1NSVA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLNGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 100
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsvA00
1DP0A 3NJXA 1N7PA 3DCDA 2WW3A 3T0DA 1SNZA 1L7KA 2E22A 1SO0A 1JYVA 1YQ2A 1L7JA 3WFAA 1JYWA 4BZGA 4TTGA 3MWXA 1NSUA 3VDAA 3VD4A 2ZQ0A 1HM2A 3DYMA 1N7OA 1RWHA 3MUZ1 1PX4A 4BZEA 1YGAA 5A1AA 2WW1A 1JYNA 2CIRA 4RNLA 2BRPA 1CB8A 1NSSA 4BZHA 1X1HA 3DYOA 1ULVA 2E24A 3ECQA 3I3EA 1NS7A 3IMHA 1W3YA 1F4AA 2CIQA 3I3DA 2XHNA 1LOHA 3DYPA 1LXMA 2CISA 4DUXA 3VDBA 3NREA 1J0MA 1HM3A 1C82A 2HTBA 3OS7A 1HN0A 2X03A 3T09A 1PX3A 1N7QA 3IAPA 4BZFA 1JZ4A 1JZ7A 3OB8A 1NSZA 1MMUA 1RWCA 1RWAA 3SEPA 1NS4A 3DECA 1UG9A 3T0BA 1HN1A 1NSVA 1X1IA 1JZ6A 3E1F1 4DUVA 2WW2A 1LF9A 1F9GA 3VD3A 4AQ0A 1RWGA 1JOVA 2WW0A 1OJNA 2WDAA 3K25A 1NS0A 3A24A 2XSGA 1NS2A 1MMXA 3OBAA 2WZSA 1TXKA 1N7NA 3IAQA 1NS8A 1LXKA 3BGAA 2HTAA 1JYXA 3J7HA 1MMYA 1NSRA 1F1SA 2Q1FA 3VDCA 2ZXQA 2WCOA 1JZ8A 1K1WA 2BRWA 3T0AA 3MV01 1I8QA 1RW9A 1JZ3A 1LF6A 2JKEA 2WVZA 1LURA 1OJPA 1HMUA 1NSMA 1Z45A 3VD9A 3T2PA 1HMWA 1N7RA 1MN0A 1OJOA 2BRVX 3NJVA 3I3BA 2D73A 1JZ5A 1MMZA 1OJMA 3MV11 1NKGA 3Q1NA 2JKPA 3CZJA 1X1JA 1K1YA 3VD7A 1J0NA 3T2QA 3T2OA 1JZ2A 5E1QA 3MUY1 2JKAA 1F4HA 2WVYA 1RWFA 2WVXB 4DUWA 1NSXA 2WVXA 3VD5A 1K1XA 1EGUA 3T08A
chains in the Genus database with same CATH superfamily
1TU5A 1QAKA 3DCDA 2WW3A 1PS3A 2Y73A 4BZGA 1NSUA 3RRSA 3MUZ1 1PX4A 2OOVA 4BZEA 1JYNA 2EADA 2WW1A 3BUBA 3DX2A 2F1BA 1CB8A 2E2VA 1NSSA 1SIHA 3D50A 3I3EA 3ECQA 1W3YA 1F4AA 5KBPA 3I3DA 1EKMA 2WO0A 4DUXA 1IVWA 1J0MA 1HM3A 2F7OA 1TQSA 1WMNA 3HIIA 3D52A 3IAPA 1N7QA 1JZ4A 1JZ7A 1NSZA 2OQEC 1HWWA 1NS4A 4BTWA 1UG9A 1HN1A 1W4NA 3WA3A 1LF9A 2XN2A 1RJOA 3DDFA 2FYVA 1RWGA 1NS0A 1V7WA 4MMIA 1MMXA 3OBAA 3CZSA 4OK4A 3VSNA 2CQSA 1W2ZA 3VDCA 2ZXQA 1K1WA 3T0AA 1QAFA 1I8QA 3NBBA 1US1A 1LURA 3DX1A 