1NSVA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLNGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 100
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsvA00
3DYMA 1MMYA 1NSMA 1N7OA 1JYXA 1MN0A 1JYVA 1LOHA 2X03A 3VD9A 5A1AA 1HN1A 3NJVA 1JOVA 2WZSA 2WW2A 1RWHA 1PX4A 1NS8A 1OJMA 2CIQA 2XSGA 1X1IA 1JZ8A 1TXKA 1Z45A 4DUVA 1RWAA 1K1WA 2Q1FA 1HM2A 4BZEA 1NS4A 2D73A 3DECA 2WW3A 1MMXA 1LURA 1J0MA 3SEPA 1JZ6A 4DUWA 3IAQA 4DUXA 3IAPA 3K25A 1HN0A 3DYOA 3NJXA 1NS0A 2HTAA 3OBAA 1RW9A 2ZXQA 1LF6A 3T2QA 3IMHA 1J0NA 3MUZ1 1CB8A 2WVXA 2JKPA 1ULVA 3I3BA 3I3DA 1I8QA 2JKEA 3A24A 1NSRA 3MV01 2BRWA 1K1YA 1LXKA 3WFAA 1W3YA 1NSSA 3T08A 3VDAA 3BGAA 2WVXB 2CIRA 1NS2A 1JYNA 1F4HA 1N7RA 3I3EA 2XHNA 4BZGA 1X1JA 1JZ7A 1JZ4A 3T2OA 3T09A 3OS7A 3VD3A 2WW0A 1MMUA 4RNLA 3T0AA 4TTGA 3Q1NA 2CISA 1YGAA 1OJNA 1JZ5A 1JYWA 1K1XA 1SO0A 3OB8A 1X1HA 1N7QA 2HTBA 1C82A 1MMZA 3MWXA 3T0BA 4BZFA 1RWGA 1RWCA 1N7NA 1NSXA 2WVYA 3T2PA 3MV11 3T0DA 2WDAA 2BRVX 2JKAA 1UG9A 5E1QA 3VD5A 1JZ2A 1F1SA 1F9GA 3VD4A 2E22A 1HMWA 3DCDA 1HMUA 1NSVA 3VD7A 2E24A 1NSZA 1N7PA 1DP0A 1NSUA 1HM3A 4BZHA 2ZQ0A 1LF9A 3VDBA 1EGUA 1L7KA 1NKGA 4AQ0A 3J7HA 3VDCA 3NREA 1YQ2A 3MUY1 1OJPA 1L7JA 3ECQA 2WW1A 2WCOA 1F4AA 1SNZA 1OJOA 3E1F1 1LXMA 1RWFA 1PX3A 2BRPA 2WVZA 1JZ3A 3DYPA 3CZJA 1NS7A
chains in the Genus database with same CATH superfamily
2W0QA 3CZNA 3X42A 1DYUA 1JYXA 3DDGA 2X03A 3DX1A 2F18A 1HN1A 2WZSA 2WW2A 4OK4A 4KFDA 1PX4A 1NS8A 3W7WA 3BLBA 3DX2A 1Z45A 3NBJA 4FNQA 3DECA 2CFWA 1SIHA 1TQWA 3SEPA 1JZ6A 1QAFA 4DUWA 1HN0A 1KSIA 4BTXA 3T2QA 2ALWA 2WVXA 1QX1A 1I8QA 2CFGA 3BLCA 4FNSA 1NSRA 1IVWA 3MV01 4K35A 2WGQA 2C10A 1NSSA 2EABA 3VDAA 1NS2A 1EKMA 3X40A 2E2TA 2ZL8A 3VD3A 3X3YA 1HXKA 2EAEA 2WW0A 4RNLA 4FNPA 1YGAA 3CZSA 1OJNA 4J5TA 1JZ5A 3OB8A 1C82A 2FUQA 1MMZA 2CFKA 1W6CA 1NSXA 2WVYA 3EJPA 1A2VA 2BRVX 1R33A 1UG9A 