1NSVA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLNGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 100
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsvA00
1NS2A 3T08A 1N7PA 2WW3A 1JZ3A 2WVXA 1HMWA 1NS7A 3IMHA 3E1F1 1LURA 3OBAA 4BZEA 4RNLA 2JKAA 1NSUA 1JZ8A 1F1SA 1NSZA 3MUY1 4BZFA 1SNZA 1MMUA 3MUZ1 2BRWA 3VDBA 2BRVX 3VDAA 3DYPA 4BZHA 1JYWA 1RWHA 1DP0A 1RWFA 3VD9A 1N7QA 1PX3A 1JYNA 1JZ2A 1L7JA 2JKEA 3OS7A 1HM3A 1K1WA 1HN1A 1NSRA 3DCDA 3IAQA 2D73A 3I3BA 1ULVA 1MN0A 2WVXB 1N7NA 2CIQA 3MV11 1JZ6A 3BGAA 3DECA 3VD7A 1K1XA 2Q1FA 1JZ4A 5A1AA 1EGUA 1RWAA 1J0MA 1LOHA 1NS4A 1N7RA 1YQ2A 2ZXQA 5E1QA 3CZJA 3A24A 1W3YA 1OJPA 3T09A 3VDCA 2WZSA 3OB8A 1F4AA 1C82A 3I3EA 1X1HA 3DYMA 3DYOA 2JKPA 1Z45A 2E22A 3J7HA 2WW2A 4DUVA 3NJVA 1CB8A 1RW9A 1HMUA 2WW1A 3Q1NA 3VD4A 1MMXA 2WW0A 1LXKA 3ECQA 1OJOA 2HTAA 1JZ5A 1NSMA 1PX4A 1F4HA 3T0BA 1NSVA 1JYXA 3T2OA 1TXKA 3K25A 1RWCA 1J0NA 3T0DA 2HTBA 1NKGA 2WCOA 1SO0A 2CIRA 1NS8A 1LXMA 2WDAA 1N7OA 1JYVA 1NSSA 3T0AA 1JZ7A 4DUXA 1MMZA 2XHNA 3NJXA 3IAPA 2X03A 2ZQ0A 2XSGA 1MMYA 2WVYA 1UG9A 4TTGA 1YGAA 1LF9A 3T2PA 3WFAA 1HN0A 3VD3A 3VD5A 1K1YA 4BZGA 3T2QA 1F9GA 1NSXA 3MWXA 3MV01 4DUWA 1OJNA 2BRPA 2CISA 3NREA 1JOVA 1X1IA 1NS0A 1X1JA 2E24A 3I3DA 1HM2A 1RWGA 2WVZA 4AQ0A 1OJMA 1LF6A 1L7KA 3SEPA 1I8QA
chains in the Genus database with same CATH superfamily
3LOYA 2WVXA 3W7XA 2JKAA 1NSZA 3MUY1 1SNZA 1MMUA 3AMOA 3S4AA 1AVLA 1O7DD 2YFNA 3CZNA 2F1AA 3HI7A 4UFCA 1RWHA 1DP0A 1PS3A 3BLBA 3BUPA 2Y73A 3WIQA 3DX4A 3DCDA 3IAQA 1HWWA 1ULVA 2WVXB 1N7NA 3BGAA 1K1XA 1EGUA 1J0MA 2BT3A 1W5ZA 3W7UA 1N7RA 1YQ2A 3AMOB 3A24A 1OJPA 3RRSA 1OACA 3OB8A 2CG1A 3X3YA 4FNSA 2CFWA 2XN1A 4FNQA 3DX3A 3BVWA 2CFLA 2D1WA 5KBPA 1JZ5A 3T0BA 2FUTA 1NSVA 4FNVA 1W6GA 3RSYA 2WGQA 1SPUA 2HTBA 4BTWA 3X3ZA 1UI7A 1IVWA 4K35A 2C11A 3D4YA 3QDEA 4FNUA 2Y74A 2YX9A 2X03A 3TY1A 