1NSVA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLNGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 100
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsvA00
1LURA 3I3EA 1LF6A 1N7NA 3I3BA 1F4AA 1OJMA 2WZSA 5E1QA 3ECQA 1DP0A 2WVXA 2WW0A 3K25A 1X1HA 3WFAA 1HN0A 2ZXQA 1MMXA 3VDAA 1MMUA 3T0BA 1YQ2A 3VDBA 1J0NA 3IAPA 3BGAA 2WW1A 3DECA 1JOVA 3VD4A 1HMUA 1EGUA 1N7QA 1W3YA 1SO0A 2CIRA 3VD7A 2WW3A 3MV11 1X1JA 3SEPA 1N7OA 3E1F1 3T2QA 1JYWA 1NS4A 1UG9A 2JKAA 3T09A 3MUZ1 2HTAA 3OB8A 2JKEA 2XHNA 3VDCA 1JZ7A 3J7HA 1NS7A 1NSRA 1JZ3A 2ZQ0A 3MWXA 2BRWA 1MMYA 3VD5A 1MMZA 3T0DA 1Z45A 1NS8A 1NSSA 2CISA 3IAQA 1RWHA 3T2PA 4TTGA 3DYPA 1LF9A 3Q1NA 3NREA 3OS7A 3I3DA 1OJNA 2Q1FA 1F1SA 2WW2A 4BZEA 3T2OA 3DCDA 1LOHA 4BZHA 3IMHA 2WDAA 1NS2A 1CB8A 1RWCA 1JZ6A 1MN0A 3T0AA 1I8QA 1K1YA 2E22A 4AQ0A 2WVZA 1HN1A 3MV01 1JZ8A 1PX4A 1HM2A 1K1WA 4BZFA 1JZ4A 3NJXA 1F4HA 2JKPA 4DUVA 1NSUA 1K1XA 3CZJA 3OBAA 1N7RA 2BRPA 1J0MA 1C82A 1N7PA 1X1IA 1JYXA 3DYOA 3T08A 1NS0A 1JYVA 1HM3A 1NSXA 4BZGA 4DUWA 4RNLA 2WVXB 2X03A 1RW9A 1RWFA 1F9GA 1LXKA 5A1AA 2WCOA 1JZ5A 1NSVA 1ULVA 3VD9A 3MUY1 3NJVA 1NSZA 1OJPA 1SNZA 1OJOA 1PX3A 1TXKA 1YGAA 3VD3A 1RWGA 4DUXA 2BRVX 2CIQA 1RWAA 1HMWA 1L7KA 3DYMA 1JYNA 1JZ2A 1NSMA 2D73A 2XSGA 1L7JA 2HTBA 1NKGA 2E24A 2WVYA 3A24A 1LXMA
chains in the Genus database with same CATH superfamily
2CG0A 2FUTA 2W0QA 2WOFA 1F4AA 4KFEA 2CWTA 2EAEA 3K25A 2WVXA 1X1HA 1HN0A 3DDFA 3RSYA 3VDBA 1J0NA 3IAPA 2WW1A 2FYVA 2YFOA 3BVXA 1HMUA 4BTWA 1W3YA 3DX4A 4MMIA 3MV11 3WA3A 2CWUA 3WA2X 1N7OA 3E1F1 1NS4A 1HTYA 3T09A 2HTAA 3WIRA 3AFJA 1JZ7A 1NS7A 1JZ3A 3MWXA 4UFCA 1TQUA 3T0DA 2CFDA 3IAQA 3DYPA 3CZSA 3NBJA 2YFNA 3SXXA 1OJNA 2Q1FA 2WW2A 1JRQA 2EABA 3T2OA 3RRSA 1WMPA 1CB8A 1RWCA 1W5ZA 4KFDA 3WIQA 1IVXA 2ZL8A 1I8QA 1K1YA 3MV01 2XN0A 1K1WA 3EJUA 4BZFA 1JZ4A 3DX1A 3PGBA 2JKPA 4DUVA 2D1WA 2BRPA 1C82A 1N7PA 3T08A 1NS0A 3S4CA 3QFZA 1JYVA 1HM3A 4BZGA 3MI6A 3AMOB 1RWFA 2PNCA 1V7VA 1LXKA 2WCOA 1JZ5A 2OQEC 4KTPA 2OOVC 3D52A 1EKMA 4DUXA 1L7KA 1JZ2A 1NSMA 1TQTA 2CWVA 3BUPA 1NKGA 3HI7A 3A24A 2E2VA 1KSIA 3QG0A 5GW7A 3MPHA 3EJSA 3QFYA 4KTRA 3W7TA 3BGAA 1JOVA 3EJTA 3EJRA 4FNTA 1N7QA 4MMHA 1A2VA 