1NSVA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLNGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 100
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsvA00
1ULVA 2XSGA 4TTGA 1NSZA 1JZ8A 3E1F1 3VD7A 3OB8A 3T2QA 2CIQA 4BZHA 1RWCA 1J0NA 3OBAA 3IMHA 1F4HA 2HTBA 2WVYA 2WW1A 1LF6A 4RNLA 3Q1NA 3T0BA 1HN1A 1K1XA 1W3YA 3VD9A 1X1IA 1OJMA 2X03A 1RW9A 3T0AA 4BZFA 3I3DA 3T2PA 2D73A 1Z45A 1C82A 3DECA 1I8QA 1JZ7A 1YGAA 1RWFA 1LXKA 1NSVA 1HN0A 1TXKA 1L7JA 1MMXA 1NS7A 1JZ4A 1NS0A 2E22A 2WVZA 3J7HA 2WVXB 1N7QA 1JZ3A 1HM2A 2HTAA 1NSSA 3WFAA 3T0DA 3K25A 1NSMA 1CB8A 2CISA 1SNZA 2JKPA 1L7KA 3CZJA 3VDCA 3VDBA 3VD3A 3T08A 3IAPA 3I3BA 4DUXA 2WW3A 2WW2A 3MUZ1 4BZEA 4DUVA 1UG9A 1MN0A 3A24A 1OJNA 1NSXA 1SO0A 1PX3A 4DUWA 5E1QA 3DCDA 1NS2A 1NSUA 1NS8A 1LURA 1YQ2A 2JKAA 1HMUA 1N7PA 2BRWA 1OJPA 1RWHA 3DYPA 1JZ6A 5A1AA 3T2OA 2XHNA 3VD5A 1JOVA 1F4AA 1LXMA 3DYMA 3MV11 2WDAA 1HMWA 1N7NA 1J0MA 1F1SA 1N7RA 3BGAA 1LF9A 1OJOA 3T09A 2E24A 3MWXA 3NJXA 2WZSA 1NSRA 1X1HA 3NREA 1HM3A 2WCOA 1X1JA 1PX4A 2Q1FA 2CIRA 3SEPA 2BRPA 1LOHA 1EGUA 1K1WA 4AQ0A 1N7OA 1JZ5A 3ECQA 3MV01 2JKEA 1JZ2A 3I3EA 1JYNA 1JYWA 1K1YA 1DP0A 2WVXA 3OS7A 1JYXA 1MMYA 3MUY1 3VDAA 4BZGA 2ZQ0A 3DYOA 1NKGA 2BRVX 3VD4A 2WW0A 1NS4A 1RWGA 2ZXQA 1JYVA 1F9GA 3NJVA 3IAQA 1MMUA 1RWAA 1MMZA
chains in the Genus database with same CATH superfamily
1JZ8A 3E1F1 1QALA 3HIIA 3X41A 1UI8A 3MPHA 3D52A 1O7DD 1HXKA 3X3ZA 2WVYA 2Y74A 3Q1NA 1K1XA 4OK2A 3WIRA 3D4ZA 2X03A 1RW9A 3ACTA 2W0QA 2OOVC 3EJSA 3BUIA 2XN2A 2WYIA 5KBPA 2CQSA 1RWFA 1W7CA 3RSYA 1HTYA 1JZ4A 1NS0A 1QWUA 1HM2A 3BUBA 3BLCA 3T0DA 1LVNA 3X3XA 2CISA 2JKPA 1H54A 1L7KA 2EAEA 3VDCA 2WW3A 3MUZ1 4BZEA 2YX9A 1EKMA 1SO0A 1RKYA 4DUWA 2WYHA 3DCDA 3CV5A 1YQ2A 1OJPA 2WGQA 5A1AA 3VD5A 4FNVA 2ALWA 1JOVA 3ACSA 5CA3A 1QX1A 1N7NA 1J0MA 2XN1A 1IVXA 1R34A 2BT3A 3NJXA 2WZSA 3EJTA 3NREA 1WMNA 1W6GA 1W5ZA 2OQEA 1IVUA 3T0UA 1HWWA 1JZ5A 2CFKA 1JZ2A 1JYWA 4FNUA 2WVXA 3BUPA 2E2TA 1MMYA 4BZGA 3K5TA 2CFGA 3NJVA 2XSGA 3LOYA 1NSZA 3NBJA 3OB8A 3T2QA 2CIQA 1US1A 1RWCA 1J0NA 3DDFA 3DX1A 3BVUA 2CFLA 3D50A 3A0OA 1D6UA 3I3DA 3QFZA 2FUTA 1Z45A 3WA2X 2F7OA 1W4NA 3S4BA 3TY1A 1YGAA 3D51A 3BVTA 3S4DA 