1MMZA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with l-arabinose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 97
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmzA00
3I3DA 1JOVA 2HTBA 1C82A 3IMHA 1OJNA 1F4AA 2WW2A 1W3YA 3IAQA 3NJXA 1OJPA 3J7HA 1MMXA 1CB8A 2ZXQA 3DYMA 1EGUA 3VD4A 3T0DA 1I8QA 3VDAA 1RW9A 1HM2A 3DYPA 1HMWA 1LXKA 1JYWA 3A24A 1RWFA 2WW3A 1JZ5A 1NS8A 1YGAA 1L7KA 2JKAA 1JZ8A 3VDBA 1X1JA 3T2PA 1LURA 1X1HA 4BZHA 1LF9A 3MV11 1F9GA 1N7OA 1JYXA 1NSXA 1NSMA 4RNLA 1MN0A 2BRPA 1LF6A 1NS4A 3VD9A 1N7NA 2WVYA 1TXKA 1K1WA 4BZGA 3IAPA 3BGAA 1MMYA 2CIQA 3VD7A 2CIRA 2BRVX 3I3EA 1YQ2A 4AQ0A 1JYVA 1Z45A 1ULVA 2WVXA 4TTGA 3ECQA 2XHNA 3OS7A 1NSRA 1NSZA 2WVZA 1N7PA 1RWHA 1DP0A 2WDAA 1JZ7A 3T2QA 3VD5A 3Q1NA 1F1SA 3VD3A 1HM3A 5E1QA 3T09A 2JKEA 2WCOA 2XSGA 2E22A 1SO0A 1NS0A 4BZEA 1RWAA 3SEPA 1PX4A 1HMUA 1NSSA 1NSUA 3CZJA 1J0NA 3NREA 1F4HA 1JZ6A 3MV01 2BRWA 1N7QA 3T08A 1K1YA 1L7JA 3T2OA 3K25A 1LOHA 1PX3A 3DECA 3OBAA 3T0BA 2D73A 1K1XA 4DUWA 1RWCA 3MWXA 3DCDA 2CISA 2WZSA 2WVXB 3E1F1 3MUY1 4DUVA 3T0AA 2HTAA 2Q1FA 2X03A 2JKPA 1NSVA 2WW1A 3WFAA 1JYNA 2E24A 1JZ4A 3I3BA 1NS7A 1J0MA 1HN1A 1JZ3A 4BZFA 3DYOA 1MMUA 1OJOA 3MUZ1 1SNZA 4DUXA 1OJMA 1LXMA 1N7RA 1HN0A 2ZQ0A 5A1AA 3VDCA 1X1IA 2WW0A 1JZ2A 3OB8A 1RWGA 1NKGA 1UG9A 1NS2A 1MMZA 3NJVA
chains in the Genus database with same CATH superfamily
1JOVA 2HTBA 3IMHA 1OJNA 1F4AA 1IQYA 1TQSA 3BUIA 1RKYA 1R33A 3DX0A 1HXKA 4BTXA 3DX2A 4OK2A 4FNRA 2ZXQA 3QFZA 3KIIA 3RRSA 2E2UA 3DX3A 2E2VA 1QWNA 1HMWA 1AVLA 1LXKA 3VSMA 2E2TA 2YFOA 1QWUA 3BVWA 1MN0A 3D50A 1LF6A 1WMNA 3VD9A 4KTRA 3IAPA 3BUPA 1MMYA 2CIQA 3VD7A 3X42A 3I3EA 1YQ2A 1IQXA 1Z45A 2F7RA 1UI8A 2WVZA 3W7UA 1F1SA 3HIIA 5E1QA 1IVVA 2WCOA 4FNSA 3EJUA 3EJSA 3MI6A 3W7SA 1PX4A 3KN4A 1NSUA 3NREA 3MPHA 2BRWA 2CG1A 4FNUA 2OQEA 1N7QA 3T08A 1HWWA 4MMHA 3OBAA 1EKMA 2CFDA 