4FNTA

Crystal structure of gh36 alpha-galactosidase agaa a355e d548n from geobacillus stearothermophilus in complex with raffinose
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSNNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
total genus 225
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fntA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fntA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fntA02
1K7EA 3P81A 1VCFA 2VELA 4WOZA 1MZHA 3KLLA 3EWYA 4LUIA 3N2MA 2H3DA 3G22A 1GEQA 3CWNA 4O1AA 3BVUA 4IPIA 5FF2A 3P61A 3NQFA 3GIYA 1DHPA 2QUTA 1LRTA 1JJKA 1H51A 3MHFA 4O1CA 3TU9A 3IJ8A 3CZLA 3W83A 1FCUA 1JUBA 3A22A 4JTIA 4GBUA 1KB3A 2ISVA 4MLRA 4WSJA 4HPHA 5AB3A 2Q8ZA 1XUZA 1AQHA 1X6UA 5E0FA 3BMWA 1S5TA 1ME8A 1YDNA 1DQXA 3VNDA 3UY8A 1FCBA 2Y7DA 1YPIA 3W76A 4JTHA 2DH2A 3EWWA 2E77A 3QPYA 2EGZA 4K37A 2ALDA 4JTTA 2NUXA 3PULA 2VKZG 5F7UA 2FGZA 5BW6A 2I1OA 1F7BA 2P1FA 5FF4A 2RFGA 3D4YA 5BMXA 2V82A 4LC8A 1LRQA 1OFEA 4N9EA 3NYZA 5G2HA 3SR7A 3M5XA 1TJRA 4FO4A 2A6NA 1KFBA 3LHVA 3P80A 3B04A 3C2RA 4ZQRA 2CLEA 3DFSA 3EJSA 1YTDA 3UWWA 2EQDA 3HIJA 1QOPA 3ZS4A 3LRMA 1OJXA 3WK0A 1F6KA 3C2EA 4LQ1A 5IBXA 3G24A 3SW6A 4FXRA 3GDRA 2E6AA 2WOQA 3B0PA 3DDGA 2WKLA 3HPSA 3WNPA 3IGSA 1G4SA 5CLTA 3HO8A 3KAOA 2BWGA 3HJZA 2GPTA 2J6XA 1XH1A 3LV6A 1KXVA 3NQGA 3GZ3A 3U2OA 2PURA 4N9BA 1I2QA 2RDTA 4CNPA 3BUIA 2FYVA 1H1ZA 5HUOA 2QMKA 4KWVA 3WK3A 2QJGA 4FX7A 5KSWA 3S6DA 3MO7A 4O1BA 5DLCA 3THQA 5DXYA 3K8KA 3OVQA 5CPLA 1G7UA 4JYFA 4E0CA 4MIMA 4Y96A 3W1PA 1KM5A 5BNKA 3DFNA 4NZJA 2QF7A 3W7LA 2VUYA 2F7QA 3LGEA 5TQLA 1EP2A 3M5VA 3IIXA 4KFPA 5K9CA 3WFAA 2QCMA 2WVVA 1R2TA 3IRDA 3WNOA 2Y7GA 2VEMA 3GTNA 5EY5A 5I3HA 2AMGA 4M6PA 3SGUA 4UTWA 1QPRA 2HMCA 3LCHA 2FIQA 2NX9A 3TSMA 4GRSA 1ZAIA 3L66A 1ADOA 4UTWC 1OFRA 1NF0A 2HS6A 3HGJA 4U31A 1TREA 4KFOA 3A4AA 2BSLA 3STEA 5KZEA 2EADA 3LLDA 3CU2A 1W5PA 1QX1A 1TO3A 2Y89A 3WMSA 4DQWA 4G1KA 3GR8A 4KWWA 3HBLA 2VENA 3LHTA 1TQSA 3QYQA 1QW8A 1W3IA 3ZOAA 1M7XA 5DFAA 4JFVA 1KTBA 3B06A 1JCLA 1VR6A 3MP5A 4JL2A 4IMCA 3M07A 2ZUVA 1NFBA 2PWDA 1I75A 1Y7VA 3UWUA 2C1HA 3BGJA 4N6EA 5DN1A 5J5DA 