3LOYA 3BS6A 3NJVA 2F7QA 2WYIA 2XN0A 2JKPA 2F7RA 1X1JA 2C10A 1J0NA 3BLCA 3MUY1 4FNSA 2WVXA 3PGBA 1K1XA 3DX0A 2CFWA 1R34A 3S4AA 3W7TA 1N7PA 3T0DA 1KSIA 1YQ2A 3WFAA 1JYWA 2YFNA 2CFGA 2CG1A 4EV2A 4TTGA 3QG0A 3MWXA 1N7OA 3ALAA 3S4BA 2CWUA 1V7VA 4RNLA 1RKYA 1AV4A 1PU4A 1NS7A 2YFOA 2CWVA 1TQTA 2CIQA 3X3XA 2WYHA 2EAEA 1LVNA 2D1WA 3DX4A 3EJUA 2CISA 3EJQA 3BVVA 5CA3A 3W7UA 3DDGA 3OS7A 1HN0A 1QALA 3WIQA 1HXKA 2ZL8A 1PX3A 3T09A 4BZFA 3AMOA 3AFLA 4KFDA 3KIIA 2F1AA 3MI6A 3WIRA 1NSVA 4FNRA 2XN1A 2C11A 3E1F1 4DUVA 2ALWA 2OW6A 3S4DA 1W6GA 2PNCA 3VD3A 3W7SA 2OW7A 3EJRA 1OJNA 3K25A 3BVTA 2OOVC 2WZSA 1TXKA 3QDEA 2FUQA 3BGAA 3D51A 1JYXA 3BVWA 4J5TA 3D3IA 1MMYA 1NSRA 1F1SA 3SX1A 3BUPA 1IQYA 4FNTA 3SXXA 1JZ3A 2WVZA 2F18A 2W0QA 3HI7A 3X3ZA 3T2PA 4KFEA 3DX3A 1HMWA 1N7RA 1MN0A 1OJOA 4NEIA 2E2TA 3I3BA 1D6YA 1OJMA 2Y74A 4BTXA 3T2QA 5E1QA 1UI7A 2WOFA 2JKAA 4BTYA 1RWFA 2RDYA 1NSXA 2BT3A 3VD5A 3T2OA 1DP0A 4K3AA 4EV5A 1IVXA 2OQEA 4MMHA 3E80A 3WA2X 2EACA 1SNZA 2E22A 1SIIA 5JMFA 1JYVA 1L7JA 3LVTA 2WGQA 3X3YA 3VD4A 3VDAA 2ZQ0A 1HM2A 3DYMA 1RWHA 5A1AA 2CIRA 3AFJA 4BZHA 1ULVA 3X42A 3X40A 3EJSA 3DYPA 1OACA 1LXMA 1HTYA 3W7XA 4FNPA 2X03A 4FNVA 3T0UA 3W7WA 1RWCA 1RWAA 3TY1A 3HIGA 2E2UA 3DECA 1N9EA 3VSMA 2CFDA 3RSYA 1SPUA 1IVUA 3KN4A 4OK2A 5JMDA 4FNUA 1O7DD 2F7PA 1H54A 1W5ZA 4KTRA 1N7NA 2FUTA 1NS8A 2YX9A 3NBJA 2CFKA 3A0OA 2WCOA 1JZ8A 3X41A 2BRWA 1LF6A 1IU7A 1OJPA 1HMUA 1WMPA 1NSMA 3VD9A 2CQTA 1QWNA 2BRVX 2D73A 1V7XA 1NKGA 1QWUA 3S4CA 4OJZA 2EABA 2WVYA 3EJTA 3BUIA 1JRQA 3T08A 3MPHA 3EJPA 3NJXA 2CG0A 4UFCA 1WMOA 1W6CA 1L7KA 1SO0A 4FNQA 3BVUA 3N9HA 1QX1A 4KTPA 1YGAA 1W7CA 5GW7A 2BRPA 1A2VA 3ACSA 1X1HA 1IQXA 3DYOA 2E24A 1UI8A 3BUDA 3IMHA 1D6UA 4KFFA 2XHNA 1LOHA 1TQWA 2CFLA 1TQUA 3VDBA 3NREA 1C82A 3BUQA 2HTBA 1AVLA 3OB8A 1MMUA 3SEPA 3T0BA 3WVFA 1X1IA 3D4ZA 1JZ6A 3K5TA 2WW2A 3QFZA 3D4YA 3BVXA 1AVKA 1F9GA 4AQ0A 1JOVA 2WW0A 2WDAA 2CWTA 3A24A 2XSGA 1R33A 1NS2A 3IAQA 3AMOB 1LXKA 2HTAA 4K35A 3J7HA 3CV5A 2Q1FA 3ACTA 3QFYA 3MV01 1RW9A 1D6ZA 2JKEA 1DYUA 1Z45A 1JZ5A 1MMZA 3CZNA 3MV11 1TQVA 3Q1NA 3CZJA 1K1YA 3BLBA 3VD7A 1JZ2A 2WOHA 3E7JA 1F4HA 1IVVA 2WVXB 4DUWA 1EGUA