2WVYA 4KTRA 1YGAA 3BUIA 3WFAA 3QG0A 3VD5A 1K1YA 3A0OA 3ALAA 3MV01 2WOHA 4KTPA 3LVTA 5JMFA 2BRPA 2EADA 1QWNA 3D3IA 3NBBA 2WVZA 3MI6A 4AQ0A 3W7SA 1WMOA 1IVVA 1JRQA 3E7JA 4EV5A 2WW3A 1HMWA 3IMHA 3X41A 3E1F1 4BTYA 3OBAA 4BZEA 4RNLA 1SIHA 1V7XA 1JZ8A 3BUQA 2CQSA 2CWUA 1TQUA 1QWUA 3D52A 3DYPA 1TQSA 1WMPA 3W7WA 3S4DA 1JZ2A 3OS7A 1HM3A 1K1WA 1HN1A 1NSRA 3I3BA 3HIIA 5CA3A 2F7PA 3HIGA 1JZ6A 3DX2A 1RKYA 3VD7A 5GW7A 2Q1FA 1RWAA 1NS4A 2ZXQA 1QAKA 2E2VA 3T09A 2WZSA 2CQTA 3J7HA 4DUVA 1A2VA 2E2TA 1QAFA 1MMXA 2YFOA 1RJOA 3D50A 2OOVC 2EACA 4FNRA 2WYHA 4NEIA 1F4HA 3X3XA 1HTYA 2CWVA 2WOFA 1JYXA 1TXKA 2C10A 4KFEA 1J0NA 4K3AA 1NKGA 3BUBA 2F1BA 2WDAA 1V7WA 3EJRA 3SX1A 2XHNA 2ZQ0A 1SIIA 3AFJA 3EJPA 4KFDA 1UI8A 4MMHA 1UG9A 1W2ZA 1LF9A 3EJSA 1N9EA 4FNPA 2F7QA 4BZGA 2FYVA 4DUWA 1WMNA 3X42A 1QX1A 2CISA 3DX0A 2E24A 1HXKA 1HM2A 2ZL8A 2OOVA 1OJMA 2XN2A 1NS2A 1W6CA 1IQXA 3T08A 3WIRA 1N7PA 1LURA 4OJZA 2OQEA 4BTXA 1PU4A 3CV5A 1F1SA 4BZFA 3MUZ1 3WVFA 3VDBA 1W4NA 3VDAA 3EJTA 1N7QA 1L7JA 2JKEA 3ACSA 1QALA 3S4CA 1R33A 3BVXA 2D73A 4KFFA 1MN0A 3PGBA 2CIQA 3MV11 1TQTA 3DECA 3W7TA 3MPHA 1LVNA 5E1QA 3VDCA 2F7RA 3ACTA 3BVTA 2CFKA 3K5TA 2WYIA 3KIIA 2CFGA 1X1HA 1Z45A 2E22A 1RW9A 1HMUA 3DDGA 3VD4A 2WW0A 1LXKA 1OJOA 3VSMA 1IQYA 3BS6A 1AVKA 3T2OA 1D6UA 2F7OA 3K25A 2ALWA 2CFDA 2CG0A 2OW6A 3T0DA 2WCOA 1NS8A 2E2UA 3D4ZA 1N7OA 4DUXA 1MMZA 1KSIA 3IAPA 2XSGA 1MMYA 4OK2A 1HN0A 2W0QA 3VD3A 2OW7A 1TQVA 3CZSA 1DYUA 1F9GA 1OJNA 1TU5A 3NBJA 5JMDA 1X1JA 2F18A 2OQEC 3I3DA 4FNTA 1D6YA 3DX1A 3T0UA 1RWGA 3N9HA 1LF6A 2XN0A 3QFZA 1JZ3A 1NS7A 3BVUA 1NSUA 2RDYA 1W7CA 2BRWA 3EJQA 3SXXA 2BRVX 4BZHA 1EKMA 4MMIA 1JYWA 1AV4A 1RWFA 3VD9A 1PX3A 3VSNA 1JYNA 3X40A 2PNCA 2EABA 1IVXA 1D6ZA 2CWTA 3BLCA 1JZ4A 5A1AA 1LOHA 1IU7A 2WO0A 3CZJA 1W3YA 3AFLA 1F4AA 1C82A 3I3EA 3DYMA 3DYOA 2JKPA 2WW2A 3NJVA 1CB8A 2WW1A 3WA3A 3Q1NA 1H54A 3WA2X 3ECQA 2HTAA 3S4BA 3EJUA 3E80A 1NSMA 1PX4A 4J5TA 1V7VA 1US1A 1IVUA 1RWCA 2FUQA 1SO0A 2CIRA 1LXMA 4EV2A 1JYVA 3D51A 1NSSA 3DDFA 3KN4A 4OK4A 3T0AA 3BVVA 1JZ7A 3NJXA 1TQWA 4TTGA 3T2PA 1R34A 3T2QA 3MWXA 1NSXA 3BUDA 3QFYA 3NREA 1JOVA 1X1IA 1NS0A 2EAEA 1L7KA 3SEPA 1I8QA