5E1QA 3VD5A 1AVLA 1F1SA 1F9GA 3T0UA 1W7CA 3EJRA 1NSVA 2E24A 4UFCA 2YX9A 3RSYA 1HM3A 1QWUA 1LF9A 4AQ0A 3S4AA 3MUY1 1OJPA 1L7JA 3ECQA 3DX4A 2CQTA 3QFZA 2BRPA 4BTWA 1JRQA 3E80A 4KFFA 1NSMA 3BS6A 4FNUA 3ACSA 3X41A 2OW6A 2CWUA 1SPUA 3E7JA 1RWHA 1IQYA 1OACA 1JZ8A 1TXKA 4DUVA 1RWAA 1W2ZA 2D73A 1MMXA 3KN4A 3VSNA 3KIIA 3AMOB 1PS3A 3DYOA 3D4YA 3NJXA 1NS0A 1RW9A 4FNTA 3RRSA 3S4BA 3A0OA 2PNCA 3IMHA 1J0NA 2C11A 1QWNA 3NBBA 3D52A 2CFLA 3A24A 1K1YA 1LXKA 5CA3A 3T08A 3BGAA 5KBPA 3BVXA 1N7RA 1X1JA 1JZ7A 1JZ4A 3T2OA 3EJQA 4OJZA 4TTGA 3WIRA 1LVNA 3DDFA 1TQUA 4BZFA 1RWCA 3X3ZA 3S4CA 2Y73A 2BT3A 4MMIA 3MV11 3T0DA 2JKAA 1UI7A 3MI6A 1W4NA 3VD4A 2E22A 4FNVA 1HMUA 2RDYA 2EACA 3VD7A 1SIIA 1NSZA 1L7KA 3X3XA 3MPHA 2CWTA 3TY1A 1TQTA 2WYHA 3WVFA 1IVUA 2WW1A 5GW7A 1IVVA 1WMOA 1OJOA 3E1F1 1LXMA 1RWFA 2WVZA 2YFNA 3DYPA 1NS7A 3D4ZA 3DYMA 1MMYA 1N7OA 2XN2A 1LOHA 1QALA 3W7UA 3NJVA 4EV2A 2F7QA 1UI8A 1OJMA 3BUQA 2CIQA 2XSGA 1X1IA 1R34A 1K1WA 1V7XA 4BZEA 1NS4A 1J0MA 3N9HA 3QDEA 2F7OA 4DUXA 3K25A 4K3AA 4KTRA 1V7VA 1TQSA 1IU7A 3OBAA 2HTAA 1LF6A 1D6ZA 2WO0A 2ZXQA 1HWWA 3D50A 1CB8A 2JKPA 1ULVA 2XN0A 2OOVC 3WFAA 1WMNA 3BVUA 1JYNA 3EJUA 2XHNA 3BUPA 2YFOA 3K5TA 4NEIA 1W5ZA 3BVVA 1MMUA 5JMFA 3D51A 3T0AA 2CISA 3ACTA 1SO0A 2F1BA 1N7QA 1O7DD 2HTBA 3T0BA 1RWGA 1N7NA 2D1WA 3HIGA 2EADA 1PU4A 4MMHA 1HMWA 1DP0A 3EJSA 2CG1A 1US1A 2WOFA 3SXXA 2WCOA 1F4AA 1SNZA 1JZ3A 4BTYA 3CZJA 1IVXA 1MN0A 1JYVA 3VD9A 5A1AA 3S4DA 1JOVA 3D3IA 3BUBA 2WYIA 4EV5A 2Q1FA 2F7RA 1H54A 3EJTA 3WA3A 1HM2A 3W7TA 4OK2A 2WW3A 5JMDA 1LURA 1QAKA 2F7PA 3IAQA 3IAPA 3SX1A 2FYVA 1W6GA 2FUTA 3QG0A 3AFLA 3MUZ1 1HTYA 3CV5A 3I3BA 2OQEA 3I3DA 2JKEA 2BRWA 2F1AA 1W3YA 1WMPA 3AMOA 3LOYA 2WVXB 2CIRA 1F4HA 3I3EA 4BZGA 1RJOA 2CQSA 3T09A 3OS7A 2OW7A 2OQEC 2OOVA 3DX0A 3Q1NA 1D6UA 1JYWA 1K1XA 2XN1A 1X1HA 4KTPA 3W7XA 3MWXA 2CFDA 2WOHA 1RKYA 4KFEA 3W7SA 3T2PA 1AV4A 3DX3A 3ALAA 3LVTA 2CG0A 2WDAA 1IQXA 3VSMA 1JZ2A 2E2VA 3BUIA 1D6YA 3WIQA 3HI7A 3WA2X 3DCDA 4FNRA 3HIIA 1N7PA 3PGBA 1TQVA 1N9EA 1NSUA 4BZHA 2ZQ0A 3VDBA 1EGUA 1NKGA 3BVWA 1V7WA 3J7HA 3VDCA 3NREA 1YQ2A 2CWVA 3BUDA 2E2UA 3BVTA 3AFJA 1PX3A 1TU5A 1AVKA 2Y74A 3QFYA