2CFLA 3S4DA 5CA3A 2F7OA 1UG9A 3CV5A 2JKEA 3VDCA 3J7HA 2WGQA 2ZQ0A 2WYIA 1RKYA 2F7QA 2CISA 3BVTA 3WVFA 4BZEA 3DCDA 1LOHA 4OK2A 4BZHA 1NS2A 2C10A 2ALWA 3VSMA 1MN0A 2E22A 4J5TA 2WVZA 2F1BA 3D51A 3X40A 3E80A 3HIGA 3E7JA 4K3AA 2RDYA 1N7RA 2WO0A 3CZNA 1J0MA 1X1IA 4FNRA 1D6ZA 3W7SA 1R34A 2OW6A 5A1AA 3TY1A 1W6GA 3VD9A 3MUY1 1AVLA 1DYUA 1WMNA 2E2TA 1OJPA 1SNZA 1TXKA 3EJQA 3AFLA 2D73A 2XSGA 1L7JA 1QWNA 3BUDA 1QALA 1TQVA 3N9HA 4FNPA 1UI8A 4FNQA 1LURA 3I3EA 1W4NA 1LF6A 1OJMA 1RJOA 5E1QA 2EADA 2ZXQA 2YX9A 3AMOA 1MMUA 3BVUA 3SX1A 3VD4A 1EGUA 2OW7A 1SO0A 2OQEA 1TQWA 2CIRA 3VD7A 2WW3A 1X1JA 3W7XA 3K5TA 3SEPA 2OOVA 1HXKA 2F18A 3BUQA 3MUZ1 3OB8A 3LOYA 1AV4A 3KN4A 2BRWA 3VD5A 1MMZA 1W6CA 1Z45A 1NSSA 3X41A 1UI7A 3BLBA 1RWHA 2F1AA 4TTGA 1LF9A 3OS7A 3S4BA 2FUQA 3D4YA 1SIHA 3IMHA 3BUIA 1H54A 1JZ6A 1IVUA 1IVWA 2CFGA 1HN1A 1HM2A 4NEIA 3QDEA 1K1XA 2WYHA 3OBAA 3A0OA 2CG1A 4FNSA 1NSXA 2XN2A 4DUWA 3W7UA 4RNLA 2WVXB 2X03A 1RW9A 3X3XA 1SIIA 1F9GA 4K35A 3ALAA 2XN1A 2CQTA 1ULVA 4FNVA 3NJVA 1NSZA 5JMFA 1OJOA 3VD3A 2BT3A 1RWAA 1N9EA 1HMWA 4OK4A 3DYMA 3HIIA 1US1A 2HTBA 3X3ZA 2WVYA 1HWWA 3BLCA 1R33A 1N7NA 1IQXA 3I3BA 2WZSA 3ECQA 1DP0A 3ACTA 2WW0A 3W7WA 3WFAA 1MMXA 3VDAA 4EV2A 2CFKA 3T0BA 1PU4A 1YQ2A 1QAFA 3DECA 3D3IA 1O7DD 4KFFA 1D6YA 1W7CA 3T2QA 3BUBA 1JYWA 5JMDA 3LVTA 2JKAA 3KIIA 3T0UA 2XHNA 3X3YA 1OACA 1NSRA 2Y74A 1MMYA 3D50A 1NS8A 1TQSA 1PS3A 3BVVA 4EV5A 3T2PA 1V7WA 3S4AA 3D4ZA 3Q1NA 3NREA 3I3DA 1F1SA 1QAKA 2WDAA 1V7XA 3BVWA 1IVVA 3EJPA 3DX3A 3T0AA 2Y73A 4AQ0A 1JZ8A 1PX4A 4FNUA 3NJXA 1QWUA 2WOHA 1WMOA 1SPUA 3BS6A 1F4HA 3VSNA 3DX0A 2F7RA 2C11A 1NSUA 3CZJA 1JYXA 3DYOA 1QX1A 2E2UA 1TU5A 2CQSA 3X42A 2F7PA 4OJZA 1AVKA 1IQYA 1IU7A 3ACSA 3DDGA 2EACA 1NSVA 4BTXA 1W2ZA 2CFWA 1PX3A 1YGAA 1RWGA 2BRVX 2CIQA 1LVNA 1JYNA 3NBBA 4BTYA 3DX2A 2E24A 1D6UA 1LXMA 5KBPA
chains in the Genus database with same CATH topology