5I5RA 1ZY9A 3NPVA 4WJEA 4ICNA 3WEMA 1MSSA 4XZ9A 1ZENA 1N8FA 1CLVA 2BX7A 2ZUUA 3SECA 1HG3A 4OBTA 1G1YA 4UFIA 2OSXA 2FFCA 2YZRA 3PY2A 2H90A 2CW6A 2OJPA 3W7HA 2YW4A 1VLIA 3VSUA 1CXHA 1OK4A 5DBTA 2Y7FA 4X2RA 5G5IA 4P2VA 3G1DA 4LV9A 1KM4A 3L5AA 3RLVA 3ELFA 3W1UA 2JGYA 2ZBTA 4Q32A 5LNVA 3EXSA 5F4SA 3DHFA 1PL9A 3NA8A 1OT1A 3I65A 3LXAA 3JRKA 3OA3A 5D2VA 1OF6A 4LNYA 1PS9A 1ZFJA 1MXDA 1GVIA 3VMPA 1IZJA 1KV5A 2C18A 1WAUA 1HTYA 1D3GA 3AJXA 3QZEA 4A2SA 3QEZA 3VE7A 3GNDA 3STFA 3L4WA 4I7VA 2A6LA 3K30A 1GVQA 3T40A 3TX9A 1A53A 3PBWA 3KVJA 3OG3A 2DJXA 4FNSA 1FY6A 3W22A 5HR7A 4WSKA 4K7VA 4UCFA 4R53A 4MPQA 4RZ5A 3PVFA 1MW3A 4O12A 4GO8A 1SSDA 1PCWA 2TYSA 1MW2A 2DZSA 1HFBA 1K7XA 3Q37A 3W7JA 4B9YA 4IMEA 5D2WA 3S5OA 3WENA 5KITA 4JFTA 2YR1A 1C8VA 5E0KA 2ZX9A 3LCXA 5CSSA 5FEWA 4JEQA 2TAAA 4HOXA 2QCCA 3VNZA 2J9YA 4LVDA 4Y8FA 1GWJA 2GQAA 3IJ9A 1GCYA 4FLOA 4MZ1A 5FF7A 4Z1CA 3W2MA 5C6MA 2NXHA 1XD0A 3EWZA 3M6YA 3W70A 1TTPA 2YIHA 1T8XA 1FX6A 1CXIA 2ZX7A 3LRKA 2E09A 1I45A 4UNLA 1TRIA 3EDDA 4K8EA 4YXGA 3BVJA 1DKWA 2Y63A 1A5CA 1UD5A 1G4EA 5CKSA 1PZ2A 1U30A 1GVRA 3DX2A 1WPCA 3CLMA 4EIVA 1JR1A 3TNOA 4XKYA 3B0VC 1SW3A 3NL5A 4GWEA 4J3WA 5HWNA 1RPXA 3ATZA 1G69A 1WX0A 2A0NA 3EXRA 2CLHA 4MY1A 1TV7A 1B4KA 3HGRA 3CM4A 4BZYA 3W1LA 1ML1A 1AK5A 4EF9A 3LB0A 4AHOA 4QAWA 3UEQA 2R14A 5D02A 2EACA 3GBDA 3N3MA 3UZJA 1BPLB 3BGGA 1WA3A 1U33A 1ZAJA 3QC3A 3W7OA 4NZFA 4WOQA 3EDEA 3FIGA 3NQ7A 1Y0EA 4NT0A 1PJ9A 3OLIA 4NJHA 2NSXA 4UMBA 1OX4B 5D03A 4BI7A 1AG1O 3VM7A 1IXNA 4JY9A 5G1YA 5K4XA 2X1UA 1XDMA 2VFIA 3MYOA 2ZXBA 4J28A 3W07A 1W0MA 1XSKA 4H2CA 4LRSA 5FF0A 5BMWA 1DJQA 1DOSA 3EB2A 1RD5A 1F74A 1VJSA 3KRSA 2EEXA 3D0CA 3G1YA 2UV8G 3BAIA 4DBDA 2W6RA 3P67A 5HR6A 1CGYA 4LVGA 4AIOA 2ZXAA 1X7FA 3VKJA 4CCEA 4ADSA 4BI5A 1WQ5A 3LPPA 3O63A 1JGIA 3BMVA 5CGTA 3SZ8A 2ZUTA 3L4XA 1FDZA 3BW3A 4DXVA 3MP3A 1JDAA 5D30A 4FIRA 4RKAA 5LNUA 5EPDA 4JXCA 3MI3A 1JRBA 2YFOA 3GAKA 1JD9A 1A5BA 1YXCA 1RV8A 3GKAA 3WJXA 4ADUA 2GJNA 1N55A 4WY0B 2F61A 5DY3A 4UFMA 2X2GA 3NZ1A 4MOZA 4ZQOA 1JAEA 3DFOA 4LVAA 4WLCA 3NG3A 1WE5A 4IJBA 3EEGA 3NPWA 3EDKA 2EABA 1BEUA 2ZRUA 4DF0A 3DHDA 3BCFA 1R75A 