1LXKA 3CZSA 1IQYA 1HN0A 3BVWA 3E7JA 1TQVA 1N7QA 1JZ3A 1NSSA 1NSMA 1CB8A 2WOFA 1SNZA 3T08A 1D6ZA 4MMHA 1TQWA 2CQTA 4DUVA 2YFOA 3A24A 1OJNA 3WVFA 3DX0A 2ZL8A 3BVXA 1N9EA 2F7QA 3DYPA 1JZ6A 3AMOA 3T2OA 3W7TA 3DYMA 2WDAA 3BUQA 3BGAA 1LF9A 3AFJA 3AFLA 3E80A 3W7WA 4NEIA 3BS6A 2EADA 3DX4A 1X1HA 1HM3A 2CWUA 1PX4A 1W2ZA 3SEPA 1LOHA 1QAFA 1EGUA 1N7OA 3MV01 1DYUA 2FUQA 4EV2A 3VDAA 3DYOA 2WW0A 1WMPA 2ZXQA 3IAQA 3ALAA 4MMIA 2CG1A 2WO0A 1ULVA 1JRQA 3VD7A 5JMDA 3W7XA 4FNPA 3WA3A 1F4HA 2E2UA 2HTBA 2WW1A 4BTXA 3T0BA 3KIIA 3VD9A 1RJOA 3VSNA 1OJMA 4EV5A 3D3IA 3T0AA 4OJZA 3T2PA 1TQSA 1AVKA 1C82A 3DECA 1PS3A 1I8QA 1JZ7A 1AV4A 3CZNA 3BUDA 3QFYA 1L7JA 3EJQA 2WVZA 3J7HA 4FNSA 2WVXB 2OW6A 2HTAA 3K25A 1TQTA 3VD3A 4FNQA 3IAPA 3I3BA 1UI7A 1UG9A 1MN0A 3N9HA 2E2VA 2OOVA 5E1QA 4KTRA 2Y73A 4FNRA 1NSUA 3EJUA 2JKAA 1LURA 1QWNA 1R33A 2BRWA 1RWHA 1SPUA 3X3YA 5JMFA 1LXMA 3RRSA 1IQXA 3MV11 3VSMA 3D4YA 2F1BA 1HMWA 2CWVA 4OK4A 1QAKA 1N7RA 2CWTA 1OJOA 2WOHA 2E24A 3MWXA 3HIGA 1NSRA 2F1AA 1X1JA 2C10A 2CIRA 2Q1FA 3WIQA 1K1WA 4AQ0A 3MI6A 3DX2A 4BTYA 3ECQA 3EJRA 3PGBA 2F18A 1K1YA 1DP0A 1JYXA 2CFDA 3W7SA 1IVVA 2ZQ0A 3EJPA 1NKGA 2BRVX 3VD4A 1RWGA 1JYVA 4K3AA 3DX3A 1MMUA 3NBBA 3BLBA 1SIIA 1AVLA 4TTGA 2RDYA 3S4CA 3SXXA 4BZHA 3OBAA 4FNTA 3IMHA 1LF6A 4J5TA 4RNLA 1HN1A 3AMOB 2CFWA 2F7PA 1W3YA 2XN0A 1X1IA 1V7VA 3KN4A 1IU7A 4BZFA 1V7WA 2D73A 2PNCA 2FYVA 1NSVA 4UFCA 1TXKA 1PU4A 1WMOA 1MMXA 1NS7A 1KSIA 4KFEA 4K35A 2OW7A 2E22A 3S4AA 2YFNA 3X40A 3WFAA 4KTPA 3CZJA 2D1WA 3QDEA 3VDBA 4DUXA 2WW2A 1TQUA 3SX1A 1NSXA 1V7XA 3HI7A 1A2VA 1PX3A 4KFDA 1NS2A 3LVTA 1SIHA 5GW7A 2CG0A 3DDGA 4BTWA 1NS8A 1HMUA 1N7PA 3BVVA 2XHNA 1F4AA 1OACA 3X42A 1F1SA 3T09A 2OQEC 2C11A 2WCOA 4KFFA 2BRPA 2EACA 1TU5A 2F7RA 2JKEA 3I3EA 1JYNA 1D6YA 3OS7A 1W6CA 2EABA 3QG0A 3MUY1 3W7UA 1NS4A 1IVWA 1F9GA 1RWAA 1MMZA
chains in the Genus database with same CATH topology