3BLCA 2FUTA 1LURA 3I3EA 1LF6A 1N7NA 3I3BA 1F4AA 1OJMA 2WZSA 5E1QA 3ECQA 1DP0A 2WVXA 2WW0A 3K25A 1X1HA 3WFAA 1HN0A 2ZXQA 1MMXA 3VDAA 1MMUA 3T0BA 1YQ2A 3VDBA 1J0NA 3IAPA 3BGAA 2WW1A 3DECA 1JOVA 3VD4A 1HMUA 1EGUA 1N7QA 1W3YA 1SO0A 4MMHA 4MMIA 2CIRA 3VD7A 2WW3A 3MV11 1X1JA 3SEPA 1N7OA 3E1F1 3T2QA 1JYWA 1NS4A 5JMDA 1UG9A 2JKAA 3T09A 3MUZ1 2HTAA 3OB8A 2JKEA 2XHNA 3VDCA 1JZ7A 3J7HA 1NS7A 1NSRA 1JZ3A 2ZQ0A 3MWXA 2BRWA 1MMYA 3VD5A 1MMZA 3T0DA 1Z45A 1NS8A 1NSSA 2CISA 3IAQA 1RWHA 3T2PA 4TTGA 3DYPA 1LF9A 3Q1NA 3WVFA 3NREA 3OS7A 3I3DA 1OJNA 2FUQA 2Q1FA 1F1SA 2WW2A 4BZEA 3T2OA 3DCDA 1LOHA 4OK2A 4BZHA 3IMHA 2WDAA 1NS2A 1CB8A 1RWCA 1JZ6A 3VSMA 1MN0A 3T0AA 1I8QA 1K1YA 2E22A 4J5TA 4AQ0A 2WVZA 1HN1A 3MV01 1JZ8A 1PX4A 1HM2A 1K1WA 4NEIA 4BZFA 1JZ4A 3NJXA 3BS6A 1F4HA 3VSNA 2JKPA 4DUVA 3E80A 1NSUA 3E7JA 1K1XA 3CZJA 3OBAA 1N7RA 2BRPA 1J0MA 1C82A 1N7PA 1X1IA 1JYXA 3DYOA 3T08A 1NS0A 3A0OA 1JYVA 1HM3A 1NSXA 4BZGA 4DUWA 4RNLA 2WVXB 4OJZA 1RW9A 2X03A 1RWFA 1F9GA 1LXKA 5A1AA 2WCOA 1JZ5A 3TY1A 1NSVA 1ULVA 3VD9A 3MUY1 4FNVA 3NJVA 1NSZA 5JMFA 1OJPA 1SNZA 1OJOA 1PX3A 1TXKA 1YGAA 3VD3A 1RWGA 4DUXA 2BRVX 2CIQA 1RWAA 4OK4A 1HMWA 3AFLA 1L7KA 3DYMA 1JYNA 1JZ2A 1NSMA 2D73A 2XSGA 1L7JA 2HTBA 1NKGA 2E24A 2WVYA 3A24A 1LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUR A;  3I3E A;  1LF6 A;  1N7N A;  3I3B A;  1F4A A;  1OJM A;  2WZS A;  5E1Q A;  3ECQ A;  1DP0 A;  2WVX A;  2WW0 A;  3K25 A;  1X1H A;  3WFA A;  1HN0 A;  2ZXQ A;  1MMX A;  3VDA A;  1MMU A;  3T0B A;  1YQ2 A;  3VDB A;  1J0N A;  3IAP A;  3BGA A;  2WW1 A;  3DEC A;  1JOV A;  3VD4 A;  1HMU A;  1EGU A;  1N7Q A;  1W3Y A;  1SO0 A;  2CIR A;  3VD7 A;  2WW3 A;  3MV1 1;  1X1J A;  3SEP A;  1N7O A;  3E1F 1;  3T2Q A;  1JYW A;  1NS4 A;  1UG9 A;  2JKA A;  3T09 A;  3MUZ 1;  2HTA A;  3OB8 A;  2JKE A;  2XHN A;  3VDC A;  1JZ7 A;  3J7H A;  1NS7 A;  1NSR A;  1JZ3 A;  2ZQ0 A;  3MWX A;  2BRW A;  1MMY A;  3VD5 A;  1MMZ A;  3T0D A;  1Z45 A;  1NS8 A;  1NSS A;  2CIS A;  3IAQ A;  1RWH A;  3T2P A;  4TTG A;  3DYP A;  1LF9 A;  3Q1N A;  3NRE A;  3OS7 A;  3I3D A;  1OJN A;  2Q1F A;  1F1S A;  2WW2 A;  4BZE A;  3T2O A;  3DCD A;  1LOH A;  4BZH A;  3IMH A;  2WDA A;  1NS2 A;  1CB8 A;  1RWC A;  1JZ6 A;  1MN0 A;  3T0A A;  1I8Q A;  1K1Y A;  2E22 A;  4AQ0 A;  2WVZ A;  1HN1 A;  3MV0 1;  1JZ8 A;  1PX4 A;  1HM2 A;  1K1W A;  4BZF A;  1JZ4 A;  3NJX A;  1F4H A;  2JKP A;  4DUV A;  1NSU A;  1K1X A;  3CZJ A;  3OBA A;  1N7R A;  2BRP A;  1J0M A;  1C82 