chains in the Genus database with same CATH topology
3DYMA 1MMYA 1NSMA 1N7OA 1JYXA 1MN0A 3BS6A 1JYVA 1LOHA 2X03A 3VD9A 5A1AA 1HN1A 3NJVA 1JOVA 2WZSA 2WW2A 4OK4A 3E7JA 1RWHA 1PX4A 1NS8A 1OJMA 2CIQA 2XSGA 1X1IA 1JZ8A 1TXKA 1Z45A 4DUVA 1RWAA 1K1WA 2Q1FA 1HM2A 4BZEA 1NS4A 2D73A 4OK2A 3DECA 2WW3A 1MMXA 5JMDA 1LURA 1J0MA 3SEPA 1JZ6A 3VSNA 4DUWA 3IAQA 4DUXA 3IAPA 3K25A 1HN0A 3DYOA 3NJXA 1NS0A 2HTAA 2FUTA 1RW9A 2ZXQA 3OBAA 1LF6A 3AFLA 3A0OA 3T2QA 3IMHA 1J0NA 3MUZ1 1CB8A 2WVXA 2JKPA 1ULVA 3I3BA 3I3DA 1I8QA 2JKEA 3A24A 3BLCA 1NSRA 3MV01 2BRWA 1K1YA 1LXKA 3WFAA 1W3YA 1NSSA 3T08A 3VDAA 3BGAA 2WVXB 2CIRA 1NS2A 1JYNA 1F4HA 1N7RA 3I3EA 2XHNA 4BZGA 1X1JA 1JZ7A 1JZ4A 3T2OA 3T09A 3OS7A 3VD3A 4NEIA 2WW0A 1MMUA 4OJZA 4RNLA 5JMFA 3T0AA 4TTGA 3Q1NA 2CISA 1YGAA 1OJNA 4J5TA 1JZ5A 1JYWA 1K1XA 1SO0A 3OB8A 1X1HA 1N7QA 2HTBA 1C82A 2FUQA 1MMZA 3MWXA 3T0BA 4BZFA 1RWGA 1RWCA 1N7NA 1NSXA 2WVYA 4MMIA 3T2PA 3MV11 3T0DA 2WDAA 2BRVX 2JKAA 1UG9A 5E1QA 3VSMA 3VD5A 1JZ2A 1F1SA 1F9GA 4MMHA 3VD4A 2E22A 4FNVA 1HMWA 3DCDA 1HMUA 1NSVA 3VD7A 2E24A 1NSZA 1N7PA 1DP0A 1NSUA 1HM3A 4BZHA 2ZQ0A 1LF9A 3VDBA 1EGUA 1L7KA 1NKGA 4AQ0A 3J7HA 3TY1A 3VDCA 3NREA 1YQ2A 3MUY1 1OJPA 1L7JA 3ECQA 3WVFA 2WW1A 2WCOA 1F4AA 1SNZA 1OJOA 3E1F1 1LXMA 1RWFA 1PX3A 2BRPA 2WVZA 1JZ3A 3DYPA 3CZJA 1NS7A 3E80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYM A;  1MMY A;  1NSM A;  1N7O A;  1JYX A;  1MN0 A;  1JYV A;  1LOH A;  2X03 A;  3VD9 A;  5A1A A;  1HN1 A;  3NJV A;  1JOV A;  2WZS A;  2WW2 A;  1RWH A;  1PX4 A;  1NS8 A;  1OJM A;  2CIQ A;  2XSG A;  1X1I A;  1JZ8 A;  1TXK