1ULVA 2XSGA 4TTGA 1NSZA 1JZ8A 3E1F1 5JMDA 3VD7A 3OB8A 3T2QA 2CIQA 4BZHA 1RWCA 1J0NA 3OBAA 3IMHA 1F4HA 2HTBA 2WVYA 2WW1A 1LF6A 4J5TA 4RNLA 3Q1NA 3T0BA 1HN1A 1K1XA 1W3YA 4OK2A 3VD9A 1X1IA 3A0OA 3VSNA 1OJMA 2X03A 1RW9A 3T0AA 4BZFA 3I3DA 4OJZA 2FUTA 3T2PA 2D73A 1Z45A 1C82A 3DECA 1I8QA 1JZ7A 3TY1A 1YGAA 1RWFA 1LXKA 1NSVA 1HN0A 1TXKA 3E7JA 1L7JA 1MMXA 1NS7A 1JZ4A 1NS0A 2E22A 2WVZA 3J7HA 2WVXB 1N7QA 1JZ3A 1HM2A 2HTAA 1NSSA 3BLCA 3WFAA 3T0DA 3K25A 1NSMA 1CB8A 2CISA 1SNZA 2JKPA 1L7KA 3CZJA 3VDCA 3VDBA 3VD3A 3T08A 3IAPA 3I3BA 4MMHA 4DUXA 2WW3A 2WW2A 3MUZ1 4BZEA 4DUVA 1UG9A 1MN0A 3A24A 1OJNA 1NSXA 3WVFA 1SO0A 1PX3A 4DUWA 5E1QA 3DCDA 1NS2A 1NSUA 1NS8A 1LURA 1YQ2A 2JKAA 1HMUA 1N7PA 2BRWA 1OJPA 1RWHA 3DYPA 1JZ6A 5A1AA 3T2OA 2XHNA 4FNVA 3VD5A 5JMFA 1JOVA 1F4AA 1LXMA 3DYMA 3MV11 3VSMA 2WDAA 1HMWA 1N7NA 4OK4A 1J0MA 1F1SA 1N7RA 3BGAA 1LF9A 1OJOA 3T09A 3AFLA 3E80A 2E24A 3MWXA 3NJXA 2WZSA 3BS6A 4NEIA 1NSRA 1X1HA 3NREA 1HM3A 2WCOA 1X1JA 1PX4A 2Q1FA 2CIRA 3SEPA 2BRPA 1LOHA 1EGUA 1K1WA 4AQ0A 1N7OA 1JZ5A 4MMIA 3ECQA 3MV01 2JKEA 1JZ2A 3I3EA 1JYNA 1JYWA 1K1YA 1DP0A 2FUQA 2WVXA 3OS7A 1JYXA 1MMYA 3MUY1 3VDAA 4BZGA 2ZQ0A 3DYOA 1NKGA 2BRVX 3VD4A 2WW0A 1NS4A 1RWGA 2ZXQA 1JYVA 1F9GA 3NJVA 3IAQA 1MMUA 1RWAA 1MMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULV A;  2XSG A;  4TTG A;  1NSZ A;  1JZ8 A;  3E1F 1;  3VD7 A;  3OB8 A;  3T2Q A;  2CIQ A;  4BZH A;  1RWC A;  1J0N A;  3OBA A;  3IMH A;  1F4H A;  2HTB A;  2WVY A;  2WW1 A;  1LF6 A;  4RNL A;  3Q1N A;  3T0B A;  1HN1 A;  1K1X A;  1W3Y A;  3VD9 A;  1X1I A;  1OJM A;  2X03 A;  1RW9 A;  3T0A A;  4BZF A;  3I3D A;  3T2P A;  2D73 A;  1Z45 A;  1C82 A;  3DEC A;  1I8Q A;  1JZ7 A;  1YGA A;  1RWF A;  1LXK A;  1NSV A;  1HN0 A;  1TXK A;  1L7J A;  1MMX A;  1NS7 A;  1JZ4 A;  1NS0 A;  2E22 A;  2WVZ A;  3J7H A;  2WVX B;  1N7Q A;  1JZ3 A;  1HM2 A;  2HTA A;  1NSS A;  3WFA A;  3T0D A;  3K25 A;  1NSM A;  1CB8 A;  2CIS A;  1SNZ A;  2JKP A;  1L7K A;  3CZJ A;  3VDC A;  3VDB A;  3VD3 A;  3T08 A;  3IAP A;  3I3B A;  4DUX A;  2WW3 A;  2WW2 A;  3MUZ 1;  4BZE A;  4DUV A;  1UG9 A;  1MN0 A;  3A24 A;  1OJN A;  1NSX A;  1SO0 A;  1PX3 A;  4DUW A;  5E1Q A;  3DCD A;  1NS2 A;  1NSU A;  1NS8 A;  1LUR A;  1YQ2 A;  2JKA A;  1HMU A;  1N7P A;  2BRW A;  1OJP A;  1RWH A;  3DYP A;  1JZ6 A;  5A1A A;  3T2O A;  2XHN A;  3VD5 A;  1JOV A;  1F4A A;  1LXM A;  3DYM A;  3MV1 1;  2WDA A;  1HMW A;  1N7N A;  1J0M A;  1F1S A;  1N7R A;  3BGA A;  1LF9 A;  1OJO