1MMZA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with l-arabinose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 97
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmzA00
2BRWA 3SEPA 1N7OA 1F9GA 1J0MA 1NSSA 3I3BA 2D73A 2WVXA 1X1JA 3DYPA 3IMHA 2CIQA 3VD5A 1SNZA 1OJNA 2WZSA 3NJVA 3NREA 1L7JA 1JOVA 3DECA 1I8QA 3VD3A 1MMYA 1N7PA 3A24A 2WW1A 1NS2A 1JZ7A 1MMUA 3MUY1 2Q1FA 4TTGA 1F4HA 1SO0A 2ZXQA 5E1QA 3WFAA 1LXMA 1JZ3A 1EGUA 3VDAA 2XSGA 1PX3A 2E22A 3CZJA 1NSVA 1NSUA 3MUZ1 1PX4A 3T0BA 1C82A 2ZQ0A 1RW9A 1JYWA 1W3YA 1YGAA 2WW3A 2HTBA 3MV01 1JYNA 3BGAA 1JYXA 1N7RA 3MV11 3ECQA 3IAPA 1NS7A 3OS7A 2WVXB 1HMUA 3T09A 3T08A 4AQ0A 1NKGA 1LF9A 2JKEA 3I3EA 1HM3A 1RWHA 3MWXA 1LF6A 1K1YA 3K25A 1LXKA 2HTAA 4BZFA 1LOHA 3OB8A 1RWGA 3T0DA 1ULVA 1OJPA 2CISA 5A1AA 1L7KA 2WW2A 1NS4A 3T2OA 4RNLA 1RWCA 1RWAA 1F1SA 2BRPA 2WDAA 2BRVX 4DUVA 3VD9A 1X1HA 3T2QA 3E1F1 1K1XA 3DCDA 2CIRA 1N7NA 1HN0A 1LURA 1F4AA 1HM2A 1UG9A 1JYVA 3VD7A 3J7HA 3OBAA 1MMXA 3NJXA 1OJMA 3VDCA 2WVZA 1J0NA 1Z45A 2XHNA 1JZ4A 1HN1A 1MN0A 4DUXA 2JKPA 3IAQA 1JZ8A 2WVYA 3VD4A 2WCOA 1CB8A 1NS0A 1YQ2A 1JZ6A 3DYOA 1TXKA 4BZEA 3T2PA 1K1WA 1MMZA 3VDBA 2E24A 2X03A 1JZ2A 3T0AA 1NSMA 1JZ5A 1N7QA 1NS8A 1DP0A 1NSZA 1RWFA 1X1IA 2JKAA 3DYMA 3Q1NA 1NSRA 1HMWA 1NSXA 3I3DA 1OJOA 4BZHA 2WW0A 4BZGA 4DUWA
chains in the Genus database with same CATH superfamily
2BRWA 3DX0A 2F7RA 1R34A 2D73A 4OJZA 2EACA 1W4NA 2F7OA 3X3XA 4FNPA 3DECA 3RSYA 2Y73A 3BLBA 1SO0A 1US1A 4KFFA 3WIQA 3BS6A 3BVXA 3T0BA 3BUDA 3E80A 3WVFA 5CA3A 1HMUA 3BUBA 1LF9A 1LXKA 2OW7A 4KTPA 3OB8A 1RWGA 3T0DA 3N9HA 3LOYA 5A1AA 1L7KA 2C11A 1D6UA 3WA2X 1W7CA 5KBPA 4UFCA 4DUVA 3MI6A 3W7SA 2EADA 3DCDA 1N7NA 3D3IA 1IVVA 1LURA 2CFLA 1PU4A 1MMXA 3VDCA 1TU5A 1J0NA 2XHNA 1JRQA 2WVYA 1CB8A 1NS0A 1JZ6A 3AFJA 4EV5A 1K1WA 2CFDA 3PGBA 3QG0A 2X03A 1JZ2A 2CWTA 4BTYA 1NSMA 1AV4A 