A;  1Z45 A;  4DUV A;  1RWA A;  1K1W A;  2Q1F A;  1HM2 A;  4BZE A;  1NS4 A;  2D73 A;  3DEC A;  2WW3 A;  1MMX A;  1LUR A;  1J0M A;  3SEP A;  1JZ6 A;  4DUW A;  3IAQ A;  4DUX A;  3IAP A;  3K25 A;  1HN0 A;  3DYO A;  3NJX A;  1NS0 A;  2HTA A;  3OBA A;  1RW9 A;  2ZXQ A;  1LF6 A;  3T2Q A;  3IMH A;  1J0N A;  3MUZ 1;  1CB8 A;  2WVX A;  2JKP A;  1ULV A;  3I3B A;  3I3D A;  1I8Q A;  2JKE A;  3A24 A;  1NSR A;  3MV0 1;  2BRW A;  1K1Y A;  1LXK A;  3WFA A;  1W3Y A;  1NSS A;  3T08 A;  3VDA A;  3BGA A;  2WVX B;  2CIR A;  1NS2 A;  1JYN A;  1F4H A;  1N7R A;  3I3E A;  2XHN A;  4BZG A;  1X1J A;  1JZ7 A;  1JZ4 A;  3T2O A;  3T09 A;  3OS7 A;  3VD3 A;  2WW0 A;  1MMU A;  4RNL A;  3T0A A;  4TTG A;  3Q1N A;  2CIS A;  1YGA A;  1OJN A;  1JZ5 A;  1JYW A;  1K1X A;  1SO0 A;  3OB8 A;  1X1H A;  1N7Q A;  2HTB A;  1C82 A;  1MMZ A;  3MWX A;  3T0B A;  4BZF A;  1RWG A;  1RWC A;  1N7N A;  1NSX A;  2WVY A;  3T2P A;  3MV1 1;  3T0D A;  2WDA A;  2BRV X;  2JKA A;  1UG9 A;  5E1Q A;  3VD5 A;  1JZ2 A;  1F1S A;  1F9G A;  3VD4 A;  2E22 A;  1HMW A;  3DCD A;  1HMU A;  1NSV A;  3VD7 A;  2E24 A;  1NSZ A;  1N7P A;  1DP0 A;  1NSU A;  1HM3 A;  4BZH A;  2ZQ0 A;  1LF9 A;  3VDB A;  1EGU A;  1L7K A;  1NKG A;  4AQ0 A;  3J7H A;  3VDC A;  3NRE A;  1YQ2 A;  3MUY 1;  1OJP A;  1L7J A;  3ECQ A;  2WW1 A;  2WCO A;  1F4A A;  1SNZ A;  1OJO A;  3E1F 1;  1LXM A;  1RWF A;  1PX3 A;  2BRP A;  2WVZ A;  1JZ3 A;  3DYP A;  3CZJ A;  1NS7 A; 
#chains in the Genus database with same CATH topology
 2W0Q A;  3CZN A;  3X42 A;  1DYU A;  1JYX A;  3DDG A;  2X03 A;  3DX1 A;  2F18 A;  1HN1 A;  2WZS A;  2WW2 A;  4OK4 A;  4KFD A;  1PX4 A;  1NS8 A;  3W7W A;  3BLB A;  3DX2 A;  1Z45 A;  3NBJ A;  4FNQ A;  3DEC A;  2CFW A;  1SIH A;  1TQW A;  3SEP A;  1JZ6 A;  1QAF A;  4DUW A;  1HN0 A;  1KSI A;  4BTX A;  3T2Q A;  2ALW A;  2WVX A;  1QX1 A;  1I8Q A;  2CFG