4DUWA 1K1XA 2D1WA 3DCDA 1JYNA 4OK4A 2CWVA 1JZ4A 3NBJA 3ALAA 4UFCA 4BTYA 1AVKA 1OJMA 2WYHA 1HN0A 3VSNA 3VDCA 1X1IA 3ACTA 3X40A 1RWGA 2CQTA 3RSYA 3S4AA 1NS2A 3SXXA 3EJRA 1IVWA 2FUTA 1UI7A 3HIGA 2Y74A 3NJXA 4FNVA 3LOYA 3AFJA 1MMXA 3DDFA 1A2VA 3DDGA 1D6YA 2OW7A 1I8QA 3T0DA 1HM2A 3DYPA 3BLBA 2W0QA 2WW3A 2WO0A 3D3IA 1JZ5A 2C10A 3VDBA 3PGBA 3T2PA 2BT3A 1D6ZA 1LURA 1PS3A 4EV5A 2C11A 4RNLA 3W7WA 2WOFA 1N7NA 1SIIA 2WVYA 2YFNA 3EJTA 4BZGA 1US1A 3BGAA 1DYUA 2CWTA 2CFGA 2BRVX 2YX9A 1JYVA 3LVTA 3ECQA 3BVUA 1N7PA 1IU7A 2WOHA 3W7TA 1JZ7A 3T2QA 3D4ZA 1H54A 2ZL8A 1W7CA 3AMOB 3T09A 2XSGA 1SPUA 3A0OA 2E22A 1NS0A 3SEPA 3CZJA 1WMOA 1JZ6A 2EAEA 1L7JA 3T2OA 3DECA 3N9HA 2CFWA 1RWCA 2WZSA 3MUY1 4K3AA 4DUVA 1KSIA 2Q1FA 2JKPA 1JRQA 1NS7A 3DYOA 1PU4A 1OJOA 3BVXA 3QFYA 1W4NA 2ALWA 1LXMA 5CA3A 1OACA 1TQWA 4NEIA 1MMZA 4KFFA 3NJVA 2WGQA 2CQSA 1C82A 1R34A 2XN1A 3BS6A 3BVTA 2CFKA 3IAQA 3BUDA 3BUQA 3J7HA 1CB8A 3WA2X 1N9EA 3VD4A 3VDAA 5JMFA 2OW6A 1NS8A 3WIQA 1YGAA 1QALA 1X1JA 3X3ZA 3BVVA 1X1HA 4J5TA 3DX4A 1F9GA 1N7OA 1JYXA 1HTYA 2Y73A 2WYIA 3QDEA 3T0UA 1K1WA 2CWUA 5JMDA 3BUBA 3S4DA 2CFLA 3CZSA 4TTGA 2WVXA 2XHNA 1TQVA 3OS7A 1NSZA 1RWHA 1DP0A 2WDAA 3CZNA 3Q1NA 2OOVC 3VD3A 2EADA 4BTWA 1HM3A 2JKEA 2F7OA 4BZEA 1RWAA 1IVXA 1NSSA 1AV4A 1F4HA 3MV01 3D51A 2CG0A 1LVNA 3K25A 1PX3A 3DX1A 2CISA 3E1F1 3ACSA 3T0AA 2HTAA 2X03A 4KTPA 1NSVA 2RDYA 2WW1A 3WFAA 3WA3A 2E24A 3TY1A 3I3BA 1TQUA 2XN0A 4K35A 3MUZ1 4FNPA 1SNZA 4DUXA 2WW0A 1JZ2A 3OB8A 1UG9A 2EACA 3E80A 3I3DA 3WIRA 4FNTA 5GW7A 3X3XA 3AMOA 2WW2A 1W3YA 1V7WA 2FYVA 1OJPA 1TQTA 3DYMA 1EGUA 1RW9A 1JYWA 3A24A 2EABA 1RWFA 3E7JA 3S4BA 1L7KA 2JKAA 1JZ8A 1IVUA 4BZHA 1LF9A 3MV11 4KFDA 1V7XA 1NSXA 3BLCA 3D4YA 1NSMA 2PNCA 2F1AA 2F7QA 2BRPA 1W5ZA 3QG0A 1NS4A 3SX1A 1TXKA 1D6UA 4OJZA 3X3YA 2CIRA 1SIHA 4AQ0A 1ULVA 2XN2A 1NSRA 1TU5A 2OOVA 3VD5A 3HI7A 2F1BA 1W6GA 1SO0A 2F7PA 