3EJPA 1RWFA 2JKAA 1X1IA 3DYMA 3Q1NA 1NSRA 1QWUA 1OJOA 3CV5A 2F18A 3VD5A 1X1JA 2CG1A 1SNZA 3VSMA 3HIGA 1L7JA 3D52A 1N9EA 1QX1A 3D50A 1I8QA 3VD3A 3A24A 3S4AA 3EJUA 1JZ7A 1LVNA 3MUY1 2Q1FA 1AVLA 1LXMA 2FUTA 1JZ3A 3VDAA 1PX3A 2E22A 4KFDA 1NSVA 3DX3A 1NSUA 3MUZ1 1PX4A 2ZQ0A 3QFYA 3QFZA 2F7QA 1W3YA 2EAEA 1D6ZA 1IVWA 3DDFA 1RJOA 3CZSA 1W5ZA 4K3AA 4MMHA 1NKGA 3AFLA 4FNQA 2WYHA 3K25A 4BZFA 2HTAA 3SXXA 4MMIA 1WMOA 2E2UA 1TQSA 3X3YA 3CZNA 1NS4A 3D51A 1RWCA 1F1SA 2WDAA 3T2QA 2WYIA 3E1F1 4K35A 1EKMA 1HM2A 1HWWA 1WMNA 3VD7A 3X42A 1OJMA 2WVZA 1Z45A 1HN1A 3W7WA 1MN0A 1TQUA 1W6GA 3EJQA 1QWNA 2XN1A 3D4ZA 3VD4A 4EV2A 2WCOA 1YQ2A 4FNUA 3DYOA 1SPUA 3RRSA 2C10A 2CQSA 4J5TA 3SX1A 1MMZA 3VDBA 3T0AA 1AVKA 2XN2A 4KTRA 2ALWA 1UI7A 3EJRA 4BTXA 4FNTA 3I3DA 2WW0A 3SEPA 1N7OA 1F9GA 1J0MA 1NSSA 3NBJA 3IMHA 4FNRA 4NEIA 3X40A 3BUPA 3LVTA 3NJVA 1JOVA 2CFGA 1N7PA 2WW1A 1MMUA 3S4DA 1F4HA 2ZXQA 5E1QA 3TY1A 1EGUA 2XN0A 2XSGA 3A0OA 1C82A 2HTBA 1UI8A 3BGAA 1N7RA 3MV11 3ECQA 2F7PA 1NS7A 2D1WA 3S4CA 2FYVA 3T08A 2WGQA 2JKEA 1LF6A 1OACA 3W7TA 2WOFA 3D4YA 1ULVA 3BLCA 2CISA 1V7VA 2PNCA 3DX2A 2WW2A 3T2OA 2CG0A 3VD9A 1X1HA 3AMOA 3BVUA 3W7UA 1F4AA 2CFKA 1UG9A 1JYVA 2YX9A 3J7HA 3NBBA 1QALA 3KN4A 1TQTA 2OOVC 2CWUA 4DUXA 2JKPA 3IAQA 1SIHA 1DYUA 2W0QA 1TXKA 4OK2A 3X3ZA 1O7DD 3S4BA 3T2PA 2E24A 3W7XA 1N7QA 1D6YA 2BT3A 1IVUA 1NS8A 3E7JA 1DP0A 1NSZA 3ACTA 1V7WA 1KSIA 3AMOB 1HMWA 1NSXA 1W2ZA 4BZGA 2OQEC 4DUWA 3BVWA 3I3BA 2RDYA 2WVXA 3DYPA 2CWVA 2CIQA 4BTWA 1H54A 1V7XA 1OJNA 2WZSA 3HIIA 3NREA 1IQXA 3HI7A 2WO0A 1MMYA 1NS2A 4FNSA 1QAKA 4TTGA 3WFAA 1A2VA 1TQVA 2OW6A 3CZJA 2OOVA 1SIIA 1RW9A 1JYWA 1RKYA 1YGAA 3QDEA 2EABA 2WW3A 2F1AA 1HTYA 3MV01 2CQTA 1JYXA 3IAPA 3OS7A 2WVXB 4OK4A 3VSNA 3T09A 1IU7A 4AQ0A 5GW7A 3BUIA 2FUQA 3I3EA 1HM3A 1RWHA 3MWXA 3K5TA 1K1YA 3ACSA 3KIIA 1LOHA 3DX1A 1OJPA 2WOHA 3BUQA 3WIRA 3DDGA 1IQYA 3X41A 