chains in the Genus database with same CATH topology
1DP0A 3NJXA 4MMHA 1N7PA 3E80A 3DCDA 2WW3A 3T0DA 1SNZA 1L7KA 2E22A 1SO0A 5JMFA 1JYVA 1YQ2A 1L7JA 3WFAA 1JYWA 4BZGA 4TTGA 3MWXA 1NSUA 3VDAA 3VD4A 2ZQ0A 1HM2A 3DYMA 1N7OA 1RWHA 3MUZ1 1PX4A 4BZEA 1YGAA 5A1AA 2WW1A 1JYNA 2CIRA 4RNLA 2BRPA 1CB8A 1NSSA 4BZHA 1X1HA 3DYOA 1ULVA 2E24A 3ECQA 3I3EA 1NS7A 3IMHA 1W3YA 1F4AA 2CIQA 3I3DA 2XHNA 1LOHA 3DYPA 1LXMA 2CISA 4DUXA 3VDBA 3NREA 1J0MA 1HM3A 1C82A 2HTBA 3OS7A 1HN0A 2X03A 3T09A 1PX3A 1N7QA 3IAPA 4FNVA 4BZFA 1JZ4A 3AFLA 1JZ7A 3OB8A 1NSZA 1MMUA 1RWCA 1RWAA 3SEPA 3TY1A 1NS4A 3DECA 1UG9A 3T0BA 1HN1A 3WVFA 1NSVA 3VSMA 1X1IA 1JZ6A 3E1F1 4DUVA 2WW2A 1LF9A 1F9GA 4OK2A 5JMDA 3VD3A 4AQ0A 1RWGA 1JOVA 2WW0A 1OJNA 2WDAA 3K25A 1NS0A 3A24A 2XSGA 4MMIA 1NS2A 1MMXA 3OBAA 2WZSA 1TXKA 1N7NA 2FUTA 3IAQA 1NS8A 2FUQA 1LXKA 3BGAA 4OK4A 2HTAA 1JYXA 4J5TA 3VSNA 3J7HA 3A0OA 1MMYA 1NSRA 1F1SA 2Q1FA 3VDCA 2ZXQA 2WCOA 1JZ8A 1K1WA 2BRWA 3T0AA 3MV01 1I8QA 1RW9A 1JZ3A 1LF6A 2JKEA 2WVZA 1LURA 1OJPA 1HMUA 1NSMA 1Z45A 3VD9A 3T2PA 3BS6A 1HMWA 1N7RA 1MN0A 1OJOA 2BRVX 4NEIA 3NJVA 3I3BA 2D73A 1JZ5A 1MMZA 1OJMA 3MV11 1NKGA 3Q1NA 2JKPA 3CZJA 1X1JA 1K1YA 3VD7A 1J0NA 3T2QA 3T2OA 1JZ2A 5E1QA 3BLCA 3MUY1 4OJZA 3E7JA 2JKAA 1F4HA 2WVYA 1RWFA 2WVXB 4DUWA 1NSXA 2WVXA 3VD5A 1K1XA 1EGUA 3T08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP0 A;  3NJX A;  1N7P A;  3DCD A;  2WW3 A;  3T0D A;  1SNZ A;  1L7K A;  2E22 A;  1SO0 A;  1JYV A;  1YQ2 A;  1L7J A;  3WFA A;  1JYW A;  4BZG A;  4TTG A;  3MWX A;  1NSU A;  3VDA A;  3VD4 A;  2ZQ0 A;  1HM2 A;  3DYM A;  1N7O