A;  1N7P A;  1X1I A;  1JYX A;  3DYO A;  3T08 A;  1NS0 A;  1JYV A;  1HM3 A;  1NSX A;  4BZG A;  4DUW A;  4RNL A;  2WVX B;  2X03 A;  1RW9 A;  1RWF A;  1F9G A;  1LXK A;  5A1A A;  2WCO A;  1JZ5 A;  1NSV A;  1ULV A;  3VD9 A;  3MUY 1;  3NJV A;  1NSZ A;  1OJP A;  1SNZ A;  1OJO A;  1PX3 A;  1TXK A;  1YGA A;  3VD3 A;  1RWG A;  4DUX A;  2BRV X;  2CIQ A;  1RWA A;  1HMW A;  1L7K A;  3DYM A;  1JYN A;  1JZ2 A;  1NSM A;  2D73 A;  2XSG A;  1L7J A;  2HTB A;  1NKG A;  2E24 A;  2WVY A;  3A24 A;  1LXM A; 
#chains in the Genus database with same CATH topology
 2CG0 A;  2FUT A;  2W0Q A;  2WOF A;  1F4A A;  4KFE A;  2CWT A;  2EAE A;  3K25 A;  2WVX A;  1X1H A;  1HN0 A;  3DDF A;  3RSY A;  3VDB A;  1J0N A;  3IAP A;  2WW1 A;  2FYV A;  2YFO A;  3BVX A;  1HMU A;  4BTW A;  1W3Y A;  3DX4 A;  4MMI A;  3MV1 1;  3WA3 A;  2CWU A;  3WA2 X;  1N7O A;  3E1F 1;  1NS4 A;  1HTY A;  3T09 A;  2HTA A;  3WIR A;  3AFJ A;  1JZ7 A;  1NS7 A;  1JZ3 A;  3MWX A;  4UFC A;  1TQU A;  3T0D A;  2CFD A;  3IAQ A;  3DYP A;  3CZS A;  3NBJ A;  2YFN A;  3SXX A;  1OJN A;  2Q1F A;  2WW2 A;  1JRQ A;  2EAB A;  3T2O A;  3RRS A;  1WMP A;  1CB8 A;  1RWC A;  1W5Z A;  4KFD A;  3WIQ A;  1IVX A;  2ZL8 A;  1I8Q A;  1K1Y A;  3MV0 1;  2XN0 A;  1K1W A;  3EJU A;  4BZF A;  1JZ4 A;  3DX1 A;  3PGB A;  2JKP A;  4DUV A;  2D1W A;  2BRP A;  1C82 A;  1N7P A;  3T08 A;  1NS0 A;  3S4C A;  3QFZ A;  1JYV A;  1HM3 A;  4BZG A;  3MI6 A;  3AMO B;  1RWF A;  2PNC A;  1V7V A;  1LXK A;  2WCO A;  1JZ5 A;  2OQE C;  4KTP A;  2OOV C;  3D52 A;  1EKM A;  4DUX A;  1L7K A;  1JZ2 A;  1NSM A;  1TQT A;  2CWV A;  3BUP A;  1NKG A;  3HI7 A;  3A24 A;  2E2V A;  1KSI A;  3QG0 A;  5GW7 A;  3MPH A;  3EJS A;  3QFY A;  4KTR A;  3W7T A;  3BGA A;  1JOV A;  3EJT A;  3EJR A;  4FNT A;  1N7Q A;  4MMH A;  1A2V A;  2CFL A;  3S4D A;  5CA3 A;  2F7O A;  1UG9 A;  3CV5 A;  2JKE A;  3VDC A;  3J7H A;  2WGQ A;  2ZQ0 A;  2WYI A;  1RKY A;  2F7Q A;  2CIS A;  3BVT A;  3WVF A;  4BZE A;  3DCD A;  1LOH A;  4OK2 A;  4BZH A;  1NS2 A;  2C10 A;  2ALW A;  3VSM A;  1MN0 A;  2E22 A;  4J5T A;  2WVZ A;  2F1B A;  3D51 A;  3X40 A;  3E80 A;  3HIG A;  3E7J A;  4K3A A;  2RDY A;  1N7R A;  2WO0 A;  3CZN