3ALAA 3EJSA 5JMFA 3T0UA 3MPHA 4RNLA 1RWAA 2E2VA 2BRPA 2OQEA 2BRVX 2CFWA 1PS3A 4KFEA 1K1XA 4FNVA 2CIRA 3BVVA 1HN0A 3WA3A 3OBAA 1HXKA 3NJXA 1TQWA 2F1BA 5JMDA 1JZ4A 2YFNA 2Y74A 1W6CA 1WMPA 1JZ8A 1IVXA 2ZL8A 4BZEA 3EJTA 2YFOA 3BVTA 3DX4A 1QAFA 1R33A 2E2TA 1JZ5A 4BZHA 1JYNA
chains in the Genus database with same CATH topology
2BRWA 3SEPA 1N7OA 1F9GA 1J0MA 1NSSA 3I3BA 2D73A 2WVXA 1X1JA 3DYPA 3IMHA 2CIQA 3VD5A 1SNZA 4OJZA 4NEIA 1OJNA 2WZSA 3VSMA 3NJVA 3NREA 1L7JA 1JOVA 3DECA 1I8QA 3VD3A 1MMYA 1N7PA 3A24A 2WW1A 1NS2A 1JZ7A 1MMUA 3MUY1 2Q1FA 4TTGA 1F4HA 1SO0A 2ZXQA 5E1QA 3WFAA 1LXMA 2FUTA 3TY1A 1JZ3A 1EGUA 3VDAA 2XSGA 1PX3A 2E22A 3A0OA 1NSVA 3BS6A 1NSUA 3CZJA 3MUZ1 1PX4A 3T0BA 1C82A 2ZQ0A 1RW9A 1JYWA 1W3YA 1YGAA 2WW3A 3E80A 2HTBA 3WVFA 3MV01 1JYNA 3BGAA 1JYXA 1N7RA 3MV11 3ECQA 3IAPA 1NS7A 3OS7A 2WVXB 4OK4A 1HMUA 3T09A 3T08A 3VSNA 4AQ0A 4MMHA 2FUQA 1NKGA 1LF9A 2JKEA 3I3EA 1HM3A 1RWHA 3AFLA 3MWXA 1LF6A 1K1YA 3K25A 1LXKA 2HTAA 4BZFA 1LOHA 3OB8A 1RWGA 3T0DA 1ULVA 4MMIA 3BLCA 1OJPA 2CISA 5A1AA 1L7KA 2WW2A 5JMFA 1NS4A 3T2OA 4RNLA 1RWCA 1RWAA 1F1SA 2BRPA 2WDAA 2BRVX 4DUVA 3VD9A 1X1HA 3T2QA 3E1F1 1K1XA 4FNVA 3DCDA 2CIRA 1N7NA 1HN0A 1LURA 1F4AA 1HM2A 1UG9A 1JYVA 3VD7A 3J7HA 3OBAA 1MMXA 3NJXA 1OJMA 3VDCA 2WVZA 5JMDA 1J0NA 1Z45A 2XHNA 1JZ4A 1HN1A 1MN0A 4DUXA 2JKPA 3IAQA 1JZ8A 2WVYA 3VD4A 2WCOA 1CB8A 1NS0A 1YQ2A 1JZ6A 3DYOA 1TXKA 4OK2A 4BZEA 3T2PA 1K1WA 4J5TA 1MMZA 3VDBA 2E24A 2X03A 1JZ2A 3T0AA 1NSMA 1JZ5A 1N7QA 1NS8A 3E7JA 1DP0A 1NSZA 1RWFA 1X1IA 2JKAA 3DYMA 3Q1NA 1NSRA 1HMWA 1NSXA 3I3DA 1OJOA 4BZHA 2WW0A 4BZGA 4DUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRW A;  3SEP A;  1N7O A;  1F9G A;  1J0M A;  1NSS A;  3I3B A;  2D73 A;  2WVX A;  1X1J A;  3DYP A;  3IMH A;  2CIQ A;  3VD5 A;  1SNZ A;  1OJN A;  2WZS A;  3NJV A;  3NRE A;  1L7J A;  1JOV A;  3DEC A;  1I8Q A;  3VD3 