A;  1RWH A;  3MUZ 1;  1PX4 A;  4BZE A;  1YGA A;  5A1A A;  2WW1 A;  1JYN A;  2CIR A;  4RNL A;  2BRP A;  1CB8 A;  1NSS A;  4BZH A;  1X1H A;  3DYO A;  1ULV A;  2E24 A;  3ECQ A;  3I3E A;  1NS7 A;  3IMH A;  1W3Y A;  1F4A A;  2CIQ A;  3I3D A;  2XHN A;  1LOH A;  3DYP A;  1LXM A;  2CIS A;  4DUX A;  3VDB A;  3NRE A;  1J0M A;  1HM3 A;  1C82 A;  2HTB A;  3OS7 A;  1HN0 A;  2X03 A;  3T09 A;  1PX3 A;  1N7Q A;  3IAP A;  4BZF A;  1JZ4 A;  1JZ7 A;  3OB8 A;  1NSZ A;  1MMU A;  1RWC A;  1RWA A;  3SEP A;  1NS4 A;  3DEC A;  1UG9 A;  3T0B A;  1HN1 A;  1NSV A;  1X1I A;  1JZ6 A;  3E1F 1;  4DUV A;  2WW2 A;  1LF9 A;  1F9G A;  3VD3 A;  4AQ0 A;  1RWG A;  1JOV A;  2WW0 A;  1OJN A;  2WDA A;  3K25 A;  1NS0 A;  3A24 A;  2XSG A;  1NS2 A;  1MMX A;  3OBA A;  2WZS A;  1TXK A;  1N7N A;  3IAQ A;  1NS8 A;  1LXK A;  3BGA A;  2HTA A;  1JYX A;  3J7H A;  1MMY A;  1NSR A;  1F1S A;  2Q1F A;  3VDC A;  2ZXQ A;  2WCO A;  1JZ8 A;  1K1W A;  2BRW A;  3T0A A;  3MV0 1;  1I8Q A;  1RW9 A;  1JZ3 A;  1LF6 A;  2JKE A;  2WVZ A;  1LUR A;  1OJP A;  1HMU A;  1NSM A;  1Z45 A;  3VD9 A;  3T2P A;  1HMW A;  1N7R A;  1MN0 A;  1OJO A;  2BRV X;  3NJV A;  3I3B A;  2D73 A;  1JZ5 A;  1MMZ A;  1OJM A;  3MV1 1;  1NKG A;  3Q1N A;  2JKP A;  3CZJ A;  1X1J A;  1K1Y A;  3VD7 A;  1J0N A;  3T2Q A;  3T2O A;  1JZ2 A;  5E1Q A;  3MUY 1;  2JKA A;  1F4H A;  2WVY A;  1RWF A;  2WVX B;  4DUW A;  1NSX A;  2WVX A;  3VD5 A;  1K1X A;  1EGU A;  3T08 A; 
#chains in the Genus database with same CATH topology
 1TU5 A;  1QAK A;  3DCD A;  2WW3 A;  1PS3 A;  2Y73 A;  4BZG A;  1NSU A;  3RRS A;  3MUZ 1;  1PX4 A;  2OOV A;  4BZE A;  1JYN A;  2EAD A;  2WW1 A;  3BUB A;  3DX2 A;  2F1B A;  1CB8 A;  2E2V A;  1NSS A;  1SIH A;  3D50 A;  3I3E A;  3ECQ A;  1W3Y A;  1F4A A;  5KBP A;  3I3D A;  1EKM A;  2WO0 A;  4DUX A;  1IVW A;  1J0M A;  1HM3 A;  2F7O A;  1TQS A;  1WMN