3C61A 3THAA 3B0PA 4FLRA 1VYPX 2A21A 3Q2DA 4FNTA 3L5MA 5HQEA 2ZRUA 2E0PA 1KBJA 1TQVA 1SO6A 1P4CA 1J2WA 4O54A 2YA2A 3BMWA 2GQ8A 2Z2UA 4XTIA 1Q6LA 3L0NA 4QIUA 4X9YA 1ZHAA 5LNSA 5DFAA 3W7HA 2DZSA 3W83A 3F4NA 2B7NA 5G2WA 2PWGA 5I3JA 5CLWA 2OT1A 4XB3A 2YW4A 3CZEA 4FXRA 4UTHA 1HO1A 4AAJA 1R30A 5TD4A 1VC4A 1XL9A 3LCLA 5HNRA 2VFIA 4E0CA 3NQEA 1CXLA 3W86A 3WJSA 2ZZ7A 4UFJA 1PS3A 2IGTA 3CZSA 1AK5A 4XKYA 5DXXA 4AHPA 1CXFA 1TYGA 4GWEA 3R5EA 4RXFA 3BVTA 3ZR5A 5FI8A 2ZRXA 2D73A 3DHDA 3GBEA 1F76A 1RP8A 3VNYA 4GUHA 1RV8A 5DELA 4JTLA 3M5VA 2OW7A 4O1AA 2W6RA 2W79A 4I7VA 1WBHA 4E2BA 1MWOA 2WSRA 3OVRA 4UR7A 4MKNA 1ZY9A 4HPHA 1ICSA 5AHEA 3PC0A 1SMDA 1VAHA 2QV4A 2D2OA 1F73A 5AHFA 2C8NA 2P1FA 4PSPA 4IQLA 5D02A 2CLEA 5CPLA 4DXVA 1GVQA 4NZJA 2J24A 5F4SA 3QQ1A 4WY0A 4H8VA 2X2JA 3MP3A 4RCXA 3UWYA 1FCUA 2Y7EA 3GR8A 2J6XA 3BLFA 2ZXQA 2O7QA 3O16A 3W7EA 3QF0A 4WQ6A 2Y62A 3WK1A 3RU6A 4DQWA 2XVLA 3BAXA 5D32A 5H91A 4O15A 4YCPA 3WMSA 1JL8A 1LP6A 1SZNA 5D04C 2X2IA 4XUGA 3O63A 1TRIA 3LBMA 2ZX9A 2NV2A 1HTIA 4M6QA 2QCNA 3N9RA 3W7MA 4NI3A 3BVJA 5F4XA 4HA1A 4PEEA 2DZVA 2E1DA 4FNRA 2A85A 1MXSA 2QCDA 5D2YA 3W2NA 1YTEA 1M5WA 3ATZA 4O10A 5DBUA 3EWYA 4ATWA 3LB0A 4LVBA 3OBKA 3OLGA 4O16A 2QAPA 1XCFA 1W37A 4J7RA 3A23A 3LBCA 3T78A 1MEWA 2XIBA 3HG4A 3ECQA 3AMLA 3K30A 3VGDA 3MW7A 3N3MA 3NR0A 2VXNA 2X1UA 3A24A 2ZBTA 3LPPA 4WY0F 1KFCA 4AYSA 4LVFA 3IEBA 3VNZA 3GXDA 3DX0A 4GUFA 1EX5A 4BR1A 4WY0B 3FEMA 4U2YA 3OEXA 1NAL1 3W9ZA 1C8QA 1IXNA 5EPDA 4GFSA 2V2HA 2CZDA 2ZE0A 4BZYA 1GT8A 3UG5A 2NXGA 2XVKA 4GINA 5D2VA 3MYOA 4FNUA 2QKFA 5HPOA 4JTUA 1AQMA 4GC4A 2FPVA 2H90A 1K7FA 2X1RA 3DAQA 3TROA 2Z6IA 3QPYA 5E93A 3L4UA 1B57A 2XIIA 1W5NA 1Q4NX 3G1DA 1P0NA 1L9WA 4JYEA 3NQAA 5F2GA 5KZEA 1DEDA 3W7IA 1AW1A 4UQEA 2DJXA 3MJYA 4NJHA 5FF4A 1WXJA 3P60A 3EEGA 1THFD 4XBSA 2H8ZA 3GDRA 4JL1A 1TJPA 4M5PA 5C54A 3VO0A 3PG9A 5CG7A 3CV5A 4O1DA 3W2LA 1E51A 4I9AA 3HJZA 1QWNA 1WA3A 4BK9A 3HB9A 4FNQA 2YW3A 1I2OA 4IMGA 2HS8A 4NNAA 1OFPA 4PC8A 3C2EA 3L4YA 2G97A 3BLPX 4OWGA 1VLWA 3W1XA 4H6KA 2PURA 4AWTA 1Z42A 2JGQA 1KTCA 2ZZ4A 5DY3A 3ABOA 1X1OA 2ZTKA 2CLLA 3ATYA 3QC3A 3TTSA 1FWTA 2ABBA 2BLEA 3WFAA 4CCEA 1A5BA 3GDTA 2DZPA 4AEOA 3CEPA 1WZAA 2ALWA 4FLOA 3N2MA 5E9AA 4MLJA 1WX0A 4FLSA 1S5TA 1YPFA 1PZ2A 1R2RA 2A5HA 6ALDA 5AC6A 2Z1KA 2VR5A 2NX1A 3BSHA 2NUYA 4LVAA 2CW6A 3KL5A 4FNPA 4WSKA 3LDVA 3B0UX 1UD4A 1ZJBA 3TTYA 1JULA 3W7JA 3R89A 5F2MA 4UTKA 2XN0A 1LYXA 3BW4A 1ML1A 1OX4A 3TOPA 1T96A 5F2LA 3WJZA 5KEZA 2QUUA 4BFAA 2QPSA 5BMXA 3PAJA 1G7UA 4YLWA 3V1PA 2C18A 3PULA 3WEMA 1JI1A 4B9YA 1FWNA 2ABAA 5AOUA 3LCWA 1TJRA 4J3UA 3GDMA 3BG3A 3CB8A 1PVNA 4WXZA 2YFOA 4CLMA 3CIWA 3KVJA 2Y7FA 3VGBA 4A3UA 3ELFA 2QMKA 4JTGA 4FLQA 4PFMA 1CLVA 1KXQA 4LPCA 2FB3A 3HBLA 3LHUA 3IK2A 3KL3A 4M19A 2G3NA 1LROA 5J5DA 2Y5EA 1M53A 1R2TA 2NX3A 2OZ0A 2BX7A 2QCDB 3GDKA 3W73A 5HUPA 2G96A 2WCSA 4FF7A 2NWSA 3OIXA 3EWXA 4X9SA 4MJMA 4POCA 3W1PA 3BVWA 2EACA 4LVDA 2HSAA 4PCSA 2RFGA 2J9ZA 2YCEA 2C1HA 1YTDA 2DIEA 1W31A 3NM3A 2VFDA 1EUNA 3GLCA 3W7OA 3STFA 1CI1A 4NQ1A 5K7JA 5D2WA 1OFOA 2ZXBA 1I2PA 1KWGA 2D3NA 1W5QA 3HGJA 1GVSA 1PIGA 1QI3A 3CZNA 5HUOA 4OV9A 3P5ZA 4FHAA 5KZDA 1O4UA 3DGRA 3Q94A 4LW7A 1TSIA 1Q45A 4JL2A 1U5JA 1K7EA 3NQVA 2CLFA 1CGTA 3KAOA 2VEPA 4UFMA 1LCOA 1JXJA 4PODA 2X2HA 1OYAA 1VR6A 3VGGA 4LXFA 4QAWA 4AH7A 4AIEA 3C56A 2FH6A 4N9CA 5A2CA 5CGQA 2OX1A 5CZ0A 2EQDA 4U33A 5TBOA 3UERA 3I7RA 4HIBA 4D2JA 1J4EA 2PWDA 4IWWA 3L0KA 1KM4A 2ZRYA 4IXXA 4AMWA 3FKKA 3RMJA 4MZ1A 1VPXA 4JTSA 4H4IA 2CZFA 2CLMA 3UEQA 1JQVA 4X3ZA 5K3VA 3BLKA 1XD0A 2FHCA 1GVRA 3QGVA 1EP2A 3DX1A 5FEZA 3EX2A 1FY6A 1G7VA 1TV8A 3DI0A 4WUIA 4MOZA 2CXGA 3TDFA 1KGXA 3W1MA 3PBVA 3L66A 3C8FA 1TQWA 1B4EA 2X30A 3O07A 1M6JA 2VRQA 3NAVA 4MYAA 1G67A 1VJIA 4UTUA 2GUYA 5EA9A 3P8JA 3EX6A 1HVXA 2GUUA 1ICQA 2QUTA 1JDCA 3L5LA 2Q3OA 1UH4A 1IZJA 4H2CA 2CU0A 4CVWA 3L5AA 3QEZA 7TAAA 2ZUSA 5A6MA 4GUGA 4K7VA 1SSDA 3U2OA 5T26A 4BI7A 3L2MA 1X7FA 3ANYA 3PM6A 2QCLA 1CGWA 3CTLA 5G2HA 4X2RA 1P6WA 1P5BA 2QJGA 3W7LA 2WSQA 1FWWA 4GI8A 2QEZA 3GKFA 1KM1A 2TMDA 3WK0A 2ZTJA 3TC7A 2Y70A 1ICPA 3A4AA 1BKSA 2YJQA 2PCQA 1YYAA 4H3DA 5DY2A 3DC0A 2Y7GA 4TMBA 1YLVA 1JIBA 1XXXA 1BVNP 2WV8A 4UZSA 1WE5A 3I68A 5DCEA 1F2JA 1LOQA 5LGXA 4OHQA 3QPZA 3TX9A 4QITA 4Z08A 3CPUA 4E2OA 1CXIA 2QAFA 4CN1A 1VCFA 3RILA 5DXYA 1JVNA 1A53A 3S1VA 