A;  1MMY A;  1N7P A;  3A24 A;  2WW1 A;  1NS2 A;  1JZ7 A;  1MMU A;  3MUY 1;  2Q1F A;  4TTG A;  1F4H A;  1SO0 A;  2ZXQ A;  5E1Q A;  3WFA A;  1LXM A;  1JZ3 A;  1EGU A;  3VDA A;  2XSG A;  1PX3 A;  2E22 A;  3CZJ A;  1NSV A;  1NSU A;  3MUZ 1;  1PX4 A;  3T0B A;  1C82 A;  2ZQ0 A;  1RW9 A;  1JYW A;  1W3Y A;  1YGA A;  2WW3 A;  2HTB A;  3MV0 1;  1JYN A;  3BGA A;  1JYX A;  1N7R A;  3MV1 1;  3ECQ A;  3IAP A;  1NS7 A;  3OS7 A;  2WVX B;  1HMU A;  3T09 A;  3T08 A;  4AQ0 A;  1NKG A;  1LF9 A;  2JKE A;  3I3E A;  1HM3 A;  1RWH A;  3MWX A;  1LF6 A;  1K1Y A;  3K25 A;  1LXK A;  2HTA A;  4BZF A;  1LOH A;  3OB8 A;  1RWG A;  3T0D A;  1ULV A;  1OJP A;  2CIS A;  5A1A A;  1L7K A;  2WW2 A;  1NS4 A;  3T2O A;  4RNL A;  1RWC A;  1RWA A;  1F1S A;  2BRP A;  2WDA A;  2BRV X;  4DUV A;  3VD9 A;  1X1H A;  3T2Q A;  3E1F 1;  1K1X A;  3DCD A;  2CIR A;  1N7N A;  1HN0 A;  1LUR A;  1F4A A;  1HM2 A;  1UG9 A;  1JYV A;  3VD7 A;  3J7H A;  3OBA A;  1MMX A;  3NJX A;  1OJM A;  3VDC A;  2WVZ A;  1J0N A;  1Z45 A;  2XHN A;  1JZ4 A;  1HN1 A;  1MN0 A;  4DUX A;  2JKP A;  3IAQ A;  1JZ8 A;  2WVY A;  3VD4 A;  2WCO A;  1CB8 A;  1NS0 A;  1YQ2 A;  1JZ6 A;  3DYO A;  1TXK A;  4BZE A;  3T2P A;  1K1W A;  1MMZ A;  3VDB A;  2E24 A;  2X03 A;  1JZ2 A;  3T0A A;  1NSM A;  1JZ5 A;  1N7Q A;  1NS8 A;  1DP0 A;  1NSZ A;  1RWF A;  1X1I A;  2JKA A;  3DYM A;  3Q1N A;  1NSR A;  1HMW A;  1NSX A;  3I3D A;  1OJO A;  4BZH A;  2WW0 A;  4BZG A;  4DUW A; 
#chains in the Genus database with same CATH topology
 2BRW A;  3DX0 A;  2F7R A;  1R34 A;  2D73 A;  4OJZ A;  2EAC A;  1W4N A;  2F7O A;  3X3X A;  4FNP A;  3DEC A;  3RSY A;  2Y73 A;  3BLB A;  1SO0 A;  1US1 A;  4KFF A;  3WIQ A;  3BS6 A;  3BVX A;  3T0B A;  3BUD A;  3E80 A;  3WVF A;  5CA3 A;  1HMU A;  3BUB A;  1LF9 A;  1LXK A;  2OW7 A;  4KTP A;  3OB8 A;  1RWG A;  3T0D A;  3N9H A;  3LOY A;  5A1A A;  