A;  3HII A;  3D52 A;  3IAP A;  1N7Q A;  1JZ4 A;  1JZ7 A;  1NSZ A;  2OQE C;  1HWW A;  1NS4 A;  4BTW A;  1UG9 A;  1HN1 A;  1W4N A;  3WA3 A;  1LF9 A;  2XN2 A;  1RJO A;  3DDF A;  2FYV A;  1RWG A;  1NS0 A;  1V7W A;  4MMI A;  1MMX A;  3OBA A;  3CZS A;  4OK4 A;  3VSN A;  2CQS A;  1W2Z A;  3VDC A;  2ZXQ A;  1K1W A;  3T0A A;  1QAF A;  1I8Q A;  3NBB A;  1US1 A;  1LUR A;  3DX1 A;  3LOY A;  3BS6 A;  3NJV A;  2F7Q A;  2WYI A;  2XN0 A;  2JKP A;  2F7R A;  1X1J A;  2C10 A;  1J0N A;  3BLC A;  3MUY 1;  4FNS A;  2WVX A;  3PGB A;  1K1X A;  3DX0 A;  2CFW A;  1R34 A;  3S4A A;  3W7T A;  1N7P A;  3T0D A;  1KSI A;  1YQ2 A;  3WFA A;  1JYW A;  2YFN A;  2CFG A;  2CG1 A;  4EV2 A;  4TTG A;  3QG0 A;  3MWX A;  1N7O A;  3ALA A;  3S4B A;  2CWU A;  1V7V A;  4RNL A;  1RKY A;  1AV4 A;  1PU4 A;  1NS7 A;  2YFO A;  2CWV A;  1TQT A;  2CIQ A;  3X3X A;  2WYH A;  2EAE A;  1LVN A;  2D1W A;  3DX4 A;  3EJU A;  2CIS A;  3EJQ A;  3BVV A;  5CA3 A;  3W7U A;  3DDG A;  3OS7 A;  1HN0 A;  1QAL A;  3WIQ A;  1HXK A;  2ZL8 A;  1PX3 A;  3T09 A;  4BZF A;  3AMO A;  3AFL A;  4KFD A;  3KII A;  2F1A A;  3MI6 A;  3WIR A;  1NSV A;  4FNR A;  2XN1 A;  2C11 A;  3E1F 1;  4DUV A;  2ALW A;  2OW6 A;  3S4D A;  1W6G A;  2PNC A;  3VD3 A;  3W7S A;  2OW7 A;  3EJR A;  1OJN A;  3K25 A;  3BVT A;  2OOV C;  2WZS A;  1TXK A;  3QDE A;  2FUQ A;  3BGA A;  3D51 A;  1JYX A;  3BVW A;  4J5T A;  3D3I A;  1MMY A;  1NSR A;  1F1S A;  3SX1 A;  3BUP A;  1IQY A;  4FNT A;  3SXX A;  1JZ3 A;  2WVZ A;  2F18 A;  2W0Q A;  3HI7 A;  3X3Z A;  3T2P A;  4KFE A;  3DX3 A;  1HMW A;  1N7R A;  1MN0 A;  1OJO A;  4NEI A;  2E2T A;  3I3B A;  1D6Y A;  1OJM A;  2Y74 A;  4BTX A;  3T2Q A;  5E1Q A;  1UI7 A;  2WOF A;  2JKA A;  4BTY A;  1RWF A;  2RDY A;  1NSX A;  2BT3 A;  3VD5 A;  3T2O A;  1DP0 A;  4K3A A;  4EV5 A;  1IVX A;  2OQE A;  4MMH A;  3E80 A;  3WA2 X;  2EAC A;  1SNZ A;  2E22 A;  1SII A;  5JMF A;  1JYV A;  1L7J A;  3LVT A;  2WGQ A;  3X3Y A;  3VD4 A;  3VDA A;  2ZQ0 A;  1HM2 A;  3DYM A;  1RWH A;  5A1A A;  2CIR A;  3AFJ A;  4BZH A;  1ULV A;  3X42 A;  3X40 A;  3EJS A;  3DYP A;  1OAC A;  1LXM A;  1HTY A;  3W7X A;  4FNP A;  2X03 A;  4FNV A;  3T0U A;  3W7W A;  1RWC A;  1RWA A;  3TY1 A;  3HIG A;  2E2U A;  3DEC A;  1N9E A;  3VSM A;  2CFD A;  3RSY A;  1SPU A;  1IVU A;  3KN4 A;  4OK2 A;  5JMD A;  4FNU A;  1O7D D;  2F7P A;  1H54 A;  1W5Z A;  4KTR A;  1N7N A;  2FUT A;  1NS8 A;  2YX9 A;  3NBJ A;  2CFK A;  3A0O A;  2WCO A;  1JZ8 A;  3X41 A;  2BRW A;  1LF6 A;  1IU7 A;  1OJP A;  1HMU A;  1WMP A;  1NSM A;  3VD9 A;  2CQT A;  1QWN A;  2BRV X;  2D73 A;  1V7X A;  1NKG A;  1QWU A;  3S4C A;  4OJZ A;  2EAB A;  2WVY A;  3EJT A;  3BUI A;  1JRQ A;  3T08 A;  3MPH A;  3EJP A;  3NJX A;  2CG0 A;  4UFC A;  1WMO A;  1W6C A;  1L7K A;  1SO0 A;  4FNQ A;  3BVU A;  3N9H A;  1QX1 A;  4KTP A;  1YGA A;  1W7C A;  5GW7 A;  2BRP A;  1A2V A;  3ACS A;  1X1H A;  1IQX A;  3DYO A;  2E24 A;  1UI8 A;  3BUD A;  3IMH A;  1D6U A;  4KFF A;  2XHN A;  1LOH A;  1TQW A;  2CFL A;  1TQU A;  3VDB A;  3NRE A;  1C82 A;  3BUQ A;  2HTB A;  1AVL A;  3OB8 A;  1MMU A;  3SEP A;  3T0B A;  3WVF A;  1X1I A;  3D4Z A;  1JZ6 A;  3K5T A;  2WW2 A;  3QFZ A;  3D4Y A;  3BVX A;  1AVK A;  1F9G A;  4AQ0 A;  1JOV A;  2WW0 A;  2WDA A;  2CWT A;  3A24 A;  2XSG A;  1R33 A;  1NS2 A;  3IAQ A;  3AMO B;  1LXK A;  2HTA A;  4K35 A;  3J7H A;  3CV5 A;  2Q1F A;  3ACT A;  3QFY A;  3MV0 1;  1RW9 A;  1D6Z A;  2JKE A;  1DYU A;  1Z45 A;  1JZ5 A;  1MMZ A;  3CZN A;  3MV1 1;  1TQV A;  3Q1N A;  3CZJ A;  1K1Y A;  3BLB A;  3VD7 A;  1JZ2 A;  2WOH A;  3E7J A;  1F4H A;  1IVV A;  2WVX B;  4DUW A;  1EGU A; 
#chains in the Genus database with same CATH homology