1EP1A 1I45A 3QJAA 3DFOA 3C2VA 4ZQNA 3ZWSA 4KMQA 1XH2A 1OVDA 2E5CA 4M6PA 1E40A 3G1VA 1SZEA 4O0ZA 3CU2A 4I7WA 4N6FA 3W23A 4JCLA 2NUXA 3LCIA 4OQVA 2WNZA 3NQ8A 4JS3A 1PZ3A 2OSWA 3EB2A 1R75A 3F4WA 3TCEA 4JFTA 1EA9C 3M7WA 3S5OA 4PTNA 3D4ZA 3W7KA 2XVGA 3TQVA 4UCFA 3D52A 3H53A 3P82A 1HUVA 5I3IA 3EDFA 2NUWA 4ZVJA 4W9TA 2Z6JA 3CZLA 4NXKA 4TU1A 3B06A 3R8RA 4BI6A 4S2CA 4N9DA 3VE9A 2YZRA 2G95A 4R7JA 1GJUA 1YDOA 3SFKA 1SW3A 1BVZA 1QPOA 1IV8A 5FEPA 3W7GA 3E96A 2OW6A 4HNNA 4O11A 4JEQA 3C6CA 1TB3A 1JDAA 3HGOA 1SO3A 1TPC1 4N6EA 4AHQA 2W0UA 3NQ7A 4FXSA 3VSTA 1RZMA 1V3JA 4HN4A 4LY8A 1IXPA 3TSDA 3AXHA 4DF0A 2E6YA 4I7UA 1V3MA 1DVJA 4NNCA 3NZ1A 3VU2A 3M47A 3EJQA 4O18A 3LHTA 2BY3A 4FMVA 3B8DA 3W1UA 1EHAA 1QW8A 1ZCOA 1K02A 4IMDA 5IM51 1VFUA 1H51A 4HNTA 4UNIA 3W84A 2IQTA 5AHIA 4AF0A 3LCXA 1V3LA 2DIJA 3W1NA 1JD7A 1W56A 1HWWA 3S5NA 3HOJA 1G69A 3FS2A 4QQ3A 3VNDA 4DPQA 1KCKA 2ZRZA 3IIZA 1SUXA 1FCVA 3HPZA 5LHFA 4OV4A 5A2AA 4AYGA 3S1WA 4WLCA 4JDBA 1VZWA 2E9BA 3TV8A 4HHPA 4FX7A 1ALDA 4MY9A 1GJPA 1K3UA 4CGTA 3HG5A 2C14A 3C4UA 3NG3A 1VB9A 4O1BA 1KM0A 3GXMA 1FCQA 2PRHA 4UNLA 1AW2A 3R12A 5HDRA 2CZEA 3P84A 4GUJA 4LU0A 4WJEA 5CZSA 3GTNA 4LUJA 1XBZA 2V3DA 1L2UA 3CEUA 2BY2A 3L68A 2EPHA 5SWUA 1ODUA 3W88A 5E0FA 3LLDA 5AHNA 4JXCA 4UR8A 2XWEA 3QSTA 3QMRA 1FUYA 5CPNA 3IVSA 5CKSA 5DN1A 3A5FA 4LUIA 5G1YA 2EABA 3STEA 3NM1A 3ZT7A 2J27A 2V2DA 2WOQA 1KGWA 1MO0A 3W7QA 1GZGA 3M41A 2C19A 2VOMA 4AB4A 4NUWA 1LOLA 3DI1A 3PY2A 4NNBA 3RFAA 2ZRWA 3DHFA 3W6YA 4IGHA 2GPTA 3TMLA 5BRBA 4MAZA 3L4ZA 1RD5A 1EUAA 3CHVA 4N9BA 4ZQPA 3LGEA 4MZYA 1J5TA 1L6WA 2VEIA 3WY3A 2A4AA 3EDEA 1EWDA 1VH7A 2GVJA 4GI6A 3W22A 3USBA 3NQFA 2NLIA 3GXNA 3OVPA 4J3XA 1Z32X 3LHWA 3LXAA 1GJWA 2ZDRA 2AGKA 4S1FA 2FHBA 3W7PA 4KFPA 3S2CA 5F2IA 3BUBA 1OHLA 3F1QA 2YYUA 3KHJA 3OVQA 3PVFA 1XBVA 3JS3A 1HL9A 1GTEA 3EWWA 4RV8A 4U2ZA 3L4XA 1PS9A 3VCRA 1TPEA 5E0KA 4GQQA 3W7CA 1FXQA 3G3MA 3GXIA 4OU1A 3NDOA 4RR4A 3BAIA 2BHYA 3DXIA 3PSVA 3BW3A 3LHYA 2GVYA 1KTNA 3C2FA 4EF9A 2ISWA 4YMZA 3PWAA 1RQHA 4KKXA 1ZAHA 1JRCA 3ZFHA 5HWMA 4FEZA 3NQDA 2Q8ZA 4NJIA 1I75A 5D33A 5FF2A 4HNVA 3LTPA 4LV4A 3W07A 1GOXA 1V3KA 1CX9A 2AQWA 1DQWA 3Q58A 1JD9A 3P7YA 3VKJA 4Z1AA 3IIOA 2V0TA 5KSWA 3LRKA 4UNKA 3EXRA 4XZ9A 4J3VA 3SZ8A 3E49A 3DX4A 3IV3A 1YDVA 4LRTA 1HTYA 4O4WA 3MMTA 3S1UA 3GK0A 1QW9A 1TCMA 2Y89A 3L4WA 1OFEA 3C3NA 2A0NA 5AHMA 1U2YA 2QMJA 5K4ZA 3G1HA 2ZX8A 1UUOA 1B2YA 1FDYA 3BUIA 3QMTA 3G1FA 3ZO9A 1J0KA 1MFVA 4FX6M 3DBPA 1TIMA 1YTKA 3QZEA 2DH2A 5EL1A 3UYCA 3CC1A 1ME7A 1PPIA 1OFAA 3G1AA 4Q4KA 4LQ1A 5EBUA 4JCMA 3I6RA 3NVTA 4CQ9A 1SO4A 2EADA 2EAEA 3KEHA 3UG3A 3HG2A 3TR2A 5D03A 4R33A 3WNMA 4EIVA 4JTFA 1C9DA 4RZ4A 3M5XA 4JFWA 3BO9A 3W1QA 2QLYA 2A7NA 1UD5A 2JKPA 2VENA 1MFUA 1F5ZA 1WZLA 5MHBA 1L6SA 1JF6A 5CXPA 1AW5A 2FH8A 1CDGA 3QM3A 2F2HA 3LPOA 3DENA 1D3CA 1KFLA 3NL2A 3O06A 1P0KA 4ADSA 3S0CA 1XV8A 4XWUA 3WDHA 3LCGA 3QQ0A 1LORA 1RQBA 1A5SA 2NV1A 1E3XA 1U33A 1PJ9A 3BCDA 2QCMA 1OK4A 4JTEA 5KINA 2RHGA 4WOZA 3C2OA 3LV6A 2XN2A 2FHFA 2E8YA 3M16A 4GE8A 3VMNA 4H7VA 4U28A 2YA1A 6TAAA 1MW0A 3MHFA 4CNOA 1ZENA 3TW6A 1KFBA 4P61A 1JAEA 1QCWA 3NA8A 1JI2A 4L4MA 2X1SA 1PE1A 4GUIA 4AEEA 2EAWA 3GXFA 3LX9A 1JRBA 3NOEA 4LS1A 1QI5A 1QOPA 2A6NA 4YL2A 3TSBA 1W0MA 4IJBA 4HT3A 4OKDA 1MXGA 4RJEA 3BUDA 5C6MA 1R34A 5C2XA 1TREA 2FJKA 2C15A 4HSNA 3EDJA 1OABA 1UD2A 4NZFA 4Z1CA 3NGJA 4BF9A 4GKLA 5DLCA 1XSIA 3ZR6A 2QF7A 3B0VC 3EJUA 1R46A 3FLUA 4UIOA 1RPXA 4K38A 4AWSA 1KA9F 5K9DA 3UY8A 4CQAA 3BVUA 2RDUA 1A5CA 5HJLA 1JCMP 3OLIA 1LOSA 3KRUA 4Z0JA 5BW6A 3BG5A 1GPWA 4OBTA 1HO4A 3ZSSA 1H1ZA 2F18A 3NL6A 4JDYA 2Q8LA 5L6UA 3C2RA 1H61A 1IXQA 3EXTA 3O1NA 1OJXA 3NL5A 3PR2A 3FOKA 9CGTA 4TIMA 3E12A 3BLBA 4CQ8A 2R91A 1EWEA 2NZLA 3F03K 4BWLA 3NXFA 4TO8A 3WNKA 2CLKA 1XD1A 3CTTA 1JJKA 1IF2A 1VJSA 1WOAA 3BAJA 3KLKA 2E5DA 4IPIA 1MW1A 3DHUA 1AMKA 3FW6A 3I65A 3C0JA 4XTDA 4MJZA 3VE7A 1B0IA 1WYIA 1VRDA 3TU9A 2P0OA 3GAKA 1V5XA 1HNYA 5F4WA 4LC8A 3T40A 1VCGA 2WQPA 1G4EA 2TAAA 3I7SA 2ATSA 3K8LA 3UWQA 1XDLA 3DFPA 1LRQA 3EWBX 1JCJA 2FPYA 1DOSA 4UFIA 1LWHA 2FE0A 1Z41A 2D3LA 1OK6A 4ADUA 1CGYA 2PWFA 5A5WA 1D7FA 1XCWA 1QPQA 5FESA 2ZCGA 1TQUA 3BPWA 1KXVA 1H1YA 5BNKA 5AYYA 2HMCA 2YA0A 4CKQA 3AJXA 3HMJG 3A5VA 1B9BA 4M6VA 2WPBA 1TQXA 1UKQA 1BF2A 2ZWYA 2LLEA 3DFSA 4W93A 3GDLA 4GXMA 2WVTA 3EX3A 4QISA 4FNSA 5L9FA 