1L7K A;  2C11 A;  1D6U A;  3WA2 X;  1W7C A;  5KBP A;  4UFC A;  4DUV A;  3MI6 A;  3W7S A;  2EAD A;  3DCD A;  1N7N A;  3D3I A;  1IVV A;  1LUR A;  2CFL A;  1PU4 A;  1MMX A;  3VDC A;  1TU5 A;  1J0N A;  2XHN A;  1JRQ A;  2WVY A;  1CB8 A;  1NS0 A;  1JZ6 A;  3AFJ A;  4EV5 A;  1K1W A;  2CFD A;  3PGB A;  3QG0 A;  2X03 A;  1JZ2 A;  2CWT A;  4BTY A;  1NSM A;  1AV4 A;  3EJP A;  1RWF A;  2JKA A;  1X1I A;  3DYM A;  3Q1N A;  1NSR A;  1QWU A;  1OJO A;  3CV5 A;  2F18 A;  3VD5 A;  1X1J A;  2CG1 A;  1SNZ A;  3VSM A;  3HIG A;  1L7J A;  3D52 A;  1N9E A;  1QX1 A;  3D50 A;  1I8Q A;  3VD3 A;  3A24 A;  3S4A A;  3EJU A;  1JZ7 A;  1LVN A;  3MUY 1;  2Q1F A;  1AVL A;  1LXM A;  2FUT A;  1JZ3 A;  3VDA A;  1PX3 A;  2E22 A;  4KFD A;  1NSV A;  3DX3 A;  1NSU A;  3MUZ 1;  1PX4 A;  2ZQ0 A;  3QFY A;  3QFZ A;  2F7Q A;  1W3Y A;  2EAE A;  1D6Z A;  1IVW A;  3DDF A;  1RJO A;  3CZS A;  1W5Z A;  4K3A A;  4MMH A;  1NKG A;  3AFL A;  4FNQ A;  2WYH A;  3K25 A;  4BZF A;  2HTA A;  3SXX A;  4MMI A;  1WMO A;  2E2U A;  1TQS A;  3X3Y A;  3CZN A;  1NS4 A;  3D51 A;  1RWC A;  1F1S A;  2WDA A;  3T2Q A;  2WYI A;  3E1F 1;  4K35 A;  1EKM A;  1HM2 A;  1HWW A;  1WMN A;  3VD7 A;  3X42 A;  1OJM A;  2WVZ A;  1Z45 A;  1HN1 A;  3W7W A;  1MN0 A;  1TQU A;  1W6G A;  3EJQ A;  1QWN A;  2XN1 A;  3D4Z A;  3VD4 A;  4EV2 A;  2WCO A;  1YQ2 A;  4FNU A;  3DYO A;  1SPU A;  3RRS A;  2C10 A;  2CQS A;  4J5T A;  3SX1 A;  1MMZ A;  3VDB A;  3T0A A;  1AVK A;  2XN2 A;  4KTR A;  2ALW A;  1UI7 A;  3EJR A;  4BTX A;  4FNT A;  3I3D A;  2WW0 A;  3SEP A;  1N7O A;  1F9G A;  1J0M A;  1NSS A;  3NBJ A;  3IMH A;  4FNR A;  4NEI A;  3X40 A;  3BUP A;  3LVT A;  3NJV A;  1JOV A;  2CFG A;  1N7P A;  2WW1 A;  1MMU A;  3S4D A;  1F4H A;  2ZXQ A;  5E1Q A;  3TY1 A;  1EGU A;  2XN0 A;  2XSG A;  3A0O A;  1C82 A;  2HTB A;  1UI8 A;  3BGA A;  1N7R A;  3MV1 1;  3ECQ A;  2F7P A;  1NS7 A;  2D1W A;  3S4C A;  2FYV A;  3T08 A;  2WGQ A;  2JKE A;  1LF6 A;  1OAC A;  3W7T A;  2WOF A;  3D4Y A;  1ULV A;  3BLC A;  2CIS A;  1V7V A;  2PNC A;  3DX2 A;  2WW2 A;  3T2O A;  2CG0 A;  3VD9 A;  1X1H A;  3AMO A;  3BVU A;  3W7U A;  1F4A A;  2CFK A;  1UG9 A;  1JYV A;  2YX9 A;  3J7H A;  3NBB A;  1QAL A;  3KN4 A;  1TQT A;  2OOV C;  2CWU A;  4DUX A;  2JKP A;  3IAQ A;  1SIH A;  1DYU A;  2W0Q A;  1TXK A;  4OK2 A;  3X3Z A;  1O7D D;  3S4B A;  3T2P A;  2E24 A;  3W7X A;  1N7Q A;  1D6Y A;  2BT3 A;  1IVU A;  1NS8 A;  3E7J A;  1DP0 A;  1NSZ A;  3ACT A;  1V7W A;  1KSI A;  3AMO B;  1HMW A;  1NSX A;  1W2Z A;  4BZG A;  2OQE C;  4DUW A;  3BVW A;  3I3B A;  2RDY A;  2WVX A;  3DYP A;  2CWV A;  2CIQ A;  4BTW A;  1H54 A;  1V7X A;  1OJN A;  2WZS A;  3HII A;  3NRE A;  1IQX A;  3HI7 A;  2WO0 A;  1MMY A;  1NS2 A;  4FNS A;  1QAK A;  4TTG A;  3WFA A;  1A2V A;  1TQV A;  2OW6 A;  3CZJ A;  2OOV A;  1SII A;  1RW9 A;  1JYW A;  1RKY A;  1YGA A;  3QDE A;  2EAB A;  2WW3 A;  2F1A A;  1HTY A;  3MV0 1;  2CQT A;  1JYX A;  3IAP A;  3OS7 A;  2WVX B;  4OK4 A;  3VSN A;  3T09 A;  1IU7 A;  4AQ0 A;  5GW7 A;  3BUI A;  2FUQ A;  3I3E A;  1HM3 A;  1RWH A;  3MWX A;  3K5T A;  1K1Y A;  3ACS A;  3KII A;  1LOH A;  3DX1 A;  1OJP A;  2WOH A;  3BUQ A;  3WIR A;  3DDG A;  1IQY A;  3X41 A;  3ALA A;  3EJS A;  5JMF A;  3T0U A;  3MPH A;  4RNL A;  1RWA A;  2E2V A;  2BRP A;  2OQE A;  2BRV X;  2CFW A;  1PS3 A;  4KFE A;  1K1X A;  4FNV A;  2CIR A;  3BVV A;  1HN0 A;  3WA3 A;  3OBA A;  1HXK A;  3NJX A;  1TQW A;  2F1B A;  5JMD A;  1JZ4 A;  2YFN A;  2Y74 A;  1W6C A;  1WMP A;  1JZ8 A;  1IVX A;  2ZL8 A;  4BZE A;  3EJT A;  2YFO A;  3BVT A;  3DX4 A;  1QAF A;  1R33 A;  2E2T A;  1JZ5 A;  4BZH A;  1JYN A; 
#chains in the Genus database with same CATH homology