1W2ZA 4MMIA 1HMUA 3K5TA 5KBPA 1J0NA 3AFLA 3S4CA 1W6CA 1K1YA 2OQEC 1LOHA 3CV5A 3T0BA 2D73A 3MWXA 3D52A 3EJPA 4KFEA 3WVFA 3EJQA 2WVXB 1WMPA 3X41A 2F18A 1JZ3A 1J0MA 1HN1A 1V7VA 4BZFA 1MMUA 2FUQA 1QAKA 4EV2A 1QX1A 1QAFA 4FNQA 1N7RA 2ZQ0A 5A1AA 3NBBA 1O7DD 3W7XA 1NKGA 1RJOA
chains in the Genus database with same CATH topology
3I3DA 1JOVA 2HTBA 2FUTA 1C82A 3IMHA 1OJNA 3BS6A 1F4AA 2WW2A 1W3YA 3IAQA 3NJXA 1OJPA 4FNVA 4OK2A 3J7HA 1MMXA 1CB8A 2ZXQA 3DYMA 1EGUA 3VD4A 3T0DA 1I8QA 3VDAA 5JMFA 1RW9A 1HM2A 3DYPA 1HMWA 1LXKA 1JYWA 3A24A 3VSMA 1RWFA 2WW3A 3E7JA 1JZ5A 1NS8A 1YGAA 1L7KA 2JKAA 1JZ8A 3VDBA 1X1JA 3T2PA 1LURA 1X1HA 4J5TA 4BZHA 1LF9A 3MV11 1F9GA 1N7OA 1JYXA 3BLCA 1NSXA 1NSMA 4RNLA 1MN0A 2BRPA 1LF6A 1NS4A 3VD9A 1N7NA 2WVYA 1TXKA 1K1WA 4BZGA 3IAPA 3BGAA 4OJZA 5JMDA 1MMYA 2CIQA 3VD7A 2CIRA 2BRVX 3I3EA 1YQ2A 4AQ0A 1JYVA 1Z45A 1ULVA 2WVXA 4TTGA 3ECQA 2XHNA 3OS7A 1NSRA 1NSZA 2WVZA 1N7PA 1RWHA 1DP0A 2WDAA 1JZ7A 3T2QA 3VD5A 3Q1NA 1F1SA 3VD3A 1HM3A 5E1QA 3T09A 2JKEA 2WCOA 2XSGA 3A0OA 2E22A 1SO0A 1NS0A 4BZEA 1RWAA 3SEPA 1PX4A 4MMIA 1HMUA 1NSSA 1NSUA 3CZJA 1J0NA 3AFLA 3NREA 1F4HA 1JZ6A 3MV01 2BRWA 1N7QA 3T08A 1K1YA 1L7JA 4MMHA 3T2OA 3K25A 1LOHA 1PX3A 3DECA 3OBAA 3T0BA 2D73A 1K1XA 4DUWA 1RWCA 3MWXA 3DCDA 2CISA 3WVFA 2WZSA 2WVXB 3E1F1 3MUY1 4DUVA 3T0AA 2HTAA 2Q1FA 2X03A 2JKPA 1NSVA 2WW1A 3WFAA 1JYNA 4OK4A 2E24A 3TY1A 1JZ4A 3I3BA 1NS7A 1J0MA 1HN1A 1JZ3A 4BZFA 3DYOA 1MMUA 2FUQA 1OJOA 3MUZ1 1SNZA 4DUXA 1OJMA 1LXMA 1N7RA 3VSNA 1HN0A 2ZQ0A 5A1AA 3VDCA 1X1IA 2WW0A 1JZ2A 3OB8A 1RWGA 1NKGA 1UG9A 1NS2A 4NEIA 1MMZA 3NJVA 3E80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3D A;  1JOV A;  2HTB A;  1C82 A;  3IMH A;  1OJN A;  1F4A A;  2WW2 A;  1W3Y A;  3IAQ A;  3NJX A;  1OJP A;  3J7H A;  1MMX A;  1CB8 A;  2ZXQ A;  3DYM A;  1EGU A;  3VD4 A;  3T0D A;  1I8Q A;  3VDA A;  1RW9 A;  1HM2 