2CLHA 1KWKA 3DDGA 5I23A 1EEPA 2C0AA 4JFUA 4UTWA 1TPUA 3GIYA 1WOBA 4A2RA 3AJ7A 3VX0A 3CLWA 4MPQA 3DX2A 3NO5A 4LS0A 1A5AA 1Z44A 2H3BA 4NX5A 3BK0A 2YFNA 3OHIA 1NFBA 3LTYA 1F05A 2OMAA 1TTPA 1GCYA 4OE7A 3GBDA 3WNOA 3VX1A 4FB7A 5CZJA 3UNDA 3GX9A 2E6FA 3T4CA 5K2ZA 3WEOA 2YSWA 2G3MA 3NPXA 1PV8A 3MP4A 1FWRA 5BRQA 3IGUA 1PIIA 2WVVA 2X2GA 4AIOA 4WSJA 4KWWA 4MY8A 4LC6A 3L21A 2EF9A 3P5YA 1RPKA 3FJ6A 1ZNNA 5DCBA 2XN1A 4P2VA 1M7OA 1KBBA 4UTLA 4JR5A 1UD3A 1JR1A 1SU5A 1J0HA 3IJ9A 1OFQA 3T7VA 3QW3A 3BGJA 4JTKA 3ABSA 2VFGA 4FX8A 3BLIA 3G3DA 3BW2A 3T44A 1H60A 3II1A 4M56A 1SZFA 3IVUA 1HG3A 2V2CA 5CPMA 4GIAA 1MVYA 1YPIA 1UA7A 1EP3A 1FBAA 3P74A 5CLTA 3MO7A 2A1YA 4O53A 2VEKA 1KXTA 2WANA 3UWWA 5HULA 1MEIA 1WBJA 1QMLA 2ZUWA 4TVUA 3W70A 3WK2A 3S8HA 3FFSA 1C29A 4CCCA 3DH7A 3NQ6A 4TMCA 3OLEA 4O1CA 3VSUA 5AB3A 1S5WA 3UCQA 5CPOA 3CPRA 3W7RA 4GO8A 1EO7A 4IOTA 3BGGA 2QCHA 2D0GA 5TIMA 3WDJA 1OFDA 3L4TA 2GOUA 3S1XA 4CNNA 1XUZA 3K8KA 3W1LA 2JBMA 4EF8A 4G1KA 2FIQA 3MWAA 3RF9A 2NXIA 2Y85A 4Y90A 2R8WA 5G2IA 4NVTA 3G24A 1QR7A 3KWXA 2Y6ZA 3UPWA 2YOCA 2WKLA 3UG4A 1LM1A 4AW7A 4C1KA 4IPJA 1XCXA 4PL2A 3M9YA 5HR7A 3HG3A 2F7OA 4N2YA 1KFEA 1GQNA 2E5BA 3PG8A 4IMCA 3STGA 1XH0A 3PUOA 1OX6A 4N4QA 1NM9A 3LRLA 4J3WA 1N8FA 4LTSA 5DBTA 3U6WA 4JIPA 4PH6A 1UCWA 2WNNA 3VM5A 2DJLA 3A6OA 1LTDA 3L4VA 6CGTA 2YYTA 1EO5A 1G4TA 4UQ9A 3N19B 3LOTA 4Y9AA 3E02A 1KBKA 1D3GA 4K36A 1VCVA 4O8RA 1JCXA 1KM2A 8CGTA 2E8ZA 4JY8A 4NJGA 1FDJA 3MI6A 2QCCA 4PCFA 1E43A 4JFSA 1F74A 1VGAA 4UTTC 3UPBA 1UB3A 2VELA 3G8EA 1AQHA 1H50A 4JTJA 1HT6A 5D2TA 4NX0A 3M6YA 1TPDA 2HS6A 2CWNA 3WFZA 5LNUA 3JRKA 1ZS2A 3DDFA 2ZX5A 3TAKA 3TNOA 3D0CA 2EKCA 3EWUA 1I2NA 3TE9A 3QYQA 3IRDA 1KM3A 2EO7A 3BUPA 1TPH1 4WOQA 2WVSA 5F1UA 3TUUA 3EKLA 2WNWA 1AL7A 4O12A 2F84A 1X6UA 1WV2A 2CLIA 3SECA 4XBKA 1CIUA 5HR6A 2BSLA 4AEFA 2E77A 2F7QA 3EJRA 3SI9A 1QDSA 1DJQA 4UQBA 3GAYA 3ABRA 2BXYA 4K8HA 4CN6A 4Z1BA 3M0ZA 4DPPA 3UD6A 3W7NA 4J3SA 1DL3A 1SW0A 1SR9A 3TJLA 3AXIA 3TQ0A 3W74A 5CGMA 3RLUA 2I14A 3VI2A 1KB3A 3IIXA 2BTMA 5LZLA 4UFLA 3VGEA 1K8ZA 1OYCA 1XBYA 3M5YA 3N34A 3HPSA 2V82A 1A47A 1TQSA 5LSMA 1SO5A 3RLVA 4MB1A 3BG9A 5I24A 2J88A 1H7PA 2VKZG 2H6RA 2PC4A 3GNDA 4NJKA 2EHHA 3BSGA 3O8AA 4MIMA 1ME9A 1ZAJA 4ZQOA 4X0NA 3KVLA 2GJRA 1BTMA 1QPNA 5LNRA 4UTIA 1OSEA 1KXHA 4PL1A 3SW6A 3PUDA 4UFKA 4R34A 1X1ZA 4IXHA 4MZ8A 1W5OA 3BAKA 2ZZ6A 1F6PA 8TIMA 1Y7VA 2AAMA 3T55A 3R13A 4B9ZA 1IIHA 3IVTA 4RZ6A 2ZUTA 5HXMA 5HWNA 4ZQCA 3VGFA 1GYLA 3BV4A 5C5YA 3D50A 3M44A 4IX0A 1OGSA 3TAOA 2QDGA 3UWVA 5I3GA 1QO5A 3ZOAA 4RK8A 5K9XA 5EKYA 3W76A 4QAIA 2QJHA 3TW7A 2B7OA 1WPCA 1KV5A 3PBUA 1I4NA 2QCFA 1JG9A 1W54A 3MP5A 4DBDA 1HXKA 2PE4A 2NWRA 1X8FA 4MLRA 2AMGA 3HGSA 2WKJA 3EDDA 4Y96A 1PAMA 3L0GA 4DF1A 3B05A 1AL8A 5U4NA 1LBFA 3VMPA 1ZAIA 3HQ1A 3LCFA 3VMOA 4UMAA 3TXZA 1KBIA 3WK3A 3OG3A 3G0UA 2A6LA 2NT0A 1TTQA 2V81A 1XDMA 2ISVA 1IXOA 2RH9A 1EH9A 4E2DA 2EJ1A 4FO4A 3W2MA 3B4UA 4J27A 1O95A 3DFTA 5BMWA 3CT7A 2WJZA 5AN7A 3KL0A 2C6QA 4AMAA 2WNQA 4HOXA 4Y6GA 1ZFJA 1L0PA 1EB3A 1CGXA 2P10A 3GR7A 1TPB1 3SSJA 3PSWA 3WENA 2J9YA 4Q33A 3QSRA 2YX0A 2D0HA 1BAGA 2OT0A 3STCA 1RQEA 1SQ7A 4RKAA 1JCYA 2G5WA 1FWSA 1TPFA 1TTJA 1XM3A 5AYXA 3WJWA 4EOUA 3TQKA 1YXCA 2F7PA 2QR6A 3GB6A 1GG0A 4GRSA 1LZOA 3VSVA 2DZTA 3K1DA 1S5VA 3WY2A 1OFRA 3DX3A 1OF8A 2I9EA 5LKYA 4JFVA 2ZZ5A 1SSGA 4XQ6A 4JYFA 3NYZA 1DQXA 1SFLA 1FXPA 1MEHA 2V3FA 3ABQA 5F7UA 5LNWA 1VFOA 4YXGA 3UZ5A 2QUVA 1KCLA 2ZXAA 3CGTA 1ME8A 1CYGA 3DHPA 3P8IA 1DHPA 1RP9A 1FDZA 3KVMA 2ZQ0A 3C52A 1VYSX 2HTMA 5A2BA 2YXGA 5J5RA 1EA0A 2E68A 3NQCA 3TK7A 2AAAA 4JIQA 4OGZA 1SW7A 2ZRVA 3HGRA 4UQCA
chains in the Genus database with same CATH superfamily
4U3CA 1OAUH 5GISH 3KPSA 4FEIA 1JCNA 3ZJ6A 3HG1D 3MKGA 2H5UA 1EPXA 1W3IA 1N6VA 1HCZA 3NZUA 3QEGL 1QPPA 2WNGA 4URIA 3W2UA 5IB4A 2XBDA 3SKMB 3W39A 3RIKA 1B4KA 1UTDA 4JQAA 1T40A 3TCSA 1KIQB 2XFXB 5DRZA 1DFBL 4Q4RA 3LRHA 2C19A 4MWAD 3B2XA 4UOQA 5K59F 5D38A 1LK3L 5FHAL 2Q76B 4BQ6A 1NFGA 2ZXEB 1PZ1A 2WHLA 4QLRA 3WFDL 2I5YL 5JXQA 3EJPA 2O6DA 4PJHF 3ZQ9A 3GFYA 3R43A 1FVCA 2IXVA 2CUAA 3I3DA 5A8GA 4AVKA 4AGLA 4Y5VA 3B0XA 4ATTA 3ES6B 4PVNA 1EZVX 1NF0A 3HZ3A 3MUHL 43CAB 4X5RA 5C0JB 1HXJA 1PJWA 3KLLA 5KWYC 4MZRA 3ITTA 4BTWA 4WRHA 1LO5A 3P4OB 4ADJA 1J18A 4MSSA 5C0GA 2AGTA 1HCYA 3FT0A 4RMUA 4EVNB 5I0ZA 5C7XH 1J0JA 3KBHE 