chains in the Genus database with same CATH topology
1NS2A 3T08A 1N7PA 2WW3A 1JZ3A 2WVXA 1HMWA 1NS7A 3IMHA 3E1F1 1LURA 3OBAA 4BZEA 4OJZA 4RNLA 2JKAA 1NSUA 1JZ8A 1F1SA 1NSZA 3MUY1 4BZFA 1SNZA 1MMUA 3MUZ1 2BRWA 3WVFA 3VDBA 2BRVX 3VDAA 3DYPA 4BZHA 4MMIA 1JYWA 1RWHA 1DP0A 1RWFA 3VD9A 1N7QA 1PX3A 3VSNA 1JYNA 1JZ2A 1L7JA 2JKEA 3OS7A 1HM3A 1K1WA 1HN1A 1NSRA 3DCDA 3IAQA 2D73A 3I3BA 1ULVA 1MN0A 2WVXB 1N7NA 2CIQA 3MV11 1JZ6A 3BGAA 3DECA 3VD7A 1K1XA 2Q1FA 3BLCA 1JZ4A 5A1AA 1EGUA 1RWAA 1J0MA 1LOHA 1NS4A 1N7RA 1YQ2A 2ZXQA 5E1QA 3CZJA 3A24A 1W3YA 1OJPA 3T09A 3VDCA 3AFLA 2WZSA 3OB8A 1F4AA 1C82A 3I3EA 1X1HA 3DYMA 3DYOA 2JKPA 1Z45A 2E22A 3J7HA 2WW2A 4DUVA 3NJVA 1CB8A 1RW9A 1HMUA 2WW1A 3Q1NA 3VD4A 1MMXA 2WW0A 1LXKA 3ECQA 1OJOA 2HTAA 3VSMA 1JZ5A 3E80A 1NSMA 1PX4A 4NEIA 1F4HA 3T0BA 3BS6A 4J5TA 2FUTA 1NSVA 4FNVA 1JYXA 3T2OA 1TXKA 3K25A 1RWCA 2FUQA 1J0NA 3T0DA 2HTBA 1NKGA 2WCOA 1SO0A 2CIRA 1NS8A 1LXMA 2WDAA 1N7OA 1JYVA 1NSSA 3T0AA 4OK4A 1JZ7A 4DUXA 1MMZA 2XHNA 3NJXA 3IAPA 2X03A 2ZQ0A 2XSGA 3TY1A 1MMYA 2WVYA 4MMHA 1UG9A 4OK2A 1YGAA 4TTGA 1LF9A 3T2PA 3WFAA 1HN0A 3VD3A 3VD5A 1K1YA 4BZGA 3T2QA 3A0OA 1F9GA 1NSXA 3MWXA 3MV01 4DUWA 1OJNA 5JMFA 2BRPA 2CISA 3NREA 1JOVA 1X1IA 1NS0A 1X1JA 2E24A 5JMDA 3I3DA 1HM2A 1RWGA 2WVZA 4AQ0A 1OJMA 1LF6A 1L7KA 3SEPA 1I8QA 3E7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NS2 A;  3T08 A;  1N7P A;  2WW3 A;  1JZ3 A;  2WVX A;  1HMW A;  1NS7 A;  3IMH A;  3E1F 1;  1LUR A;  3OBA A;  4BZE A;  4RNL A;  2JKA A;  1NSU A;  1JZ8 A;  1F1S A;  1NSZ A;  3MUY 1;  4BZF A;  1SNZ A;  1MMU A;  3MUZ 1;  2BRW