A;  3DYP A;  1HMW A;  1LXK A;  1JYW A;  3A24 A;  1RWF A;  2WW3 A;  1JZ5 A;  1NS8 A;  1YGA A;  1L7K A;  2JKA A;  1JZ8 A;  3VDB A;  1X1J A;  3T2P A;  1LUR A;  1X1H A;  4BZH A;  1LF9 A;  3MV1 1;  1F9G A;  1N7O A;  1JYX A;  1NSX A;  1NSM A;  4RNL A;  1MN0 A;  2BRP A;  1LF6 A;  1NS4 A;  3VD9 A;  1N7N A;  2WVY A;  1TXK A;  1K1W A;  4BZG A;  3IAP A;  3BGA A;  1MMY A;  2CIQ A;  3VD7 A;  2CIR A;  2BRV X;  3I3E A;  1YQ2 A;  4AQ0 A;  1JYV A;  1Z45 A;  1ULV A;  2WVX A;  4TTG A;  3ECQ A;  2XHN A;  3OS7 A;  1NSR A;  1NSZ A;  2WVZ A;  1N7P A;  1RWH A;  1DP0 A;  2WDA A;  1JZ7 A;  3T2Q A;  3VD5 A;  3Q1N A;  1F1S A;  3VD3 A;  1HM3 A;  5E1Q A;  3T09 A;  2JKE A;  2WCO A;  2XSG A;  2E22 A;  1SO0 A;  1NS0 A;  4BZE A;  1RWA A;  3SEP A;  1PX4 A;  1HMU A;  1NSS A;  1NSU A;  3CZJ A;  1J0N A;  3NRE A;  1F4H A;  1JZ6 A;  3MV0 1;  2BRW A;  1N7Q A;  3T08 A;  1K1Y A;  1L7J A;  3T2O A;  3K25 A;  1LOH A;  1PX3 A;  3DEC A;  3OBA A;  3T0B A;  2D73 A;  1K1X A;  4DUW A;  1RWC A;  3MWX A;  3DCD A;  2CIS A;  2WZS A;  2WVX B;  3E1F 1;  3MUY 1;  4DUV A;  3T0A A;  2HTA A;  2Q1F A;  2X03 A;  2JKP A;  1NSV A;  2WW1 A;  3WFA A;  1JYN A;  2E24 A;  1JZ4 A;  3I3B A;  1NS7 A;  1J0M A;  1HN1 A;  1JZ3 A;  4BZF A;  3DYO A;  1MMU A;  1OJO A;  3MUZ 1;  1SNZ A;  4DUX A;  1OJM A;  1LXM A;  1N7R A;  1HN0 A;  2ZQ0 A;  5A1A A;  3VDC A;  1X1I A;  2WW0 A;  1JZ2 A;  3OB8 A;  1RWG A;  1NKG A;  1UG9 A;  1NS2 A;  1MMZ A;  3NJV A; 
#chains in the Genus database with same CATH topology
 1JOV A;  2HTB A;  3IMH A;  1OJN A;  1F4A A;  1IQY A;  1TQS A;  3BUI A;  1RKY A;  1R33 A;  3DX0 A;  1HXK A;  4BTX A;  3DX2 A;  4OK2 A;  4FNR A;  2ZXQ A;  3QFZ A;  3KII A;  3RRS A;  2E2U A;  3DX3 A;  2E2V A;  1QWN A;  1HMW A;  1AVL A;  1LXK A;  3VSM A;  2E2T A;  2YFO A;  1QWU A;  3BVW A;  1MN0 A;  3D50 A;  1LF6 A;  1WMN A;  3VD9 A;  4KTR A;  