4GAFB 3U7BA 2GDUA 1T6MA 1FTXA 4E8DA 5AECA 2YPKA 3K6IA 4N85A 2Y72A 1UT1A 4PB3A 4QJ1A 5BZDB 3ZTJH 2VMFA 1L7TH 3GKWL 2NSXA 1JWMB 3K80A 1B3OA 2K4AA 3I6SA 1KM6A 5AC7A 3H42L 5EORH 4AXKA 1Q6OA 3ABKB 3CFCH 5I71B 2VISA 4DVBA 3BS6A 2YBVA 2JKTM 2RQEA 5FF6A 3ELQA 1N55A 1MCDA 1YSOA 3GUTB 2P8LA 5CF3A 2LLLA 4GX9A 3DOSB 3QUKA 4FQXB 2PWUA 3D85D 3DGDA 1CVRA 1CJYA 1JYWA 4LEOB 4BKLB 4XH2B 4HIXH 2FECI 2WVVB 2COVD 3A6BL 3BLCA 2VDMB 2DUAA 4O57A 4HEMA 4HSCX 3REVA 1H5BC 3VXPA 4B9IA 4KQ0A 1E42A 4FABH 3UTTA 1IQWH 3OVUB 1DDTA 3VFOA 4OBRA 4W9IC 5D9PA 3E9AA 4C6BA 2IWGA 2F74A 2ROXA 4KNQA 4GRLD 4EI0A 3FB7A 4HUXA 4U5IA 1UGNA 3B2VL 1ORQA 1U1UA 4UMCA 4MQSB 2REQA 1PBGA 1RLCL 4M1RA 3UF9A 1YADA 3I10A 2F54B 2NY3C 5AW6B 5FECB 3NFSL 1FFTB 3SDCC 3TEXA 2HJKA 4US5A 5DWUL 3D1MC 4K7PL 5CJOH 4AC2A 1GZQA 2KUTA 4ETQA 4GKNA 2JIXA 3RX8A 5I8CB 1LWIA 1QHQA 2VITA 2ZOKB 1IT7A 2WHMA 4CD5A 3MRIA 3ARSA 4WWKD 5FO7B 3XISA 3ARGB 1S9VB 3HZVA 1E9PA 1SMOA 4Z7UB 5DCCA 1UJ3C 1F07A 3S5ZA 3K2UL 1RFDL 3RVUC 4AEIH 5B38B 2RIKA 2XQYG 4W9KC 1CB2A 2KQMA 4H8NA 3WLTA 3MI3A 3GF8A 4DNMA 2VDKB 4GABA 5D7KE 4C4UA 4MQXC 1YKWA 4AF0B 2HTKC 3B34A 1CMOA 4PEKA 5C9WA 3V0JA 2P5WD 4M1DH 3CLMA 4MKVA 4AMXA 1E4HA 4I6KA 3QISA 2DW6A 3KW7A 4YNYB 3UAEA 2E6AA 1KRBC 4C6JA 1H3WM 1KFJA 3ZXAC 3LD5A 4GPNA 2FFCA 4LWWA 4X6DB 5LWYL 1QWGA 3VFWA 4OJYA 4QRUB 5JZ7C 2OZ4L 1HJVA 1N26A 4QDMA 2OQJB 3VGHA 5KS9F 2B08A 3MRCB 4OF0A 2IALA 4Q0XL 3TBVA 4ORMA 4UXDA 4E6MA 2Q0ZX 4F1ZA 4LPUA 5GHWL 3RPBA 2WPGA 3DKLA 5AZ2L 4FNLL 5K1JA 1K1WA 3IDXL 4ZFZA 1CTMA 2G2RB 1NGWB 1YMMB 4UQAA 4ZAKC 3D0AA 2FB2A 2WYSA 4BWWA 3BDYH 2X0YA 5JOFB 1ZMYA 5AZ1A 3EZ4A 5D30A 3RCMA 3P11L 4BKLA 1EIBA 3WJYA 1K77A 1XYZA 2AK4A 4JPSA 4Z7WF 1PB0A 3G5EA 3HGJA 2E7CA 1H7WA 2GY7B 1W3HA 1DVFD 3LXCA 4G42A 3EDKA 4PY8J 1KLFB 2LGNA 2DTML 3G5ZB 4R7NB 5I75C 1P4IL 1XF5A 2WXPA 2C71A 3UY7A 5I5RA 2HLAB 2VMCA 4RH4A 4U4MA 4IRZL 3BHBB 2C11A 4PRID 4U6XB 3KM8A 4M7TA 2ZNXA 4H8HA 1TJIH 1MLCB 2BWIA 4KRMB 5DEFA 2E09A 4XWGH 4S3FA 5KMYA 2A3TA 5D1XC 1N68A 3QEHB 3S36H 2NT1A 1ZDQA 4P2RB 5E1QA 3PG2A 2WYIA 5LA2A 3CFBB 2WUBH 1N82A 2QCGA 1QK0A 4WV1A 2Z1VA 4XP9H 1RJYA 1S5IH 1ACYH 1THCA 4Z9KB 2OMZA 1TQBB 4YZFE 1XWYA 3VKAA 1ZHNB 3QLDA 4FQLL 4DZ5A 1OM9A 4B0MM 4S1RH 1AZNA 5D7SL 2VFHA 1BJ1H 2R69A 1CXEA 4DFIA 3DURA 3GJFH 2X4UA 2TPSA 4R97C 3FU0A 4AZ8A 3OW1A 4XD3A 2NQ5A 2IDSA 3BH4A 1NMBH 1J1OH 4WEMB 4Y8FA 2K7PA 3EWZA 3LRSB 2AL1A 3KYMB 3VD5A 1EGJH 15C8L 3HRZC 3SPCA 2GVLA 2WV3A 2BSED 5IJVB 2E9MA 2CE6A 2Z2AA 5HDQH 5BOZG 2WYTA 3OF6D 2XRAL 1B6UA 2GB2A 2FO1A 4ODTH 3FJLA 3BVNA 3BWSA 1JF5A 4NLAA 3BC9A 4NO3B 4HAKA 1LBMA 3HPXA 4WTZA 3PZ9A 4O4VA 3NPUA 4DN3H 4OCRL 3MHGA 3TPKA 1ZJAA 3T4YA 4AG4H 4LP5A 5J13C 3A67H 3QHZH 3SSGA 4YTTA 2Y6SC 1RL1A 5D7IF 3WXVL 4G43A 2RFXB 3MT1A 4S3JA 2A6JB 3K2GA 2PPEA 5CGTA 4HLZG 2I7GA 1ZV5A 3R1GL 4K73A 3RB5A 5EOCH 3VFRB 4FABL 3GUWA 4L4OA 4OZHE 2AZAA 5FF3A 4ALAH 4WJKB 4ZMGA 3B37A 2ODIA 3SE9L 4Z7UF 3RM8A 4I3GA 4Y5YC 1PKQA 3Q8EA 4IRSD 1W2ZA 1WIUA 1JTTA 5F0LB 2FFIA 4GRWF 3P62A 5AVTB 5I6SA 3TBYB 4P7NA 1PUDA 1U8JA 5D93B 1KN4L 3O2VL 4Y1AE 5IMKA 1OIOA 4J4PC 1N5AB 1X3DA 1KCZA 1V03A 2GFTA 3SIMA 2N01B 3PV7A 2WCGA 2ZA2A 3WA3A 4JANB 3QJVB 2BXZA 4YSQA 4YWSA 4NQED 3C60A 2R0LH 3L7EB 4HT1H 4NN6B 4Z7VA 4IKJA 3A64A 4JKMA 3O3AB 4Z7WE 1OCQA 3EA1A 4OZGB 4HU0A 4O28A 1QEWA 1WBYB 5DHVA 1LE9A 1X4XA 1QTYT 4MY1A 4H9XA 3WD0A 1K7XA 4HIQA 4MMWA 3UJ2A 2W59A 4M5YH 2FR4B 5GZND 1OGTB 3BPLB 4WIQA 2J7EA 3DV4B 2VR9A 5CSSA 4Y9OA 1VHNA 5A6AA 4QD2E 2FGZA 3QUXB 1ZSDA 4UINH 2ZADA 5LIUX 4ACZA 5AFDA 4DO6A 2ZUUA 5L4JA 4TOQA 3I02A 1QWUA 1ZA6B 2CO7A 2PLCA 2OOFA 3QDGE 3IWUA 4KDWA 4R4ND 2EBNA 3FYOA 3VYPA 3QLLA 3CFBA 5EOQH 4LSBA 1F3XA 3MCLH 1OACA 2WWKT 5FYJU 2OM5A 3NA9H 2IAND 4U1NB 4YBQD 3BDYL 2W61A 4WDUA 4WDTA 3H3PH 1IBBA 1RJRA 4PGCA 3GO1L 2NLJA 3P80A 3NPVA 1U30A 3KTSA 4WWKB 4XZUA 1TWDA 4HOZA 4Z3HA 4XN7A 2SEBB 1BECA 1RWHA 4J5TA 2Y61A 3L65A 4HCRL 4G6CA 4LT9A 4OZOA 2V9RA 1IEHA 1Q9KB 1XR9B 1MHPL 4H00A 3GPEA 1SEBA 4OLWH 1N59B 4JHWL 4KPHH 1QNVA 1U8HA 1WKEA 5JXEC 1CL7I 3WN5B 1J8KA 2VHLA 1P1ZA 4PBGA 1NLDL 3GXTA 5IBTH 3VXRB 1KY7A 4FA6A 1TJ1A 4RPPA 1R47A 4QHKJ 3SO3C 4KZDH 2XNAA 2VFFA 1W9UA 2YR1A 2XISA 4AY7A 3GNMH 4O5LL 1CT8B 2XXMB 1ZLWH 2E25A 3FT2A 3ZR4A 3CV6A 3DVFA 4FG2A 4UZUA 5DHEA 1O5RA 1R7OA 3OB0H 4FCHA 4L4TD 3SQOH 5CCZA 1XX9C 1KNOB 3VFMB 