A;  3BLC A;  4FNS A;  1NSR A;  1IVW A;  3MV0 1;  4K35 A;  2WGQ A;  2C10 A;  1NSS A;  2EAB A;  3VDA A;  1NS2 A;  1EKM A;  3X40 A;  2E2T A;  2ZL8 A;  3VD3 A;  3X3Y A;  1HXK A;  2EAE A;  2WW0 A;  4RNL A;  4FNP A;  1YGA A;  3CZS A;  1OJN A;  4J5T A;  1JZ5 A;  3OB8 A;  1C82 A;  2FUQ A;  1MMZ A;  2CFK A;  1W6C A;  1NSX A;  2WVY A;  3EJP A;  1A2V A;  2BRV X;  1R33 A;  1UG9 A;  5E1Q A;  3VD5 A;  1AVL A;  1F1S A;  1F9G A;  3T0U A;  1W7C A;  3EJR A;  1NSV A;  2E24 A;  4UFC A;  2YX9 A;  3RSY A;  1HM3 A;  1QWU A;  1LF9 A;  4AQ0 A;  3S4A A;  3MUY 1;  1OJP A;  1L7J A;  3ECQ A;  3DX4 A;  2CQT A;  3QFZ A;  2BRP A;  4BTW A;  1JRQ A;  3E80 A;  4KFF A;  1NSM A;  3BS6 A;  4FNU A;  3ACS A;  3X41 A;  2OW6 A;  2CWU A;  1SPU A;  3E7J A;  1RWH A;  1IQY A;  1OAC A;  1JZ8 A;  1TXK A;  4DUV A;  1RWA A;  1W2Z A;  2D73 A;  1MMX A;  3KN4 A;  3VSN A;  3KII A;  3AMO B;  1PS3 A;  3DYO A;  3D4Y A;  3NJX A;  1NS0 A;  1RW9 A;  4FNT A;  3RRS A;  3S4B A;  3A0O A;  2PNC A;  3IMH A;  1J0N A;  2C11 A;  1QWN A;  3NBB A;  3D52 A;  2CFL A;  3A24 A;  1K1Y A;  1LXK A;  5CA3 A;  3T08 A;  3BGA A;  5KBP A;  3BVX A;  1N7R A;  1X1J A;  1JZ7 A;  1JZ4 A;  3T2O A;  3EJQ A;  4OJZ A;  4TTG A;  3WIR A;  1LVN A;  3DDF A;  1TQU A;  4BZF A;  1RWC A;  3X3Z A;  3S4C A;  2Y73 A;  2BT3 A;  4MMI A;  3MV1 1;  3T0D A;  2JKA A;  1UI7 A;  3MI6 A;  1W4N A;  3VD4 A;  2E22 A;  4FNV A;  1HMU A;  2RDY A;  2EAC A;  3VD7 A;  1SII A;  1NSZ A;  1L7K A;  3X3X A;  3MPH A;  2CWT A;  3TY1 A;  1TQT A;  2WYH A;  3WVF A;  1IVU A;  2WW1 A;  5GW7 A;  1IVV A;  1WMO A;  1OJO A;  3E1F 1;  1LXM A;  1RWF A;  2WVZ A;  2YFN A;  3DYP A;  1NS7 A;  3D4Z A;  3DYM A;  1MMY A;  1N7O A;  2XN2 A;  1LOH A;  1QAL A;  3W7U A;  3NJV A;  4EV2 A;  2F7Q A;  1UI8 A;  1OJM A;  3BUQ A;  2CIQ A;  2XSG A;  1X1I A;  1R34 A;  1K1W A;  1V7X A;  4BZE A;  1NS4 A;  1J0M