3IAP A;  3BUP A;  1MMY A;  2CIQ A;  3VD7 A;  3X42 A;  3I3E A;  1YQ2 A;  1IQX A;  1Z45 A;  2F7R A;  1UI8 A;  2WVZ A;  3W7U A;  1F1S A;  3HII A;  5E1Q A;  1IVV A;  2WCO A;  4FNS A;  3EJU A;  3EJS A;  3MI6 A;  3W7S A;  1PX4 A;  3KN4 A;  1NSU A;  3NRE A;  3MPH A;  2BRW A;  2CG1 A;  4FNU A;  2OQE A;  1N7Q A;  3T08 A;  1HWW A;  4MMH A;  3OBA A;  1EKM A;  2CFD A;  4DUW A;  1K1X A;  2D1W A;  3DCD A;  1JYN A;  4OK4 A;  2CWV A;  1JZ4 A;  3NBJ A;  3ALA A;  4UFC A;  4BTY A;  1AVK A;  1OJM A;  2WYH A;  1HN0 A;  3VSN A;  3VDC A;  1X1I A;  3ACT A;  3X40 A;  1RWG A;  2CQT A;  3RSY A;  3S4A A;  1NS2 A;  3SXX A;  3EJR A;  1IVW A;  2FUT A;  1UI7 A;  3HIG A;  2Y74 A;  3NJX A;  4FNV A;  3LOY A;  3AFJ A;  1MMX A;  3DDF A;  1A2V A;  3DDG A;  1D6Y A;  2OW7 A;  1I8Q A;  3T0D A;  1HM2 A;  3DYP A;  3BLB A;  2W0Q A;  2WW3 A;  2WO0 A;  3D3I A;  1JZ5 A;  2C10 A;  3VDB A;  3PGB A;  3T2P A;  2BT3 A;  1D6Z A;  1LUR A;  1PS3 A;  4EV5 A;  2C11 A;  4RNL A;  3W7W A;  2WOF A;  1N7N A;  1SII A;  2WVY A;  2YFN A;  3EJT A;  4BZG A;  1US1 A;  3BGA A;  1DYU A;  2CWT A;  2CFG A;  2BRV X;  2YX9 A;  1JYV A;  3LVT A;  3ECQ A;  3BVU A;  1N7P A;  1IU7 A;  2WOH A;  3W7T A;  1JZ7 A;  3T2Q A;  3D4Z A;  1H54 A;  2ZL8 A;  1W7C A;  3AMO B;  3T09 A;  2XSG A;  1SPU A;  3A0O A;  2E22 A;  1NS0 A;  3SEP A;  3CZJ A;  1WMO A;  1JZ6 A;  2EAE A;  1L7J A;  3T2O A;  3DEC A;  3N9H A;  2CFW A;  1RWC A;  2WZS A;  3MUY 1;  4K3A A;  4DUV A;  1KSI A;  2Q1F A;  2JKP A;  1JRQ A;  1NS7 A;  3DYO A;  1PU4 A;  1OJO A;  3BVX A;  3QFY A;  1W4N A;  2ALW A;  1LXM A;  5CA3 A;  1OAC A;  1TQW A;  4NEI A;  1MMZ A;  4KFF A;  3NJV A;  2WGQ A;  2CQS A;  1C82 A;  1R34 A;  2XN1 A;  3BS6 A;  3BVT A;  2CFK A;  3IAQ A;  3BUD A;  3BUQ A;  3J7H A;  1CB8 A;  3WA2 X;  1N9E A;  3VD4 A;  3VDA A;  5JMF A;  2OW6 A;  1NS8 A;  3WIQ A;  1YGA A;  1QAL A;  