3W4RA 3Q43A 4EIUA 3S9YA 5KTLA 1FAIL 3T6VA 2BIQA 3IJEA 4HVBA 2EIMB 5BS0E 1LLWA 3W2DL 3MPGA 4XN5A 2VJ8A 4H44C 4NNXA 4F8QA 5LGJB 5IP4A 3C5SA 2CLZA 5EU5B 3LHVA 1AH3A 3LMYA 4AD2A 4DJFC 4X2PA 4OZGA 3WGVB 3SRHA 4H8UA 3BQUA 4M4RA 2KZBA 15C8H 2B0MA 5DR5L 3ZVHB 1ETA1 4ECLA 1K8YA 1MW2A 3KXQA 4F0RA 4MNKA 4KROD 1DSWA 2C9VA 4N0FB 2X88A 4MA8H 4YMPA 2AQ2A 2TYSA 4NT0A 2ZD0A 3V5HA 5CEWA 4LS2A 4LT7A 3MWCA 4YWIA 3QAZB 4G5ZH 4P23A 2I69A 1N5AA 2DD8H 4WD0A 2L4OA 1ADOA 1DKWA 4RXGA 4UQ3A 4DQAA 3KCJA 4FOJA 4KTDH 3TJPA 2GAZB 3WXVH 3D4GA 5IF0A 2R1WA 1QI2A 4KIEA 4NAFB 1W8SA 1R9YA 2I9TB 3EFDH 2J2ZA 5DSCB 1QO3A 1KLYA 4J2PA 2WW2A 3P4NA 1KB5A 1O5KA 3DUSA 5DD0H 3QYNA 2Q7YB 5F89B 1W6WA 2ZOTA 5IR1A 5I1JL 3Q1SL 1D5IL 4PYSA 5U7SA 3V6BR 2ATPB 4NENA 1P4LB 1GYNA 4L0YA 4JIHA 4Z2GA 1S9YB 4ZL1A 5A8MA 1FSKB 2XQBH 5E6ID 2BW4A 1CURA 4YUEH 1DJHA 4GRLC 2UWEA 4OIFA 5JTWA 4AMKL 1WC7B 3CDYA 3MLRH 1S3HA 3T07A 4IJCA 2FZ8A 1XO8A 1UR2A 1X5GA 4DJEA 3TBWA 4ES9A 1CPUA 4JFEA 2FPTA 4ALDA 1MREH 4XPBL 3S47A 4DO7A 3D6GA 3O9WB 3VPLA 3AG3B 2X42A 4PBDA 5IJCC 2Y1HA 3U36A 4GI9A 4MMHA 1YNTF 5IMLB 4KWVA 5C9ZA 5E4OA 2EEXA 3VRJB 3EH3B 3RPMA 3BEVB 3W7WA 2OYKA 3U57A 3H85A 3TN6A 2YD9A 3WI9A 4TV5A 4QSHA 3FYIB 1ZXKA 4NEHB 2OFJA 1M65A 3ZLHA 2VFEA 1V02A 5EU9A 3KLSA 3I2CH 4JQ3A 2NY0C 1HXYA 4N02A 5DVOA 4NJ9H 2PB1A 4A29A 4XT1C 4HKXA 3E0LA 4GUQA 2N1KA 2ZCZA 4UTTA 1F3JA 1QRNA 4JR9H 1J9CT 2W9DL 2WM0A 4YL9A 1RZJH 2BJMH 3E8UL 5KVEH 3KEDA 4LYRA 4NPYB 5H37A 4PMOA 3FULA 2QQLH 3K46A 3MOAH 4LSQH 1KTLA 2HH0L 4ODSH 3JWNC 3W75A 4V1DA 2H0PA 3M43A 4XB8A 4YDVB 2HT2C 2V9DA 3MV9D 3WL9A 1Q72H 4O2CA 5LA0A 2ZCLH 4Z7NF 1H7NA 2O26U 1SFSA 1W9XA 5AKVA 3VD2A 2RAMA 1XZ0B 3RVWD 1EX0A 4HX1A 5IB1B 2NYZA 5IB2B 1QI0A 2JALA 5KVDL 1FL6A 3O4LB 1DSFL 2HRHA 4PS3A 5JIMA 3ALPA 1A64A 4F80A 4MMIA 1C3FA 2YBTA 2EZ0D 3UJSA 1F18A 1JYNA 3QJHA 5I1AB 3WIQA 2RDWA 4HU4A 1P7QD 2MWCA 5I0DA 3G0XA 4DJEC 4LDLB 5CU5A 4GJ1A 1KXVC 4YSUA 2HJFB 1MFAL 2KC0A 4WDIA 1C5CL 3QK0A 1BKHA 3MA9H 5FYKH 2ZZ3A 4MXQC 4Y4FC 4RMSA 4G9FD 4M8UA 4IIHA 3MUGA 1BTCA 1OD7A 3SJVA 4FA8A 3GNNA 1Z9SB 35C8L 4MMXA 3B2MA 4Y7MA 2GSHA 4KW2A 3C0QA 4W7WA 1RMFH 4WI3A 2HTLD 3AGVA 3QZWB 4NBYB 1VESA 4ZENA 3WMCA 4NHCL 2H32A 5ESAA 4JX6A 3MOBH 2QBWA 4XX1E 2BH0A 5HNTA 4UT6L 2GQAA 4IFKB 3WKML 2COQA 4WUUE 1P43A 3NNTA 4JD4A 1XLIA 4XNQB 1AO7B 3VDAA 2WAGA 2C4XA 1ED3B 4LAUA 4ICNA 2J4GA 2PRMA 3ZDXF 32C2B 4FIRA 4CEXC 1RIUH 3ZKSD 1D6VH 3GIZH 5GGVY 2FATH 3S83A 3D3VD 4L3EA 4C56A 4L1LA 1E4NA 4PE8A 5TQ2H 3NQ2A 3SBPA 1R3QA 1WGOA 1J7VR 3KPRA 2AC0A 2VT0A 3RWCA 3SBRA 4BD4A 5FYJD 3RYSA 2WXHA 3ATDA 3EJTA 1NPJA 4QXWA 3TH3T 3UZQB 1FRGL 3WF3A 4JKNA 5B7MA 2XIJA 3ZQXA 4XMUA 1OIFA 3W6LA 3TZVA 1BG4A 2CO2A 4MA8L 4BZEA 3DI3B 4M4PA 5CS7A 1RAMA 4GKNB 2V5KA 3BAYA 2H9AA 3ZVHA 1LO3L 2Q02A 3KBFA 1QX1A 3M5ZA 4HZ6A 3EBGA 3GVVA 5A69A 2A4CA 2XT1B 4RFOL 2CMRH 5F1VA 1OT1A 3SKJL 2R4SL 4W88A 4GO9A 1XH1A 1AJ7H 4GQ9L 1L0QA 1NJ9A 4N5EC 2HISA 1E73M 5I1EL 2D3JA 4HJ0C 4ZQMA 5AOMA 3L5XL 3H54A 3NWRA 1QFEA 3LNHA 2Z35B 5HNUA 3LN5B 4N0YL 4IJ3C 4MMXC 2ZWLT 4MBOA 5HHNB 3FPYA 5IEHB 5I1JH 4NRYB 1D6ZA 5C55A 5GRXG 3F4DA 4RL3A 4XWOD 4UUIA 3G08B 2EE0A 3LQGA 1Z66A 3BOXA 1KYUA 2GQ3A 4YUEL 2Y2WA 2PWEA 1L6FA 2YUXA 4CVZB 1IGIL 1LRTA 1N7KA 1I9EA 3QHTC 4CVXA 1LBLA 4HIEB 4XOAA 5LXEA 1BWKA 3A6BH 6PAZA 2PPCA 3CFDA 1RUSA 3ORJA 5D7HA 3WSQL 2AEOA 5GGUB 3SE3C 3SN1A 1G43A 2BHFA 2VLRD 2XHNA 5DVLA 1H5YA 1I9RL 3JWNH 4YCOA 1MG3C 1RU9H 2X3AA 2OJZL 5EEXA 4ENLA 1YJDL 2NQCA 3QIUB 1AE6L 1EBAA 1EDTA 2JWYA 3HIIA 1FO0A 3RLSA 1MQPA 4DF1A 1UZ6E 4XCFH 3SGUA 4UT9L 3SE4A 2R9HC 2HFEB 4PR5A 3FQRB 4WUUA 1N10A 2OI9C 3P0YH 2NW3A 2FMNA 3CAKA 2Y63A 4OIIH 4APQD 3RWHA 1GSMA 1Y0EA 2F61A 1KTJA 1ZHKA 2NNXA 2VSCA 3JWOH 4OD1L 2XIQA 1QFPA 2WIIB 2CWRA 3F5WA 1SMAA 2EH8L 2O6FA 2PYFA 4XVEA 4C7GA 2NY6D 2WVUA 2DDQH 3OAZH 2BWGA 3FHAA 2BZCA 3WS6A 5A1AA 5K1VA 3U1SL 4DEPC 2XN9B 5D6DC 3PJSA 2DPEA 4M1BA 5LBVA 2W91A 7PTDA 2HKFH 2Y7DA 4F7CB 1TTCA 2CA4A 3KXFE 4H0LC 1R3LB 4BDVB 4FJZA 3L3OC 2NX5E 3MV7A 4YDLC 3THMH 1XI3A 3EMZA 3JV4A 3S3DB 1G9NC 1AHWC 1ZB5A 1DE4B 4PCTA 5HHOD 1E0VA 3NTYA 3PBWA 4Q4MA 5DFWH 1MW3A 4ZFFA 4GBUA 1G7PB 3I6LE 4P2OB 1F90H 3AREB 4F7MB 1ECZA 4HUUB 2VEFA 4PRPB 3ZTNH 4GQRA 1C5CH 2REQB 2OMTA 1WO2A 5FM5M 4GVIA 1HX0A 1NGZB 3GM8A 4F2EA 3DU0A 2DT0A 2VCBA 7FABL 1GS7A 3CUFA 2XTKA 4UV4H 2ZCKH 4V2BA 