A;  3T09 A;  2E24 A;  3MWX A;  3NJX A;  2WZS A;  1NSR A;  1X1H A;  3NRE A;  1HM3 A;  2WCO A;  1X1J A;  1PX4 A;  2Q1F A;  2CIR A;  3SEP A;  2BRP A;  1LOH A;  1EGU A;  1K1W A;  4AQ0 A;  1N7O A;  1JZ5 A;  3ECQ A;  3MV0 1;  2JKE A;  1JZ2 A;  3I3E A;  1JYN A;  1JYW A;  1K1Y A;  1DP0 A;  2WVX A;  3OS7 A;  1JYX A;  1MMY A;  3MUY 1;  3VDA A;  4BZG A;  2ZQ0 A;  3DYO A;  1NKG A;  2BRV X;  3VD4 A;  2WW0 A;  1NS4 A;  1RWG A;  2ZXQ A;  1JYV A;  1F9G A;  3NJV A;  3IAQ A;  1MMU A;  1RWA A;  1MMZ A; 
#chains in the Genus database with same CATH topology
 1JZ8 A;  3E1F 1;  1QAL A;  3HII A;  3X41 A;  1UI8 A;  3MPH A;  3D52 A;  1O7D D;  1HXK A;  3X3Z A;  2WVY A;  2Y74 A;  3Q1N A;  1K1X A;  4OK2 A;  3WIR A;  3D4Z A;  2X03 A;  1RW9 A;  3ACT A;  2W0Q A;  2OOV C;  3EJS A;  3BUI A;  2XN2 A;  2WYI A;  5KBP A;  2CQS A;  1RWF A;  1W7C A;  3RSY A;  1HTY A;  1JZ4 A;  1NS0 A;  1QWU A;  1HM2 A;  3BUB A;  3BLC A;  3T0D A;  1LVN A;  3X3X A;  2CIS A;  2JKP A;  1H54 A;  1L7K A;  2EAE A;  3VDC A;  2WW3 A;  3MUZ 1;  4BZE A;  2YX9 A;  1EKM A;  1SO0 A;  1RKY A;  4DUW A;  2WYH A;  3DCD A;  3CV5 A;  1YQ2 A;  1OJP A;  2WGQ A;  5A1A A;  3VD5 A;  4FNV A;  2ALW A;  1JOV A;  3ACS A;  5CA3 A;  1QX1 A;  1N7N A;  1J0M A;  2XN1 A;  1IVX A;  1R34 A;  2BT3 A;  3NJX A;  2WZS A;  3EJT A;  3NRE A;  1WMN A;  1W6G A;  1W5Z A;  2OQE A;  1IVU A;  3T0U A;  1HWW A;  1JZ5 A;  2CFK A;  1JZ2 A;  1JYW A;  4FNU A;  2WVX A;  3BUP A;  2E2T A;  1MMY A;  4BZG A;  3K5T A;  2CFG A;  3NJV A;  2XSG A;  3LOY A;  1NSZ A;  3NBJ A;  3OB8 A;  3T2Q A;  2CIQ A;  1US1 A;  1RWC A;  1J0N A;  3DDF A;  3DX1 A;  3BVU A;  2CFL A;  3D50 A;  3A0O A;  1D6U A;  3I3D A;  3QFZ A;  2FUT A;  1Z45 A;  3WA2 X;  2F7O A;  1W4N A;  3S4B A;  3TY1 A;  1YGA A;  3D51 A;  3BVT A;  3S4D A;  1LXK A;  3CZS A;  1IQY A;  1HN0 A;  3BVW A;  3E7J A;  1TQV A;  1N7Q A;  1JZ3 A;  1NSS A;  1NSM A;  1CB8 A;  2WOF A;  1SNZ A;  3T08 A;  1D6Z A;  4MMH A;  1TQW A;  2CQT A;  4DUV A;  2YFO A;  3A24 A;  1OJN A;  3WVF A;  3DX0 A;  2ZL8 A;  3BVX A;  1N9E A;  2F7Q A;  3DYP A;  1JZ6 A;  3AMO A;  3T2O A;  3W7T A;  3DYM A;  2WDA A;  3BUQ A;  3BGA A;  1LF9 A;  3AFJ A;  3AFL