 2BRW A;  3SEP A;  1N7O A;  1F9G A;  1J0M A;  1NSS A;  3I3B A;  2D73 A;  2WVX A;  1X1J A;  3DYP A;  3IMH A;  2CIQ A;  3VD5 A;  1SNZ A;  4OJZ A;  4NEI A;  1OJN A;  2WZS A;  3VSM A;  3NJV A;  3NRE A;  1L7J A;  1JOV A;  3DEC A;  1I8Q A;  3VD3 A;  1MMY A;  1N7P A;  3A24 A;  2WW1 A;  1NS2 A;  1JZ7 A;  1MMU A;  3MUY 1;  2Q1F A;  4TTG A;  1F4H A;  1SO0 A;  2ZXQ A;  5E1Q A;  3WFA A;  1LXM A;  2FUT A;  3TY1 A;  1JZ3 A;  1EGU A;  3VDA A;  2XSG A;  1PX3 A;  2E22 A;  3A0O A;  1NSV A;  3BS6 A;  1NSU A;  3CZJ A;  3MUZ 1;  1PX4 A;  3T0B A;  1C82 A;  2ZQ0 A;  1RW9 A;  1JYW A;  1W3Y A;  1YGA A;  2WW3 A;  3E80 A;  2HTB A;  3WVF A;  3MV0 1;  1JYN A;  3BGA A;  1JYX A;  1N7R A;  3MV1 1;  3ECQ A;  3IAP A;  1NS7 A;  3OS7 A;  2WVX B;  4OK4 A;  1HMU A;  3T09 A;  3T08 A;  3VSN A;  4AQ0 A;  4MMH A;  2FUQ A;  1NKG A;  1LF9 A;  2JKE A;  3I3E A;  1HM3 A;  1RWH A;  3AFL A;  3MWX A;  1LF6 A;  1K1Y A;  3K25 A;  1LXK A;  2HTA A;  4BZF A;  1LOH A;  3OB8 A;  1RWG A;  3T0D A;  1ULV A;  4MMI A;  3BLC A;  1OJP A;  2CIS A;  5A1A A;  1L7K A;  2WW2 A;  5JMF A;  1NS4 A;  3T2O A;  4RNL A;  1RWC A;  1RWA A;  1F1S A;  2BRP A;  2WDA A;  2BRV X;  4DUV A;  3VD9 A;  1X1H A;  3T2Q A;  3E1F 1;  1K1X A;  4FNV A;  3DCD A;  2CIR A;  1N7N A;  1HN0 A;  1LUR A;  1F4A A;  1HM2 A;  1UG9 A;  1JYV A;  3VD7 A;  3J7H A;  3OBA A;  1MMX A;  3NJX A;  1OJM A;  3VDC A;  2WVZ A;  5JMD A;  1J0N A;  1Z45 A;  2XHN A;  1JZ4 A;  1HN1 A;  1MN0 A;  4DUX A;  2JKP A;  3IAQ A;  1JZ8 A;  2WVY A;  3VD4 A;  2WCO A;  1CB8 A;  1NS0 A;  1YQ2 A;  1JZ6 A;  3DYO A;  1TXK A;  4OK2 A;  4BZE A;  3T2P A;  1K1W A;  4J5T A;  1MMZ A;  3VDB A;  2E24 A;  2X03 A;  1JZ2 A;  3T0A A;  1NSM A;  1JZ5 A;  1N7Q A;  1NS8 A;  3E7J A;  1DP0 A;  1NSZ A;  1RWF A;  1X1I A;  2JKA A;  3DYM A;  3Q1N A;  1NSR A;  1HMW A;  1NSX A;  3I3D A;  1OJO A;  4BZH A;  2WW0 A;  4BZG A;  4DUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...