1Z7AA 2ZWNA 4Q4IA 1O68A 2OGYA 4BZFA 4POYA 1LDSA 3PB0A 1E2VA 1NBZA 2C1OB 3IXAB 1CICD 1BV8A 2QEJA 4IKLA 4RBPK 4ZDHB 5TFSL 4AENA 2F1AA 1TO3A 5GVJA 1YNLH 1UROA 2NQLA 1ZDSA 1TJGL 2AQQA 3BT2L 1YYLH 1IU1A 4GA8A 1W80A 3CZKA 1C8VA 2Y88A 1XSKA 3CM4A 1PZBA 3I9GH 4XVSL 1IIGA 1Q9LB 3EX4A 3M0HA 5BS0D 2G4GA 1CD0A 5BQDA 1FUNA 2BY1A 5HDLA 1N3NB 3B3IB 1KJ2L 2X4NA 4KXZH 3PDOA 4QRRD 1FQ0A 2DM4A 1PL9A 1B54A 2PEVA 1KFAL 3UWUA 3F84A 1H8OA 2AJYH 5DUJA 3SO5A 1V7MH 3NFNB 2BFVH 1QWHA 2E6QA 3RVWC 1LMKA 1UOKA 2Z8VC 5KZCB 4IUOA 4OVXA 3CFIC 3NZRA 2MSPA 4LVGA 2R1LA 4G7YH 1XF1A 3HBZA 4NQUA 4UDUB 3T8LA 4IBVA 3HC4L 4X5WB 2JB5L 5D1QE 4PJBA 1ECEA 1MSSA 3EFFB 3HN8A 4Z7WB 1Q3NA 1RURH 4AZIA 2MIZA 2DSKA 5JYLA 1RW9A 2VTFA 5HVFB 2A21A 3Q2DA 5CSUA 3NCWA 1KKOA 1H11A 3L5MA 5CN2A 1H49A 5E0QA 4HJJH 1MHCA 4B9KC 2E0PA 4TPRL 1TQVA 1HOCB 5I1EH 1V10A 4JGMA 1A66A 1SO6A 1TJ0A 1AANA 2VRAA 4LFHD 3D48R 3TT3H 2NY2C 2CDFA 2QKIB 4YN3A 3UPRA 4O54A 1DJXA 1EBGA 3DVGA 4KJQC 1GGUA 4XTIA 1NP2A 2BC4A 3PNUA 2GCYB 5D1ZB 4B9FA 4X9YA 3V1HA 5T5FA 2DL2A 5DLMH 3QEGH 5DFAA 3BTNA 4XZMX 1U8QA 5KSUA 2B7NA 5G2WA 5I3JA 3I3EA 1BX2B 4JE4B 4PR5B 2WLIB 3NQIA 2AQTA 3M7FB 5CJ8A 4DKTA 1OW0C 2IG2H 3KPSB 2AKRB 3VRLF 1TIWA 4YFDB 5I76B 3QHZL 3ARGD 1FGNL 4ZNCD 1W2PA 3UR2A 5HNRA 2GVEA 1HHJB 4NO5A 4QEGA 5CMAB 3QFJB 4A3YA 1WDQA 5JQ6L 3MUGB 4PJCF 2ZZ7A 3HFYA 2IKIA 4A4AA 2IGTA 1JGEA 4XKYA 2B1OA 4U1NA 5JDSA 3O45A 5DLLA 4UILH 4YHNB 3GH4A 3QXVA 1FNHA 1JMZA 4IIZA 3UH8A 2HFGH 1RP8A 5LCVL 3QJZA 4GUHA 4GSDH 3TA4D 5HD8C 1UC5A 3FNDA 4HC1H 1QVBA 3A6CL 5IK3B 3MC5A 4JTLA 4MNQB 4OZHF 3SHSA 4BXSV 1X96A 3US1A 4NQVB 2D03H 1RKYA 4I7VA 4I5RA 4PJDB 3QSKB 2DLEA 2AHIA 3PC0A 2YUZA 4I13B 2QV4A 2L04A 4AT6B 4HHWA 5CR1A 1VBUA 4IQLA 4LAMA 1YAZA 4QO1A 5E1GA 3BQUD 5BS0B 2GY5A 3FL7A 2OMWB 3L3OB 1NIUA 4FFTA 4DXVA 5T3ZD 3IAGC 5G55A 2GWGA 5F4SA 4ZAKA 1F4XL 2DVXA 3VOHA 2TSAA 1AY1L 3L1OH 5DS8B 4FR6A 4RCXA 5E2WH 1F1AA 1CLYL 2MNUA 3H3KA 1S5HA 5JIKA 1FCUA 2Y7EA 3QAZC 3OZPA 2A74B 4DJFD 1SRDA 1CICB 3B7RL 1FFQA 4NM8H 2XBTA 1XH3A 3W7EA 4TNFA 4WQ6A 4LVHB 3PABA 3ME3A 3WUEA 2K45A 3HZYB 4I77H 5KYYA 4IU2A 5BV7B 4YCPA 5KYNA 1Z9LA 4EDXB 4IU3B 3WMSA 1A5UA 4GBXB 1K3IA 1LLAA 1SZNA 1LL7A 1Z5LA 2X2IA 5A16A 1KCUL 4XUGA 5D1XA 2IXQB 1JNJA 1HTIA 1XCTA 2QJNA 1E27A 4C65A 4BSWB 2J44A 2PGWA 1DQTA 2A85A 1RVFL 3S3GA 3B8IA 4JDTH 3LEYH 4OCXH 1G6VK 3TCXA 1B0GB 2ACQA 5DBUA 4R7DB 3MBXL 2IKHA 4UZGA 3ECUA 4LVBA 2OGJA 3ESVF 2BNRD 3OLGA 2XDHA 1M9WA 1DQKA 1HQRA 3I6GB 7A3HA 3WLOA 4J7RA 5F7KC 4OUEA 3A23A 3LBCA 1XMWA 1XIJA 2J56A 3TH2T 1OV8A 2IFFL 5F88B 3PNWA 2YPLE 2WINB 2CBTA 3ECQA 3NGBC 2JQXA 1KFAH 3D05A 4NP7A 4BY3A 4FQXA 1H0DB 5HHPA 4OOUA 4PB4A 4HS3B 5DI8B 1VFBA 2YUVA 5I1IH 3SFWA 7ENLA 3QZNA 2ZBTA 4BWTA 3LPPA 2Z31B 4WY0F 2LE9A 1EZUA 2MMXA 3TN3A 2OQEC 4AYSA 4DZ8B 1O9VA 3VFUA 5JMFA 4OGAC 4LVFA 5SWQA 2V5JA 3UZZA 3VNZA 3GXDA 3D3FA 2J20A 2D2HA 4G7EA 1HH9A 3TEWA 4RAVB 1I8KB 5H8DA 2A6DA 5E1IA 4GUFA 3CN0A 1I53A 1DWFM 4DHGA 2B4CH 3M8OH 4PI0A 4DHLA 2DWYA 4GP5B 3ZKNC 5B39G 2FLRT 4U2YA 1HKWA 1V7XA 2VCCA 2WW5A 4FYTA 1MDAA 3GY1A 4L6OA 2PDLA 5DD3H 1JJUA 4RGOL 1ZLPA 2FSDA 4HKXB 2R27A 1S7WB 4PJHA 1RJOA 1GT8A 3COOA 3MLVL 5CBEB 1E1CA 1EGMA 4OJZA 5AKQA 1HP4A 3PJUA 1BZDA 3B9VA 1RWFA 4ZE4A 4JFDE 5LHFA 4K3DL 2JJUA 2XVKA 4GINA 3CVHB 3MYOA 3OKNB 5D2VA 1OZMA 5IK3A 3I6LD 3IBEA 2EYSA 4YDKH 3BICA 2KPNA 3VJ6B 4GKTA 4JTUA 1BQHG 3NRFA 2H90A 1YQVL 5ICYA 4F3HA 2W07B 4YSEA 4PMYA 4DKFL 5DJ8B 1N64L 5J6HA 1B0RA 2G4FA 1XGYL 5I28A 2X1RA 1SOSA 3MZNA 4KCWA 4DW2L 3DAQA 4U1GB 1LEKA 4CKVX 1MCPL 2C1IA 2OEKA 1YEGL 3QPYA 5E93A 2X41A 2PS2A 3KXFD 3H9HA 3RWIB 2X0UA 4S1RL 4LRIA 5D7SH 5HJGA 4G8FA 4JYEA 3QWRD 2G75B 5KZEA 4G3YH 1SJHA 2EUXA 3L7FA 2ZOWA 2ACUA 5FF4A 2FUTA 1MH5A 4Z0XB 5GRUH 4Z23A 5KSVB 1XGUB 4DK3A 3P60A 3EEGA 2QSCL 3FQYA 4Y9GA 1THFD 5FO8A 4CNSA 3FU5A 4JL1A 4ZS7L 3BZEA 2ESVD 4JFFD 1HWGB 5ENWA 3PG9A 5IDIA 6XIAA 3CV5A 2P8PB 5C0IA 4OQTL 4PJGA 1E51A 3HJZA 4IH3A 4U5KA 3W2LA 1NCIA 4RWHA 4BK9A 3P40A 4AEHL 3CMFA 1W8OA 1L6GA 5E99L 3V6FB 4I0PA 4XMKH 4IMGA 3C9NB 2HS8A 4PRTA 5DUBA 4NNAA 4R9XA 5FDWB 3ILEA 3RJQB 3ES8A 2QHRL 1AKJD 1XJBA 3CQKA 1JRHI 4I5XA 2P5EB 4AKQA 2VLRE 1GGBH 1OPOA 3DETC 2LU5A 2BS8A 3GFUA 5KVGE 2BSCA 3B83A 4H9VA 4W5ZA 2ZZ4A 2BK8A 2WBGA 1BXXA 3DX9A 2CLLA 1GOIA 8RUCA 1AD9A 2V2WB 2G8ZA 4H20L 2ABBA 1C16A 4KHTH 3ZMRA 