A;  3VDB A;  2BRV X;  3VDA A;  3DYP A;  4BZH A;  1JYW A;  1RWH A;  1DP0 A;  1RWF A;  3VD9 A;  1N7Q A;  1PX3 A;  1JYN A;  1JZ2 A;  1L7J A;  2JKE A;  3OS7 A;  1HM3 A;  1K1W A;  1HN1 A;  1NSR A;  3DCD A;  3IAQ A;  2D73 A;  3I3B A;  1ULV A;  1MN0 A;  2WVX B;  1N7N A;  2CIQ A;  3MV1 1;  1JZ6 A;  3BGA A;  3DEC A;  3VD7 A;  1K1X A;  2Q1F A;  1JZ4 A;  5A1A A;  1EGU A;  1RWA A;  1J0M A;  1LOH A;  1NS4 A;  1N7R A;  1YQ2 A;  2ZXQ A;  5E1Q A;  3CZJ A;  3A24 A;  1W3Y A;  1OJP A;  3T09 A;  3VDC A;  2WZS A;  3OB8 A;  1F4A A;  1C82 A;  3I3E A;  1X1H A;  3DYM A;  3DYO A;  2JKP A;  1Z45 A;  2E22 A;  3J7H A;  2WW2 A;  4DUV A;  3NJV A;  1CB8 A;  1RW9 A;  1HMU A;  2WW1 A;  3Q1N A;  3VD4 A;  1MMX A;  2WW0 A;  1LXK A;  3ECQ A;  1OJO A;  2HTA A;  1JZ5 A;  1NSM A;  1PX4 A;  1F4H A;  3T0B A;  1NSV A;  1JYX A;  3T2O A;  1TXK A;  3K25 A;  1RWC A;  1J0N A;  3T0D A;  2HTB A;  1NKG A;  2WCO A;  1SO0 A;  2CIR A;  1NS8 A;  1LXM A;  2WDA A;  1N7O A;  1JYV A;  1NSS A;  3T0A A;  1JZ7 A;  4DUX A;  1MMZ A;  2XHN A;  3NJX A;  3IAP A;  2X03 A;  2ZQ0 A;  2XSG A;  1MMY A;  2WVY A;  1UG9 A;  4TTG A;  1YGA A;  1LF9 A;  3T2P A;  3WFA A;  1HN0 A;  3VD3 A;  3VD5 A;  1K1Y A;  4BZG A;  3T2Q A;  1F9G A;  1NSX A;  3MWX A;  3MV0 1;  4DUW A;  1OJN A;  2BRP A;  2CIS A;  3NRE A;  1JOV A;  1X1I A;  1NS0 A;  1X1J A;  2E24 A;  3I3D A;  1HM2 A;  1RWG A;  2WVZ A;  4AQ0 A;  1OJM A;  1LF6 A;  1L7K A;  3SEP A;  1I8Q A; 
#chains in the Genus database with same CATH topology
 3LOY A;  2WVX A;  3W7X A;  2JKA A;  1NSZ A;  3MUY 1;  1SNZ A;  1MMU A;  3AMO A;  3S4A A;  1AVL A;  1O7D D;  2YFN A;  3CZN A;  2F1A A;  3HI7 A;  4UFC A;  1RWH A;  1DP0 A;  1PS3 A;  3BLB A;  3BUP A;  2Y73 A;  3WIQ A;  3DX4 A;  3DCD A;  3IAQ A;  1HWW A;  1ULV A;  2WVX B;  1N7N A;  3BGA A;  1K1X A;  1EGU A;  1J0M A;  2BT3 A;  1W5Z A;  3W7U A;  1N7R