1X1J A;  3X3Z A;  3BVV A;  1X1H A;  4J5T A;  3DX4 A;  1F9G A;  1N7O A;  1JYX A;  1HTY A;  2Y73 A;  2WYI A;  3QDE A;  3T0U A;  1K1W A;  2CWU A;  5JMD A;  3BUB A;  3S4D A;  2CFL A;  3CZS A;  4TTG A;  2WVX A;  2XHN A;  1TQV A;  3OS7 A;  1NSZ A;  1RWH A;  1DP0 A;  2WDA A;  3CZN A;  3Q1N A;  2OOV C;  3VD3 A;  2EAD A;  4BTW A;  1HM3 A;  2JKE A;  2F7O A;  4BZE A;  1RWA A;  1IVX A;  1NSS A;  1AV4 A;  1F4H A;  3MV0 1;  3D51 A;  2CG0 A;  1LVN A;  3K25 A;  1PX3 A;  3DX1 A;  2CIS A;  3E1F 1;  3ACS A;  3T0A A;  2HTA A;  2X03 A;  4KTP A;  1NSV A;  2RDY A;  2WW1 A;  3WFA A;  3WA3 A;  2E24 A;  3TY1 A;  3I3B A;  1TQU A;  2XN0 A;  4K35 A;  3MUZ 1;  4FNP A;  1SNZ A;  4DUX A;  2WW0 A;  1JZ2 A;  3OB8 A;  1UG9 A;  2EAC A;  3E80 A;  3I3D A;  3WIR A;  4FNT A;  5GW7 A;  3X3X A;  3AMO A;  2WW2 A;  1W3Y A;  1V7W A;  2FYV A;  1OJP A;  1TQT A;  3DYM A;  1EGU A;  1RW9 A;  1JYW A;  3A24 A;  2EAB A;  1RWF A;  3E7J A;  3S4B A;  1L7K A;  2JKA A;  1JZ8 A;  1IVU A;  4BZH A;  1LF9 A;  3MV1 1;  4KFD A;  1V7X A;  1NSX A;  3BLC A;  3D4Y A;  1NSM A;  2PNC A;  2F1A A;  2F7Q A;  2BRP A;  1W5Z A;  3QG0 A;  1NS4 A;  3SX1 A;  1TXK A;  1D6U A;  4OJZ A;  3X3Y A;  2CIR A;  1SIH A;  4AQ0 A;  1ULV A;  2XN2 A;  1NSR A;  1TU5 A;  2OOV A;  3VD5 A;  3HI7 A;  2F1B A;  1W6G A;  1SO0 A;  2F7P A;  1W2Z A;  4MMI A;  1HMU A;  3K5T A;  5KBP A;  1J0N A;  3AFL A;  3S4C A;  1W6C A;  1K1Y A;  2OQE C;  1LOH A;  3CV5 A;  3T0B A;  2D73 A;  3MWX A;  3D52 A;  3EJP A;  4KFE A;  3WVF A;  3EJQ A;  2WVX B;  1WMP A;  3X41 A;  2F18 A;  1JZ3 A;  1J0M A;  1HN1 A;  1V7V A;  4BZF A;  1MMU A;  2FUQ A;  1QAK A;  4EV2 A;  1QX1 A;  1QAF A;  4FNQ A;  1N7R A;  2ZQ0 A;  5A1A A;  3NBB A;  1O7D D;  3W7X A;  1NKG A;  1RJO A; 
#chains in the Genus database with same CATH homology