2YD8A 3GDTA 3NCMA 2DZPA 2YAOA 3N04A 4AEOA 2DLGA 1HXMA 2YD1A 2JXMB 3DXAB 1G9NH 2ALWA 4FLOA 4FXKA 5EU6B 4MJ6A 2G4EA 2CRYA 4BGDA 2YQ2A 5AC6A 6ALDA 3POHA 4ZW8A 2Z1KA 2BNJA 2I7OA 1ZVNA 3KWTA 3PXLA 2EKJA 4HXBL 2P8PA 5KSBF 3KL5A 4Y8AA 4KEMA 1RJLA 2DB8A 3B56A 3EKCA 4WU5A 1ZJBA 1LRQA 2XG9A 2X6VA 2PLTA 3VKJA 4PJIE 4N2HA 2JFCA 1D5ZB 2JQAA 3KHQA 3M7SA 3R89A 2VO8A 4QCIB 1A3WA 3JTSA 1CLKA 1T99A 4UTKA 4KBXA 3VNIA 1C1EH 1SGKA 2BNUA 2HG5B 2W65A 3NGBB 4UM8A 2A3HA 3BW4A 2V7HA 4KX9A 3WKPA 4NCC2 4U6VL 1X98A 3OHXC 4C59B 3FTVA 4Y9FA 1U8PA 3TOPA 3CQFA 4I4WB 4NNYA 5F2LA 3HE7D 5KEZA 4BFAA 1R24A 1CTNA 2OSLA 4PGEA 3PHOA 3RNQA 2JELL 3KPMA 4XVUC 5ADOH 2PF8A 4HTBA 5BMXA 4GY1A 5LUMA 4S1QH 3V1PA 1IC5L 3BRGC 3QO0B 3WEMA 3SDDC 1JI1A 1T7VA 4JM2D 5F7NC 5MENE 4AY0A 2AJVH 3GRGA 2CXKA 3FTYA 3GDMA 3IKCB 4B5EA 5DJ8A 2PCFB 3BG3A 3CB8A 3RSYA 1PVNA 4WXZA 3E2RA 3NSCA 2VR6A 1P7KA 5MHSE 3KVJA 5D9MA 1CFTA 3GBLA 2YARA 3MJ7B 2PP7A 3E9UA 4Q56A 1HJXA 2PN5A 3IJDA 4H6QA 2DLHA 4YHZL 1DBKL 3RX7A 4IT1A 4KWSA 4A35A 1KXTB 1A6WL 4UTBH 1QUNB 2BM3A 3KGTA 4LPCA 4PS4H 5KOVC 3HBLA 3NABL 2WQAA 4KCUA 1AV4A 5EMKA 3T6CA 3DX8A 4A8NA 5AL0A 5IBLD 1T2QL 3CMJA 3W81A 2INFA 1LROA 4AJWA 1FHNA 4M19A 4US5D 1M53A 4CU8A 1ISZA 2OZ0A 2XTJC 4G9FE 4QYOB 3AG2B 5ELIA 5IQ9A 2EINB 2BX7A 3GDKA 1QFWM 1LJMA 4MBRA 1GQKA 2WOYA 3RA7H 3CHXA 3NFPB 4KQ4H 4NSKA 3W1PA 2XQ0A 3WQDA 4PULA 5DJXB 3NIGB 3GS7A 1ID5I 4C4BA 1KB5H 2J9ZA 2YCEA 1JGUH 4PRDA 1IIKA 4HXAH 3D0VA 4YHIB 5DUPH 5AW4B 3SE8L 4XMXA 3FO9A 3GHBH 5IOPB 1FBIL 3U0PB 3MRRB 4XBPA 4XNBA 5IY5B 1EUNA 5AW1B 4NQ1A 5HD8D 3O2DH 3ARGC 3CK0L 4QSFA 4DKDC 4KEZA 3GDBA 1J12A 1FNFA 1I3RB 5BV7H 2RGLA 3C2YA 1OE1A 2WZ6A 1UT9A 3KCPB 4JM0A 4KVCL 5KUKA 1PIGA 1G01A 4YFEA 1OTUC 3N9GL 4HKZB 1XTMA 4XVTL 4Z3EA 3KMDA 2MQ3A 1IVXA 4HPYH 4DP0X 3P5ZA 5DQ9A 4HCHA 3EWDA 1AKPA 4YTSA 2WQWA 1WB0A 1TSIA 1VIZA 2QPFA 2Z7YA 2VE6B 3QR2A 4U1JA 3OKMA 4JL2A 2Q86B 1K7EA 4W9CC 2V3GA 5E4EB 1INEH 3C5ZA 1UA6L 4ZUSB 3G08A 2E7DA 4ZS7H 5J12B 4KFDA 2VEPA 2EYRA 3NK4A 4LL4A 2AJUL 3FKUS 5E2VL 3QDMD 5AY7A 3QJRB 1WJ3A 3LZRA 3MREA 1ZPUA 4QAWA 4AH7A 1E4XH 4PBEA 3CV1A 3C6SB 1JS4A 1KIRB 5C0FB 3C56A 3EMQA 5GS2D 2AXFA 2FH6A 3HMXH 1IGMH 4N9CA 2OX1A 2XH0A 1QVOB 5TBOA 3CX5J 1IEVA 4HIBA 1Q5MA 2YC1B 3O6FA 1NDMA 3QJFA 3MRBA 4IWWA 3RPKA 2ZRYA 4QTGA 3SDOA 3V0FA 3SDAA 2YL5A 1VPXA 2GZXA 1HZHL 4WW1B 1LOHA 1JQVA 2R8SH 3TBTA 3BLKA 3OPZH 4CBPA 4Z2LA 1A6PA 3PJSB 1HSAA 2NY2D 1UYWH 2PTTB 3FPXA 5C07B 1TVBB 1ORSB 2H9AB 4MOZA 3AHVA 5JOEA 2CXGA 4LRNL 5EIIG 2DSZA 3RCNA 1ZHNA 4MKMA 1PZUB 3PBVA 1KC7A 2FECL 4ZUUA 3L66A 4MJIE 1A2VA 1FWGC 3ILPB 5T1KA 1V77A 4G9PA 4YO0B 3O07A 1LF6A 3V5DB 2VZ3A 3NAVA 2P26A 5FO8B 3ULVE 4NBXB 5ECJE 1GHRA 1VJIA 3SPGA 2NW2B 1F90L 3EYSL 1XLFA 3TWYA 4P2QE 1RJPA 2VN4A 2CBQA 2X28A 4CADB 4KBPA 3GSWB 5BMFH 1ICQA 3VIGA 3ESPA 5AYTA 2QUTA 2HT4C 3D07A 4HU3A 3L5LA 2VXTL 4R7XA 2ZUQC 3VFTA 3DIDA 1A5KC 1IZJA 1RZKH 1S7UA 1LF9A 1G87A 2VLKD 4H2CA 3DV6B 3HC0A 3PWNB 3CVBA 1RUAH 4JFYA 3TNMA 4CVWA 3QI9D 1LCOA 1Q7MA 3L5AA 3WFLA 1T21A 5DS1A 2R23A 4CVXB 3STLB 1N7MH 5JW4Q 3GS6A 1JGEB 3T0DA 1RZ8A 5IBUB 3L2MA 4HFUH 4BI7A 3MU3A 1ZU8A 3H2WA 1N7QA 2A9BA 3LV3A 3ANYA 4MDOA 2PF6A 4XNZC 1F42A 2FDMA 3O4OB 3GZAA 5J1AA 4X4XB 1P6WA 3SQBA 3W01A 2RJHA 4LAZA 3UMTA 1ZT7A 4TQHA 4FJ6A 1P5BA 4P4RB 2QJGA 2A38A 5GS0D 1UCBH 4TSBH 5K9JL 5I1GH 2EE2A 4UTBL 2TMDA 1BM3L 3P4OA 1LM8V 3UAJD 4PMUA 5T8GA 1XLBA 1GOWA 4L9YA 4XBGA 3MBWA 3AUJA 3PCYA 2VXSL 1DBJL 1RUMH 3DC0A 3GINA 3NJLA 3P77A 4YSDA 4XMWA 3WJJC 4POZD 2DSWA 3B9DA 3BKCL 2BMKA 3Q8CA 4KX8A 4K5MA 1JIBA 1MDLA 2WWCA 5T3XD 1BVNP 2WV8A 2JKSA 1WFTA 2WJFA 5LGXA 4A2HA 2ZQKA 4AYBA 2RH0A 2VLRB 3B6SA 3QPZA 4G1NA 4QITA 4W86A 3WLMA 1YEFH 3CPUA 4A67A 1BF8A 3QFGA 1LEIB 3M4HA 3RILA 5IOKA 1RMFL 2J8HA 5I17A 1JVNA 4GAAA 3D0LA 2VXVH 3BYTA 4PJBB 4AKPA 1LJYA 3D9AH 3MX0B 3QHFH 2YPLA 1NOAA 3DFOA 1WFUA 3FOMA 3GC3A 3DFHA 4IBWA 5DZ9A 3ZY7A 1BG1A 1FKWA 4KVCH 5F88A 1F3DH 3BZ4A 4W81A 2XUWA 4XPFH 3LS5L 2XOTA 3VWKD 3C6SA 3ULVH 4KOCA 2PDCA 2CUIA 4XN9A 4UFCA 1E40A 1UURA 1SYSA 2Q9OA 3BZ5A 4XWGL 2WDAA 2PPGA 3M0YA 2MPAH 4I7WA 1RIHH 1KBGL 3W23A 4HA3A 4X5PA 5HVHB 4XP9L 1JNNL 3LCIA 2D31B 5CBBA 3PAZA 1B0GA 1PZ3A 4HJ0D 2OSWA 3WS6C 3WUWA 4MLSA 1OC6A 4U1MA 4A2GA 3F4WA 3AICA 1WHPA 4NYUA 5HI4D 3GLDA 1TKKA 1EA9C 5D2LE 3VXMD 3M7WA 3S5OA 1OADA 3POCA 2ERJC 3BGFC 5T3ZH 