A;  1YQ2 A;  3AMO B;  3A24 A;  1OJP A;  3RRS A;  1OAC A;  3OB8 A;  2CG1 A;  3X3Y A;  4FNS A;  2CFW A;  2XN1 A;  4FNQ A;  3DX3 A;  3BVW A;  2CFL A;  2D1W A;  5KBP A;  1JZ5 A;  3T0B A;  2FUT A;  1NSV A;  4FNV A;  1W6G A;  3RSY A;  2WGQ A;  1SPU A;  2HTB A;  4BTW A;  3X3Z A;  1UI7 A;  1IVW A;  4K35 A;  2C11 A;  3D4Y A;  3QDE A;  4FNU A;  2Y74 A;  2YX9 A;  2X03 A;  3TY1 A;  2WVY A;  4KTR A;  1YGA A;  3BUI A;  3WFA A;  3QG0 A;  3VD5 A;  1K1Y A;  3A0O A;  3ALA A;  3MV0 1;  2WOH A;  4KTP A;  3LVT A;  5JMF A;  2BRP A;  2EAD A;  1QWN A;  3D3I A;  3NBB A;  2WVZ A;  3MI6 A;  4AQ0 A;  3W7S A;  1WMO A;  1IVV A;  1JRQ A;  3E7J A;  4EV5 A;  2WW3 A;  1HMW A;  3IMH A;  3X41 A;  3E1F 1;  4BTY A;  3OBA A;  4BZE A;  4RNL A;  1SIH A;  1V7X A;  1JZ8 A;  3BUQ A;  2CQS A;  2CWU A;  1TQU A;  1QWU A;  3D52 A;  3DYP A;  1TQS A;  1WMP A;  3W7W A;  3S4D A;  1JZ2 A;  3OS7 A;  1HM3 A;  1K1W A;  1HN1 A;  1NSR A;  3I3B A;  3HII A;  5CA3 A;  2F7P A;  3HIG A;  1JZ6 A;  3DX2 A;  1RKY A;  3VD7 A;  5GW7 A;  2Q1F A;  1RWA A;  1NS4 A;  2ZXQ A;  1QAK A;  2E2V A;  3T09 A;  2WZS A;  2CQT A;  3J7H A;  4DUV A;  1A2V A;  2E2T A;  1QAF A;  1MMX A;  2YFO A;  1RJO A;  3D50 A;  2OOV C;  2EAC A;  4FNR A;  2WYH A;  4NEI A;  1F4H A;  3X3X A;  1HTY A;  2CWV A;  2WOF A;  1JYX A;  1TXK A;  2C10 A;  4KFE A;  1J0N A;  4K3A A;  1NKG A;  3BUB A;  2F1B A;  2WDA A;  1V7W A;  3EJR A;  3SX1 A;  2XHN A;  2ZQ0 A;  1SII A;  3AFJ A;  3EJP A;  4KFD A;  1UI8 A;  4MMH A;  1UG9 A;  1W2Z A;  1LF9 A;  3EJS A;  1N9E A;  4FNP A;  2F7Q A;  4BZG A;  2FYV A;  4DUW A;  1WMN A;  3X42 A;  1QX1 A;  2CIS A;  3DX0 A;  2E24 A;  1HXK A;  1HM2 A;  2ZL8 A;  2OOV A;  1OJM A;  2XN2 A;  1NS2 A;  1W6C A;  1IQX A;  3T08 A;  3WIR A;  1N7P A;  1LUR A;  4OJZ A;  2OQE A;  4BTX A;  1PU4 A;  3CV5 A;  1F1S A;  4BZF A;  3MUZ 1;  3WVF A;  3VDB A;  1W4N