 3I3D A;  1JOV A;  2HTB A;  2FUT A;  1C82 A;  3IMH A;  1OJN A;  3BS6 A;  1F4A A;  2WW2 A;  1W3Y A;  3IAQ A;  3NJX A;  1OJP A;  4FNV A;  4OK2 A;  3J7H A;  1MMX A;  1CB8 A;  2ZXQ A;  3DYM A;  1EGU A;  3VD4 A;  3T0D A;  1I8Q A;  3VDA A;  5JMF A;  1RW9 A;  1HM2 A;  3DYP A;  1HMW A;  1LXK A;  1JYW A;  3A24 A;  3VSM A;  1RWF A;  2WW3 A;  3E7J A;  1JZ5 A;  1NS8 A;  1YGA A;  1L7K A;  2JKA A;  1JZ8 A;  3VDB A;  1X1J A;  3T2P A;  1LUR A;  1X1H A;  4J5T A;  4BZH A;  1LF9 A;  3MV1 1;  1F9G A;  1N7O A;  1JYX A;  3BLC A;  1NSX A;  1NSM A;  4RNL A;  1MN0 A;  2BRP A;  1LF6 A;  1NS4 A;  3VD9 A;  1N7N A;  2WVY A;  1TXK A;  1K1W A;  4BZG A;  3IAP A;  3BGA A;  4OJZ A;  5JMD A;  1MMY A;  2CIQ A;  3VD7 A;  2CIR A;  2BRV X;  3I3E A;  1YQ2 A;  4AQ0 A;  1JYV A;  1Z45 A;  1ULV A;  2WVX A;  4TTG A;  3ECQ A;  2XHN A;  3OS7 A;  1NSR A;  1NSZ A;  2WVZ A;  1N7P A;  1RWH A;  1DP0 A;  2WDA A;  1JZ7 A;  3T2Q A;  3VD5 A;  3Q1N A;  1F1S A;  3VD3 A;  1HM3 A;  5E1Q A;  3T09 A;  2JKE A;  2WCO A;  2XSG A;  3A0O A;  2E22 A;  1SO0 A;  1NS0 A;  4BZE A;  1RWA A;  3SEP A;  1PX4 A;  4MMI A;  1HMU A;  1NSS A;  1NSU A;  3CZJ A;  1J0N A;  3AFL A;  3NRE A;  1F4H A;  1JZ6 A;  3MV0 1;  2BRW A;  1N7Q A;  3T08 A;  1K1Y A;  1L7J A;  4MMH A;  3T2O A;  3K25 A;  1LOH A;  1PX3 A;  3DEC A;  3OBA A;  3T0B A;  2D73 A;  1K1X A;  4DUW A;  1RWC A;  3MWX A;  3DCD A;  2CIS A;  3WVF A;  2WZS A;  2WVX B;  3E1F 1;  3MUY 1;  4DUV A;  3T0A A;  2HTA A;  2Q1F A;  2X03 A;  2JKP A;  1NSV A;  2WW1 A;  3WFA A;  1JYN A;  4OK4 A;  2E24 A;  3TY1 A;  1JZ4 A;  3I3B A;  1NS7 A;  1J0M A;  1HN1 A;  1JZ3 A;  4BZF A;  3DYO A;  1MMU A;  2FUQ A;  1OJO A;  3MUZ 1;  1SNZ A;  4DUX A;  1OJM A;  1LXM A;  1N7R A;  3VSN A;  1HN0 A;  2ZQ0 A;  5A1A A;  3VDC A;  1X1I A;  2WW0 A;  1JZ2 A;  3OB8 A;  1RWG A;  1NKG A;  1UG9 A;  1NS2 A;  4NEI A;  1MMZ A;  3NJV A;  3E80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...