A;  3E80 A;  3W7W A;  4NEI A;  3BS6 A;  2EAD A;  3DX4 A;  1X1H A;  1HM3 A;  2CWU A;  1PX4 A;  1W2Z A;  3SEP A;  1LOH A;  1QAF A;  1EGU A;  1N7O A;  3MV0 1;  1DYU A;  2FUQ A;  4EV2 A;  3VDA A;  3DYO A;  2WW0 A;  1WMP A;  2ZXQ A;  3IAQ A;  3ALA A;  4MMI A;  2CG1 A;  2WO0 A;  1ULV A;  1JRQ A;  3VD7 A;  5JMD A;  3W7X A;  4FNP A;  3WA3 A;  1F4H A;  2E2U A;  2HTB A;  2WW1 A;  4BTX A;  3T0B A;  3KII A;  3VD9 A;  1RJO A;  3VSN A;  1OJM A;  4EV5 A;  3D3I A;  3T0A A;  4OJZ A;  3T2P A;  1TQS A;  1AVK A;  1C82 A;  3DEC A;  1PS3 A;  1I8Q A;  1JZ7 A;  1AV4 A;  3CZN A;  3BUD A;  3QFY A;  1L7J A;  3EJQ A;  2WVZ A;  3J7H A;  4FNS A;  2WVX B;  2OW6 A;  2HTA A;  3K25 A;  1TQT A;  3VD3 A;  4FNQ A;  3IAP A;  3I3B A;  1UI7 A;  1UG9 A;  1MN0 A;  3N9H A;  2E2V A;  2OOV A;  5E1Q A;  4KTR A;  2Y73 A;  4FNR A;  1NSU A;  3EJU A;  2JKA A;  1LUR A;  1QWN A;  1R33 A;  2BRW A;  1RWH A;  1SPU A;  3X3Y A;  5JMF A;  1LXM A;  3RRS A;  1IQX A;  3MV1 1;  3VSM A;  3D4Y A;  2F1B A;  1HMW A;  2CWV A;  4OK4 A;  1QAK A;  1N7R A;  2CWT A;  1OJO A;  2WOH A;  2E24 A;  3MWX A;  3HIG A;  1NSR A;  2F1A A;  1X1J A;  2C10 A;  2CIR A;  2Q1F A;  3WIQ A;  1K1W A;  4AQ0 A;  3MI6 A;  3DX2 A;  4BTY A;  3ECQ A;  3EJR A;  3PGB A;  2F18 A;  1K1Y A;  1DP0 A;  1JYX A;  2CFD A;  3W7S A;  1IVV A;  2ZQ0 A;  3EJP A;  1NKG A;  2BRV X;  3VD4 A;  1RWG A;  1JYV A;  4K3A A;  3DX3 A;  1MMU A;  3NBB A;  3BLB A;  1SII A;  1AVL A;  4TTG A;  2RDY A;  3S4C A;  3SXX A;  4BZH A;  3OBA A;  4FNT A;  3IMH A;  1LF6 A;  4J5T A;  4RNL A;  1HN1 A;  3AMO B;  2CFW A;  2F7P A;  1W3Y A;  2XN0 A;  1X1I A;  1V7V A;  3KN4 A;  1IU7 A;  4BZF A;  1V7W A;  2D73 A;  2PNC A;  2FYV A;  1NSV A;  4UFC A;  1TXK A;  1PU4 A;  1WMO A;  1MMX A;  1NS7 A;  1KSI A;  4KFE A;  4K35 A;  2OW7 A;  2E22 A;  3S4A A;  2YFN A;  3X40 A;  3WFA A;  4KTP A;  3CZJ A;  2D1W A;  3QDE A;  3VDB A;  4DUX A;  2WW2 A;  1TQU A;  3SX1 A;  1NSX A;  1V7X A;  3HI7 A;  1A2V A;  1PX3 A;  4KFD A;  1NS2 A;  3LVT A;  1SIH A;  5GW7 A;  2CG0 A;  3DDG A;  4BTW A;  1NS8 A;  1HMU A;  1N7P A;  3BVV A;  2XHN A;  1F4A A;  1OAC A;  3X42 A;  1F1S A;  3T09 A;  2OQE C;  2C11 A;  2WCO A;  4KFF A;  2BRP A;  2EAC A;  1TU5 A;  2F7R A;  2JKE A;  3I3E A;  1JYN A;  1D6Y A;  3OS7 A;  1W6C A;  2EAB A;  3QG0 A;  3MUY 1;  3W7U A;  1NS4 A;  1IVW A;  1F9G A;  1RWA A;  1MMZ A; 