A;  3N9H A;  3QDE A;  2F7O A;  4DUX A;  3K25 A;  4K3A A;  4KTR A;  1V7V A;  1TQS A;  1IU7 A;  3OBA A;  2HTA A;  1LF6 A;  1D6Z A;  2WO0 A;  2ZXQ A;  1HWW A;  3D50 A;  1CB8 A;  2JKP A;  1ULV A;  2XN0 A;  2OOV C;  3WFA A;  1WMN A;  3BVU A;  1JYN A;  3EJU A;  2XHN A;  3BUP A;  2YFO A;  3K5T A;  4NEI A;  1W5Z A;  3BVV A;  1MMU A;  5JMF A;  3D51 A;  3T0A A;  2CIS A;  3ACT A;  1SO0 A;  2F1B A;  1N7Q A;  1O7D D;  2HTB A;  3T0B A;  1RWG A;  1N7N A;  2D1W A;  3HIG A;  2EAD A;  1PU4 A;  4MMH A;  1HMW A;  1DP0 A;  3EJS A;  2CG1 A;  1US1 A;  2WOF A;  3SXX A;  2WCO A;  1F4A A;  1SNZ A;  1JZ3 A;  4BTY A;  3CZJ A;  1IVX A;  1MN0 A;  1JYV A;  3VD9 A;  5A1A A;  3S4D A;  1JOV A;  3D3I A;  3BUB A;  2WYI A;  4EV5 A;  2Q1F A;  2F7R A;  1H54 A;  3EJT A;  3WA3 A;  1HM2 A;  3W7T A;  4OK2 A;  2WW3 A;  5JMD A;  1LUR A;  1QAK A;  2F7P A;  3IAQ A;  3IAP A;  3SX1 A;  2FYV A;  1W6G A;  2FUT A;  3QG0 A;  3AFL A;  3MUZ 1;  1HTY A;  3CV5 A;  3I3B A;  2OQE A;  3I3D A;  2JKE A;  2BRW A;  2F1A A;  1W3Y A;  1WMP A;  3AMO A;  3LOY A;  2WVX B;  2CIR A;  1F4H A;  3I3E A;  4BZG A;  1RJO A;  2CQS A;  3T09 A;  3OS7 A;  2OW7 A;  2OQE C;  2OOV A;  3DX0 A;  3Q1N A;  1D6U A;  1JYW A;  1K1X A;  2XN1 A;  1X1H A;  4KTP A;  3W7X A;  3MWX A;  2CFD A;  2WOH A;  1RKY A;  4KFE A;  3W7S A;  3T2P A;  1AV4 A;  3DX3 A;  3ALA A;  3LVT A;  2CG0 A;  2WDA A;  1IQX A;  3VSM A;  1JZ2 A;  2E2V A;  3BUI A;  1D6Y A;  3WIQ A;  3HI7 A;  3WA2 X;  3DCD A;  4FNR A;  3HII A;  1N7P A;  3PGB A;  1TQV A;  1N9E A;  1NSU A;  4BZH A;  2ZQ0 A;  3VDB A;  1EGU A;  1NKG A;  3BVW A;  1V7W A;  3J7H A;  3VDC A;  3NRE A;  1YQ2 A;  2CWV A;  3BUD A;  2E2U A;  3BVT A;  3AFJ A;  1PX3 A;  1TU5 A;  1AVK A;  2Y74 A;  3QFY A; 
#chains in the Genus database with same CATH homology