A;  3VDA A;  3EJT A;  1N7Q A;  1L7J A;  2JKE A;  3ACS A;  1QAL A;  3S4C A;  1R33 A;  3BVX A;  2D73 A;  4KFF A;  1MN0 A;  3PGB A;  2CIQ A;  3MV1 1;  1TQT A;  3DEC A;  3W7T A;  3MPH A;  1LVN A;  5E1Q A;  3VDC A;  2F7R A;  3ACT A;  3BVT A;  2CFK A;  3K5T A;  2WYI A;  3KII A;  2CFG A;  1X1H A;  1Z45 A;  2E22 A;  1RW9 A;  1HMU A;  3DDG A;  3VD4 A;  2WW0 A;  1LXK A;  1OJO A;  3VSM A;  1IQY A;  3BS6 A;  1AVK A;  3T2O A;  1D6U A;  2F7O A;  3K25 A;  2ALW A;  2CFD A;  2CG0 A;  2OW6 A;  3T0D A;  2WCO A;  1NS8 A;  2E2U A;  3D4Z A;  1N7O A;  4DUX A;  1MMZ A;  1KSI A;  3IAP A;  2XSG A;  1MMY A;  4OK2 A;  1HN0 A;  2W0Q A;  3VD3 A;  2OW7 A;  1TQV A;  3CZS A;  1DYU A;  1F9G A;  1OJN A;  1TU5 A;  3NBJ A;  5JMD A;  1X1J A;  2F18 A;  2OQE C;  3I3D A;  4FNT A;  1D6Y A;  3DX1 A;  3T0U A;  1RWG A;  3N9H A;  1LF6 A;  2XN0 A;  3QFZ A;  1JZ3 A;  1NS7 A;  3BVU A;  1NSU A;  2RDY A;  1W7C A;  2BRW A;  3EJQ A;  3SXX A;  2BRV X;  4BZH A;  1EKM A;  4MMI A;  1JYW A;  1AV4 A;  1RWF A;  3VD9 A;  1PX3 A;  3VSN A;  1JYN A;  3X40 A;  2PNC A;  2EAB A;  1IVX A;  1D6Z A;  2CWT A;  3BLC A;  1JZ4 A;  5A1A A;  1LOH A;  1IU7 A;  2WO0 A;  3CZJ A;  1W3Y A;  3AFL A;  1F4A A;  1C82 A;  3I3E A;  3DYM A;  3DYO A;  2JKP A;  2WW2 A;  3NJV A;  1CB8 A;  2WW1 A;  3WA3 A;  3Q1N A;  1H54 A;  3WA2 X;  3ECQ A;  2HTA A;  3S4B A;  3EJU A;  3E80 A;  1NSM A;  1PX4 A;  4J5T A;  1V7V A;  1US1 A;  1IVU A;  1RWC A;  2FUQ A;  1SO0 A;  2CIR A;  1LXM A;  4EV2 A;  1JYV A;  3D51 A;  1NSS A;  3DDF A;  3KN4 A;  4OK4 A;  3T0A A;  3BVV A;  1JZ7 A;  3NJX A;  1TQW A;  4TTG A;  3T2P A;  1R34 A;  3T2Q A;  3MWX A;  1NSX A;  3BUD A;  3QFY A;  3NRE A;  1JOV A;  1X1I A;  1NS0 A;  2EAE A;  1L7K A;  3SEP A;  1I8Q A; 
#chains in the Genus database with same CATH homology