A;  1J0M A;  1X1I A;  4FNR A;  1D6Z A;  3W7S A;  1R34 A;  2OW6 A;  5A1A A;  3TY1 A;  1W6G A;  3VD9 A;  3MUY 1;  1AVL A;  1DYU A;  1WMN A;  2E2T A;  1OJP A;  1SNZ A;  1TXK A;  3EJQ A;  3AFL A;  2D73 A;  2XSG A;  1L7J A;  1QWN A;  3BUD A;  1QAL A;  1TQV A;  3N9H A;  4FNP A;  1UI8 A;  4FNQ A;  1LUR A;  3I3E A;  1W4N A;  1LF6 A;  1OJM A;  1RJO A;  5E1Q A;  2EAD A;  2ZXQ A;  2YX9 A;  3AMO A;  1MMU A;  3BVU A;  3SX1 A;  3VD4 A;  1EGU A;  2OW7 A;  1SO0 A;  2OQE A;  1TQW A;  2CIR A;  3VD7 A;  2WW3 A;  1X1J A;  3W7X A;  3K5T A;  3SEP A;  2OOV A;  1HXK A;  2F18 A;  3BUQ A;  3MUZ 1;  3OB8 A;  3LOY A;  1AV4 A;  3KN4 A;  2BRW A;  3VD5 A;  1MMZ A;  1W6C A;  1Z45 A;  1NSS A;  3X41 A;  1UI7 A;  3BLB A;  1RWH A;  2F1A A;  4TTG A;  1LF9 A;  3OS7 A;  3S4B A;  2FUQ A;  3D4Y A;  1SIH A;  3IMH A;  3BUI A;  1H54 A;  1JZ6 A;  1IVU A;  1IVW A;  2CFG A;  1HN1 A;  1HM2 A;  4NEI A;  3QDE A;  1K1X A;  2WYH A;  3OBA A;  3A0O A;  2CG1 A;  4FNS A;  1NSX A;  2XN2 A;  4DUW A;  3W7U A;  4RNL A;  2WVX B;  2X03 A;  1RW9 A;  3X3X A;  1SII A;  1F9G A;  4K35 A;  3ALA A;  2XN1 A;  2CQT A;  1ULV A;  4FNV A;  3NJV A;  1NSZ A;  5JMF A;  1OJO A;  3VD3 A;  2BT3 A;  1RWA A;  1N9E A;  1HMW A;  4OK4 A;  3DYM A;  3HII A;  1US1 A;  2HTB A;  3X3Z A;  2WVY A;  1HWW A;  3BLC A;  1R33 A;  1N7N A;  1IQX A;  3I3B A;  2WZS A;  3ECQ A;  1DP0 A;  3ACT A;  2WW0 A;  3W7W A;  3WFA A;  1MMX A;  3VDA A;  4EV2 A;  2CFK A;  3T0B A;  1PU4 A;  1YQ2 A;  1QAF A;  3DEC A;  3D3I A;  1O7D D;  4KFF A;  1D6Y A;  1W7C A;  3T2Q A;  3BUB A;  1JYW A;  5JMD A;  3LVT A;  2JKA A;  3KII A;  3T0U A;  2XHN A;  3X3Y A;  1OAC A;  1NSR A;  2Y74 A;  1MMY A;  3D50 A;  1NS8 A;  1TQS A;  1PS3 A;  3BVV A;  4EV5 A;  3T2P A;  1V7W A;  3S4A A;  3D4Z A;  3Q1N A;  3NRE A;  3I3D A;  1F1S A;  1QAK A;  2WDA A;  1V7X A;  3BVW A;  1IVV A;  3EJP A;  3DX3 A;  3T0A A;  2Y73 A;  4AQ0 A;  1JZ8 A;  1PX4 A;  4FNU A;  3NJX A;  1QWU A;  2WOH A;  1WMO A;  1SPU A;  3BS6 A;  1F4H A;  3VSN A;  3DX0 A;  2F7R A;  2C11 A;  1NSU A;  3CZJ A;  1JYX A;  3DYO A;  1QX1 A;  2E2U A;  1TU5 A;  2CQS A;  3X42 A;  2F7P A;  4OJZ A;  1AVK A;  1IQY A;  1IU7 A;  3ACS A;  3DDG A;  2EAC A;  1NSV A;  4BTX A;  1W2Z A;  2CFW A;  1PX3 A;  1YGA A;  1RWG A;  2BRV X;  2CIQ A;  1LVN A;  1JYN A;  3NBB A;  4BTY A;  3DX2 A;  2E24 A;  1D6U A;  1LXM A;  5KBP A; 