 3DYM A;  1MMY A;  1NSM A;  1N7O A;  1JYX A;  1MN0 A;  3BS6 A;  1JYV A;  1LOH A;  2X03 A;  3VD9 A;  5A1A A;  1HN1 A;  3NJV A;  1JOV A;  2WZS A;  2WW2 A;  4OK4 A;  3E7J A;  1RWH A;  1PX4 A;  1NS8 A;  1OJM A;  2CIQ A;  2XSG A;  1X1I A;  1JZ8 A;  1TXK A;  1Z45 A;  4DUV A;  1RWA A;  1K1W A;  2Q1F A;  1HM2 A;  4BZE A;  1NS4 A;  2D73 A;  4OK2 A;  3DEC A;  2WW3 A;  1MMX A;  5JMD A;  1LUR A;  1J0M A;  3SEP A;  1JZ6 A;  3VSN A;  4DUW A;  3IAQ A;  4DUX A;  3IAP A;  3K25 A;  1HN0 A;  3DYO A;  3NJX A;  1NS0 A;  2HTA A;  2FUT A;  1RW9 A;  2ZXQ A;  3OBA A;  1LF6 A;  3AFL A;  3A0O A;  3T2Q A;  3IMH A;  1J0N A;  3MUZ 1;  1CB8 A;  2WVX A;  2JKP A;  1ULV A;  3I3B A;  3I3D A;  1I8Q A;  2JKE A;  3A24 A;  3BLC A;  1NSR A;  3MV0 1;  2BRW A;  1K1Y A;  1LXK A;  3WFA A;  1W3Y A;  1NSS A;  3T08 A;  3VDA A;  3BGA A;  2WVX B;  2CIR A;  1NS2 A;  1JYN A;  1F4H A;  1N7R A;  3I3E A;  2XHN A;  4BZG A;  1X1J A;  1JZ7 A;  1JZ4 A;  3T2O A;  3T09 A;  3OS7 A;  3VD3 A;  4NEI A;  2WW0 A;  1MMU A;  4OJZ A;  4RNL A;  5JMF A;  3T0A A;  4TTG A;  3Q1N A;  2CIS A;  1YGA A;  1OJN A;  4J5T A;  1JZ5 A;  1JYW A;  1K1X A;  1SO0 A;  3OB8 A;  1X1H A;  1N7Q A;  2HTB A;  1C82 A;  2FUQ A;  1MMZ A;  3MWX A;  3T0B A;  4BZF A;  1RWG A;  1RWC A;  1N7N A;  1NSX A;  2WVY A;  4MMI A;  3T2P A;  3MV1 1;  3T0D A;  2WDA A;  2BRV X;  2JKA A;  1UG9 A;  5E1Q A;  3VSM A;  3VD5 A;  1JZ2 A;  1F1S A;  1F9G A;  4MMH A;  3VD4 A;  2E22 A;  4FNV A;  1HMW A;  3DCD A;  1HMU A;  1NSV A;  3VD7 A;  2E24 A;  1NSZ A;  1N7P A;  1DP0 A;  1NSU A;  1HM3 A;  4BZH A;  2ZQ0 A;  1LF9 A;  3VDB A;  1EGU A;  1L7K A;  1NKG A;  4AQ0 A;  3J7H A;  3TY1 A;  3VDC A;  3NRE A;  1YQ2 A;  3MUY 1;  1OJP A;  1L7J A;  3ECQ A;  3WVF A;  2WW1 A;  2WCO A;  1F4A A;  1SNZ A;  1OJO A;  3E1F 1;  1LXM A;  1RWF A;  1PX3 A;  2BRP A;  2WVZ A;  1JZ3 A;  3DYP A;  3CZJ A;  1NS7 A;  3E80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...