 1NS2 A;  3T08 A;  1N7P A;  2WW3 A;  1JZ3 A;  2WVX A;  1HMW A;  1NS7 A;  3IMH A;  3E1F 1;  1LUR A;  3OBA A;  4BZE A;  4OJZ A;  4RNL A;  2JKA A;  1NSU A;  1JZ8 A;  1F1S A;  1NSZ A;  3MUY 1;  4BZF A;  1SNZ A;  1MMU A;  3MUZ 1;  2BRW A;  3WVF A;  3VDB A;  2BRV X;  3VDA A;  3DYP A;  4BZH A;  4MMI A;  1JYW A;  1RWH A;  1DP0 A;  1RWF A;  3VD9 A;  1N7Q A;  1PX3 A;  3VSN A;  1JYN A;  1JZ2 A;  1L7J A;  2JKE A;  3OS7 A;  1HM3 A;  1K1W A;  1HN1 A;  1NSR A;  3DCD A;  3IAQ A;  2D73 A;  3I3B A;  1ULV A;  1MN0 A;  2WVX B;  1N7N A;  2CIQ A;  3MV1 1;  1JZ6 A;  3BGA A;  3DEC A;  3VD7 A;  1K1X A;  2Q1F A;  3BLC A;  1JZ4 A;  5A1A A;  1EGU A;  1RWA A;  1J0M A;  1LOH A;  1NS4 A;  1N7R A;  1YQ2 A;  2ZXQ A;  5E1Q A;  3CZJ A;  3A24 A;  1W3Y A;  1OJP A;  3T09 A;  3VDC A;  3AFL A;  2WZS A;  3OB8 A;  1F4A A;  1C82 A;  3I3E A;  1X1H A;  3DYM A;  3DYO A;  2JKP A;  1Z45 A;  2E22 A;  3J7H A;  2WW2 A;  4DUV A;  3NJV A;  1CB8 A;  1RW9 A;  1HMU A;  2WW1 A;  3Q1N A;  3VD4 A;  1MMX A;  2WW0 A;  1LXK A;  3ECQ A;  1OJO A;  2HTA A;  3VSM A;  1JZ5 A;  3E80 A;  1NSM A;  1PX4 A;  4NEI A;  1F4H A;  3T0B A;  3BS6 A;  4J5T A;  2FUT A;  1NSV A;  4FNV A;  1JYX A;  3T2O A;  1TXK A;  3K25 A;  1RWC A;  2FUQ A;  1J0N A;  3T0D A;  2HTB A;  1NKG A;  2WCO A;  1SO0 A;  2CIR A;  1NS8 A;  1LXM A;  2WDA A;  1N7O A;  1JYV A;  1NSS A;  3T0A A;  4OK4 A;  1JZ7 A;  4DUX A;  1MMZ A;  2XHN A;  3NJX A;  3IAP A;  2X03 A;  2ZQ0 A;  2XSG A;  3TY1 A;  1MMY A;  2WVY A;  4MMH A;  1UG9 A;  4OK2 A;  1YGA A;  4TTG A;  1LF9 A;  3T2P A;  3WFA A;  1HN0 A;  3VD3 A;  3VD5 A;  1K1Y A;  4BZG A;  3T2Q A;  3A0O A;  1F9G A;  1NSX A;  3MWX A;  3MV0 1;  4DUW A;  1OJN A;  5JMF A;  2BRP A;  2CIS A;  3NRE A;  1JOV A;  1X1I A;  1NS0 A;  1X1J A;  2E24 A;  5JMD A;  3I3D A;  1HM2 A;  1RWG A;  2WVZ A;  4AQ0 A;  1OJM A;  1LF6 A;  1L7K A;  3SEP A;  1I8Q A;  3E7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...