#chains in the Genus database with same CATH homology
 3BLC A;  2FUT A;  1LUR A;  3I3E A;  1LF6 A;  1N7N A;  3I3B A;  1F4A A;  1OJM A;  2WZS A;  5E1Q A;  3ECQ A;  1DP0 A;  2WVX A;  2WW0 A;  3K25 A;  1X1H A;  3WFA A;  1HN0 A;  2ZXQ A;  1MMX A;  3VDA A;  1MMU A;  3T0B A;  1YQ2 A;  3VDB A;  1J0N A;  3IAP A;  3BGA A;  2WW1 A;  3DEC A;  1JOV A;  3VD4 A;  1HMU A;  1EGU A;  1N7Q A;  1W3Y A;  1SO0 A;  4MMH A;  4MMI A;  2CIR A;  3VD7 A;  2WW3 A;  3MV1 1;  1X1J A;  3SEP A;  1N7O A;  3E1F 1;  3T2Q A;  1JYW A;  1NS4 A;  5JMD A;  1UG9 A;  2JKA A;  3T09 A;  3MUZ 1;  2HTA A;  3OB8 A;  2JKE A;  2XHN A;  3VDC A;  1JZ7 A;  3J7H A;  1NS7 A;  1NSR A;  1JZ3 A;  2ZQ0 A;  3MWX A;  2BRW A;  1MMY A;  3VD5 A;  1MMZ A;  3T0D A;  1Z45 A;  1NS8 A;  1NSS A;  2CIS A;  3IAQ A;  1RWH A;  3T2P A;  4TTG A;  3DYP A;  1LF9 A;  3Q1N A;  3WVF A;  3NRE A;  3OS7 A;  3I3D A;  1OJN A;  2FUQ A;  2Q1F A;  1F1S A;  2WW2 A;  4BZE A;  3T2O A;  3DCD A;  1LOH A;  4OK2 A;  4BZH A;  3IMH A;  2WDA A;  1NS2 A;  1CB8 A;  1RWC A;  1JZ6 A;  3VSM A;  1MN0 A;  3T0A A;  1I8Q A;  1K1Y A;  2E22 A;  4J5T A;  4AQ0 A;  2WVZ A;  1HN1 A;  3MV0 1;  1JZ8 A;  1PX4 A;  1HM2 A;  1K1W A;  4NEI A;  4BZF A;  1JZ4 A;  3NJX A;  3BS6 A;  1F4H A;  3VSN A;  2JKP A;  4DUV A;  3E80 A;  1NSU A;  3E7J A;  1K1X A;  3CZJ A;  3OBA A;  1N7R A;  2BRP A;  1J0M A;  1C82 A;  1N7P A;  1X1I A;  1JYX A;  3DYO A;  3T08 A;  1NS0 A;  3A0O A;  1JYV A;  1HM3 A;  1NSX A;  4BZG A;  4DUW A;  4RNL A;  2WVX B;  4OJZ A;  1RW9 A;  2X03 A;  1RWF A;  1F9G A;  1LXK A;  5A1A A;  2WCO A;  1JZ5 A;  3TY1 A;  1NSV A;  1ULV A;  3VD9 A;  3MUY 1;  4FNV A;  3NJV A;  1NSZ A;  5JMF A;  1OJP A;  1SNZ A;  1OJO A;  1PX3 A;  1TXK A;  1YGA A;  3VD3 A;  1RWG A;  4DUX A;  2BRV X;  2CIQ A;  1RWA A;  4OK4 A;  1HMW A;  3AFL A;  1L7K A;  3DYM A;  1JYN A;  1JZ2 A;  1NSM A;  2D73 A;  2XSG A;  1L7J A;  2HTB A;  1NKG A;  2E24 A;  2WVY A;  3A24 A;  1LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...