#chains in the Genus database with same CATH homology
 1ULV A;  2XSG A;  4TTG A;  1NSZ A;  1JZ8 A;  3E1F 1;  5JMD A;  3VD7 A;  3OB8 A;  3T2Q A;  2CIQ A;  4BZH A;  1RWC A;  1J0N A;  3OBA A;  3IMH A;  1F4H A;  2HTB A;  2WVY A;  2WW1 A;  1LF6 A;  4J5T A;  4RNL A;  3Q1N A;  3T0B A;  1HN1 A;  1K1X A;  1W3Y A;  4OK2 A;  3VD9 A;  1X1I A;  3A0O A;  3VSN A;  1OJM A;  2X03 A;  1RW9 A;  3T0A A;  4BZF A;  3I3D A;  4OJZ A;  2FUT A;  3T2P A;  2D73 A;  1Z45 A;  1C82 A;  3DEC A;  1I8Q A;  1JZ7 A;  3TY1 A;  1YGA A;  1RWF A;  1LXK A;  1NSV A;  1HN0 A;  1TXK A;  3E7J A;  1L7J A;  1MMX A;  1NS7 A;  1JZ4 A;  1NS0 A;  2E22 A;  2WVZ A;  3J7H A;  2WVX B;  1N7Q A;  1JZ3 A;  1HM2 A;  2HTA A;  1NSS A;  3BLC A;  3WFA A;  3T0D A;  3K25 A;  1NSM A;  1CB8 A;  2CIS A;  1SNZ A;  2JKP A;  1L7K A;  3CZJ A;  3VDC A;  3VDB A;  3VD3 A;  3T08 A;  3IAP A;  3I3B A;  4MMH A;  4DUX A;  2WW3 A;  2WW2 A;  3MUZ 1;  4BZE A;  4DUV A;  1UG9 A;  1MN0 A;  3A24 A;  1OJN A;  1NSX A;  3WVF A;  1SO0 A;  1PX3 A;  4DUW A;  5E1Q A;  3DCD A;  1NS2 A;  1NSU A;  1NS8 A;  1LUR A;  1YQ2 A;  2JKA A;  1HMU A;  1N7P A;  2BRW A;  1OJP A;  1RWH A;  3DYP A;  1JZ6 A;  5A1A A;  3T2O A;  2XHN A;  4FNV A;  3VD5 A;  5JMF A;  1JOV A;  1F4A A;  1LXM A;  3DYM A;  3MV1 1;  3VSM A;  2WDA A;  1HMW A;  1N7N A;  4OK4 A;  1J0M A;  1F1S A;  1N7R A;  3BGA A;  1LF9 A;  1OJO A;  3T09 A;  3AFL A;  3E80 A;  2E24 A;  3MWX A;  3NJX A;  2WZS A;  3BS6 A;  4NEI A;  1NSR A;  1X1H A;  3NRE A;  1HM3 A;  2WCO A;  1X1J A;  1PX4 A;  2Q1F A;  2CIR A;  3SEP A;  2BRP A;  1LOH A;  1EGU A;  1K1W A;  4AQ0 A;  1N7O A;  1JZ5 A;  4MMI A;  3ECQ A;  3MV0 1;  2JKE A;  1JZ2 A;  3I3E A;  1JYN A;  1JYW A;  1K1Y A;  1DP0 A;  2FUQ A;  2WVX A;  3OS7 A;  1JYX A;  1MMY A;  3MUY 1;  3VDA A;  4BZG A;  2ZQ0 A;  3DYO A;  1NKG A;  2BRV X;  3VD4 A;  2WW0 A;  1NS4 A;  1RWG A;  2ZXQ A;  1JYV A;  1F9G A;  3NJV A;  3IAQ A;  1MMU A;  1RWA A;  1MMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...