 1DP0 A;  3NJX A;  4MMH A;  1N7P A;  3E80 A;  3DCD A;  2WW3 A;  3T0D A;  1SNZ A;  1L7K A;  2E22 A;  1SO0 A;  5JMF A;  1JYV A;  1YQ2 A;  1L7J A;  3WFA A;  1JYW A;  4BZG A;  4TTG A;  3MWX A;  1NSU A;  3VDA A;  3VD4 A;  2ZQ0 A;  1HM2 A;  3DYM A;  1N7O A;  1RWH A;  3MUZ 1;  1PX4 A;  4BZE A;  1YGA A;  5A1A A;  2WW1 A;  1JYN A;  2CIR A;  4RNL A;  2BRP A;  1CB8 A;  1NSS A;  4BZH A;  1X1H A;  3DYO A;  1ULV A;  2E24 A;  3ECQ A;  3I3E A;  1NS7 A;  3IMH A;  1W3Y A;  1F4A A;  2CIQ A;  3I3D A;  2XHN A;  1LOH A;  3DYP A;  1LXM A;  2CIS A;  4DUX A;  3VDB A;  3NRE A;  1J0M A;  1HM3 A;  1C82 A;  2HTB A;  3OS7 A;  1HN0 A;  2X03 A;  3T09 A;  1PX3 A;  1N7Q A;  3IAP A;  4FNV A;  4BZF A;  1JZ4 A;  3AFL A;  1JZ7 A;  3OB8 A;  1NSZ A;  1MMU A;  1RWC A;  1RWA A;  3SEP A;  3TY1 A;  1NS4 A;  3DEC A;  1UG9 A;  3T0B A;  1HN1 A;  3WVF A;  1NSV A;  3VSM A;  1X1I A;  1JZ6 A;  3E1F 1;  4DUV A;  2WW2 A;  1LF9 A;  1F9G A;  4OK2 A;  5JMD A;  3VD3 A;  4AQ0 A;  1RWG A;  1JOV A;  2WW0 A;  1OJN A;  2WDA A;  3K25 A;  1NS0 A;  3A24 A;  2XSG A;  4MMI A;  1NS2 A;  1MMX A;  3OBA A;  2WZS A;  1TXK A;  1N7N A;  2FUT A;  3IAQ A;  1NS8 A;  2FUQ A;  1LXK A;  3BGA A;  4OK4 A;  2HTA A;  1JYX A;  4J5T A;  3VSN A;  3J7H A;  3A0O A;  1MMY A;  1NSR A;  1F1S A;  2Q1F A;  3VDC A;  2ZXQ A;  2WCO A;  1JZ8 A;  1K1W A;  2BRW A;  3T0A A;  3MV0 1;  1I8Q A;  1RW9 A;  1JZ3 A;  1LF6 A;  2JKE A;  2WVZ A;  1LUR A;  1OJP A;  1HMU A;  1NSM A;  1Z45 A;  3VD9 A;  3T2P A;  3BS6 A;  1HMW A;  1N7R A;  1MN0 A;  1OJO A;  2BRV X;  4NEI A;  3NJV A;  3I3B A;  2D73 A;  1JZ5 A;  1MMZ A;  1OJM A;  3MV1 1;  1NKG A;  3Q1N A;  2JKP A;  3CZJ A;  1X1J A;  1K1Y A;  3VD7 A;  1J0N A;  3T2Q A;  3T2O A;  1JZ2 A;  5E1Q A;  3BLC A;  3MUY 1;  4OJZ A;  3E7J A;  2JKA A;  1F4H A;  2WVY A;  1RWF A;  2WVX B;  4DUW A;  1NSX A;  2WVX A;  3VD5 A;  1K1X A;  1EGU A;  3T08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...