4I0KA 4P5TC 4X4ME 2J75A 4NQEE 2HJFA 3UGEA 1DBMH 2IJ0C 3S2MA 3P82A 4LPYA 3L3KA 4U0QB 1AACA 5I3IA 2CKBH 5F7LB 1ML0A 1WS8A 4TTDD 3PFQA 4V2CB 4X5LA 3D0LB 1I0DA 2CXEA 4W9TA 1OGPA 2AOSA 4BI6A 2AEWA 2WD0A 2YEZB 1QNRA 4N9DA 5B4MC 5IIEB 3VE9A 1R3JB 3AREA 3ELAT 3TYDA 2H9GB 4K55A 5D71H 3ITXA 4B90A 4F48A 1D5RA 4EVNA 4YDLB 5MEQA 4RZBA 3HNSH 2NUTA 4NC2B 4XIAA 1SW3A 4P2CG 3N43B 1LQ2A 3CD4A 3FRUB 4GSUA 1EF3A 2E27L 3OV6A 5KYWB 3LH2L 4N2OA 4OLYH 2IH3B 5ABDE 4QLKA 5AHEA 1DQMH 4FGMA 3C6CA 5IQ9B 1HCFX 1SO3A 3JVGC 1TPC1 3IJEB 4FXSA 3M46A 3ONCA 1UWEL 1F0LA 4HN4A 2P8MB 5ALCL 1AMXA 3SUSA 3LSCA 4DF0A 4O9HL 4KH2A 4BSVB 5T1LA 4NNCA 1UZ8A 3VU2A 3ZE1F 4XPHL 3AY4C 4OLXH 2NXZD 4TUJB 4XCFL 4A7VA 3MRLB 3F7YB 2K70A 3ULUC 1LG1A 3W1UA 2B9BA 1IUZA 4WHYH 4IMDA 1T66C 3BV7A 4K71B 3UG8A 5IM51 1H8SA 4ECNA 2WXDM 3H2MA 1JV5B 2IQTA 5IHLB 5F7BA 2Q3XA 5AHIA 2R29A 4IYKA 1EXPA 4NRZB 4L3CA 4RAHA 3VRIA 4AXWA 3AB0C 5IHZB 2IPGA 1O7VA 3A9IA 4LALA 3CUPA 5ABFB 2AEPL 3S5NA 2N4IA 1FWIC 3AIEA 2J3SA 1R3HB 1G69A 3EYQC 1FAKT 4GG9A 3IIZA 4CD8A 4L9ZA 2JCWA 1SUXA 4I3RL 2ZXWB 1OAYH 1MLBA 5K9KA 1FCVA 3S4TA 2IPTH 3S34L 3SDCA 1A02N 5FYLD 1UPMB 5D2LA 5A2AA 1U95A 4AQAA 1LG2A 1J6PA 1P5UB 4L5ZA 5A8NA 1AHWB 4TSAH 4WLCA 2P9RA 4ZX3A 1ZA3A 2GJ6B 4W68A 5C09B 1HM3A 1VZWA 3GQYA 3RUGF 1PSKL 4R7LA 3GBNL 2QZ5A 4QR7A 1K3UA 4PPTA 3C4UA 1J8HD 1SPDA 1KO0A 4O1BA 3ZVIA 1LO4H 3RVVC 3VUSA 4YVNA 1MFCL 2HT2D 3GXMA 3K5SA 4J3OD 4XI5D 2PRHA 5I6XB 1S2CA 2FZDA 4WJEA 4MJ4A 4UV4L 1NUNB 5F8RC 1BVNT 1IAKB 1RCQA 1C92A 3DPBA 4FC3E 2VC5A 1KYOK 1L2UA 5BV7C 1OZUA 4OD3H 3CZ8A 5KS9B 3OM3B 4PUKA 2Z8WC 2D4FA 4OSUL 4F93B 3ARFA 5E0FA 5BOPA 3WTXA 3LLDA 3WHXA 4EOWL 3O8XB 2NY0D 1B3VA 4JXCA 4UR8A 1VCAA 4X6CE 3N25A 3QSTA 2MQ0A 1H54A 2A99A 5CPNA 1KELH 2Y07H 3IVSA 5CKSA 4XPAL 1US1A 1A1NA 1QKZL 7REQA 2K0RA 2WKOF 2XX1A 4G8IA 4YFLI 1WMPA 3HPLB 2WMIB 3NM1A 4XPFL 5G1YA 1M9HA 1U8CA 4ZTPL 1FIGH 4P3DB 3O4LD 2PPDA 1U4EA 1MO0A 3BW9A 2Z2BA 3PFMA 4JGUA 4HNLA 3UC0L 1CR9H 9XIAA 5DVKA 3M41A 5HGHA 2QKSA 2J6EH 4UBDC 5GGTA 5BZXA 5ENWB 3BSZA 4K9EC 3T0AA 1NWUA 2N3JA 4XO8A 1S2AA 1V4YA 3NK3A 4NKDA 4YAQB 1X8CA 3ANUA 4NNBA 5HANA 1HE8A 3Q6FA 4R97B 2Z9TA 3ATEA 4Y4HB 3FQWB 5LAXB 5C08B 1NSZA 3F4VA 1URIA 4PJIB 2GSIA 5BRBA 3LSBA 2D31A 4ZD3L 3RP1A 1S7XB 3ARFC 3FB5B 1ZZMA 2NRDA 4KROB 4NWUH 2PTWA 4N9BA 2ZP9A 1A1MB 2C5DC 4FLHA 2QGHA 3LGEA 5F1KC 5JPMC 2VEIA 3UC2A 2QV2A 3MRJB 1K4HA 3UR5A 1NGZA 3EDEA 2R2HB 3EG9B 3F3HA 4JM2A 3EGDB 3WLWC 3HMCA 3P6LA 2AEQH 4QXVA 5KVFH 2A83A 1GQIA 1Q6DA 3PGFH 5KUMA 5K1NA 1XINA 3NQFA 1PYFA 1XL6A 4QRSB 1GJWA 4U0RC 2XTLA 4AM0B 1HCVA 1Q0XL 5D8JL 2EXYD 4HJEA 3N4AA 4S1FA 1Y1UA 4LGRB 4PREA 3W7PA 2AQSA 2V9UA 3MFFB 1DQQB 1J96A 1KQYA 2HJPA 3GNRA 3JV4B 4KFPA 4XAFA 1NUDA 2IADB 2QGEA 1OHLA 4QAIA 2YYUA 4HKJB 3CZFA 4U4IA 3DG6A 3OVQA 3TOYA 3GD6A 1PLBA 2VW4A 3T3PE 1DN0B 4EZMA 1GTEA 3D39A 1E9QA 4X0KB 2HVMA 2CKBB 3NURA 2XETA 3JTTB 1S7QB 3OBAA 1AO7E 1X5MA 3HOGA 3W7CA 4WW2A 2V6AA 2VO5A 1FXQA 3DIFB 5DGRA 3G3MA 1D5IH 3GXIA 5AAWA 1XLMA 5AVWB 4AZCA 3BP7A 1H3VA 2JJTA 4MAUL 4UMSA 4AZ5A 3T2OA 3BAIA 3BKYH 4J1UB 4KV5E 3STBA 3DXIA 1BWWA 5I09A 2ICWI 3R8HA 4IRJA 1F3DJ 3IDNB 3EPNA 4H7CA 3L7EA 4WI6A 4AGQA 5T1DL 2QVIA 2Y7LA 2JFEX 3VCLB 4QHNB 4FXTA 2VLJD 2PP0A 1RQHA 2IMRA 5E2JA 2X4OA 1ZAHA 1JRCA 2A1WL 3C5JB 1JXFA 4GMSL 5F9DC 4AE1A 3NQDA 3TLQA 4LNVA 2Q8ZA 2XWCA 3K13A 4DWDA 4MJ2A 1I75A 5HJ3A 3Q13A 4ANKA 2BSRB 1BEYH 4LASL 4F33A 3MFFA 2DS4A 2DQWA 3LTPA 2JB6B 4LV4A 3W07A 4NRXB 3FCUB 1GOXA 3KD4A 3SEPA 1QAFA 5GRVK 1DQWA 2PC8A 2YRLA 2CG0A 3N9KA 4WW2C 3M1BA 5EU6D 3C75A 5HGBB 2BP0A 2V0TA 3NOYA 2HUEA 4M03A 4UNKA 1L2QA 3QUZB 4J3VA 1HGWA 3WLRA 3VC6A 2OQEA 1UM6L 5DUMH 4DP1X 1L7JA 4LRTA 2ROYA 3OR6B 1NAMB 2FTWA 1MCHA 2ICSA 3S1UA 2WVXB 1O75A 1O7DE 2CWUA 1K9FA 4FOUA 4AL8H 4NAQA 1UCTA 3B2PA 3L4WA 4FFYA 2ADGB 3SD5A 4A2MA 1OFEA 3ERPA 3PNZA 5AHMA 5K4ZA 2VERN 4GRWE 4MJIA 2F5AL 5DJ2B 3ZZSA 2ZX8A 4KVNH 1PNCA 1YEHL 4H1LB 2Y5SA 3AWNA 4RCAA 3QMTA 4I9MA 2FQDA 3QEQA 1I1AD 3ZO9A 2FX8L 1AG6A 4MD4B 4BFBD 1DSYA 2JK5B 3HQPA 4AD4A 5H2BA 3QZEA 4IBYA 3S4BA 3UYCA 3RHGA 4OD3L 2F7IA 2ZUQB 3HZYA 4QRRB 1PPIA 1OFAA 3G1AA 4JRFA 3BUVA 3BAEL 1X7SA 2R69H 1YAIA 3MKCA 3NYDA 1NKRA 4JDTL 3NVTA 3GSNA 3QZAA 4CQ9A 2CO4A 5F9JB 2EADA 2E9LA 4S0SD 4ELMB 3NPSB 5I1LB 5D03A 4R33A 3U6RA 3WNMA 2EVHA 1NEUA 2DQIL 2Y36H 3D6NA 4EIV