4FX6M 2DZPA 1Q6RA 3HPZA 4EVZA 1TRDA 2WKGA 4AH7A 1LBLA 2QCLA 1TQXA 3BG5A 1XH0A 5KZMA 3TTSA 1PV8A 3W2JA 2QDGA 2IQTA 4QSHA 3T4CA 2A7NA 3LBCA 4JX6A 4HNVA 3UQNA 1H61A 4TU1A 2LLEA 1UD8A 4AWTA 3DHPA 4MFEA 1JCJA 2EF9A 1S3HA 5EKYA 4UCGA 2XIIA 5FEPA 4GUJA 3UG3A 3PB2A 3PWAA 4RV8A 1DTUA 1PIGA 3E0IA 2X30A 2DZUA 3CTLA 3I68A 2YX0A 3DX4A 3L4VA 4YL2A 3W2NA 4GI6A 1ZS2A 2NX3A 3N73A 2BY3A 4POCA 1EP3A 4J3XA 3C52A 1XBZA 3G8RA 1KBKA 4LS1A 5AC8A 2BXVA 3CIWA 1EEPA 3P62A 4UFJA 2D3NA 1SMAA 2FHCA 4OV4A 3RFAA 3L9CA 3I7RA 4MVAA 3UNDA 3W87A 1OX5A 1L6SA 1QPOA 1LLZA 4GUFA 4NX5A 3R13A 1AW1A 4JTJA 4RJEA 2KZHA 2E6DA 4CN4A 4WZHA 4UIOA 2Y88A 1SO3A 1G6CA 1TQWA 1NOFA 1M7OA 3WN6A 2BXZA 2TRSA 4XUGA 3T78A 3BLFA 5C2XA 5CPOA 4HHPA 2H8ZA 3TUUA 2VFHA 1JI1A 5I3FA 3ATYA 1HO1A 1LM1A 4XTIA 2ZTJA 4OE7A 1I2PA 4FNQA 4Y90A 4AXKA 4E38A 3D51A 2WSYA 4CNNA 2QUUA 3KXQA 5E6ZA 2PRMA 3LLFA 1WO2A 3KVLA 3LHYA 3P60A 1FUYA 4U2YA 1XC4A 1EP1A 1M6JA 3MUXA 1WZLA 4N4QA 1LOSA 1MEHA 4RX0A 2XWEA 2C13A 2DZTA 2ISWA 2BY2A 1FCQA 3H53A 4WXZA 4XBKA 1V3MA 1C8QA 5DCDA 3MYPA 3TQ0A 2OSYA 3WY3A 2Y6ZA 3C8FA 4U4MA 5KZDA 3BAJA 3CTTA 3JR2A 4MAZA 2ZA3A 3NQVA 3GXMA 2QCNA 1OK6A 3HMJG 3VMNA 3S1UA 4AWSA 3A24A 1DV7A 2ZCGA 5HNRA 4W9TA 4WQ6A 3SFKA 2G3NA 2C8NA 2V2CA 3NM1A 5L6UA 1GVSA 3F03K 3ZT7A 1DORA 4K7YA 3G0UA 3LHUA 3UY7A 3LOTA 4N2YA 3D4ZA 1TQUA 3WFZA 2W79A 5D2TA 2XIBA 3ZWSA 3RU6A 4O52A 2VR5A 2C7FA 3W7RA 2PE4A 4HKPA 4DEFA 1Z41A 3GX9A 4S2CA 3S8HA 5D33A 1J4EA 9CGTA 1GVFA 4B9ZA 5CZTA 3TXZA 5LKYA 3VGDA 1CIUA 1VFMA 1QCWA 1TCDA 4UQ9A 3WNLA 3L0KA 1F6PA 4FLSA 4O53A 4UFKA 2ZE0A 3EWBX 3A23A 3VGGA 4AYSA 3BSGA 3ZR4A 3QSRA 3DFQA 1KFJA 3NGJA 1BAGA 1UKTA 4U33A 5HXMA 2G5WA 4LY8A 1BVZA 2Y2WA 5IM51 1H5YA 1A47A 4UTMA 4Z0SA 2D0GA 3FYOA 3MJYA 3NQMA 4H4IA 1D7FA 3DC0A 4PTNA 4TMCA 3E9AA 3TK7A 2YCEA 3WJWA 3NQCA 3W88A 1ZJBA 2EO7A 3FAWA 2X1SA 1O4UA 1E40A 1GTHA 1TTJA 4GC4A 4JTFA 3QMTA 2ZZ2A 1O5KA 3KRZA 4UMAA 4YMZA 2QAPA 1OGSA 3G1SA 2NV2A 3NAVA 2PWFA 4OT7A 4QNEA 5TBOA 3BLBA 1JD7A 5K7JA 4YCOA 3C56A 2JKAA 3S1XA 1ICPA 2WANA 3LDVA 3GDTA 1OX6A 3LXCA 3CC1A 1I4NA 1W31A 4LVFA 4ZVJA 2G96A 4LOCA 4UQAA 2WNWA 1KGWA 4GNJA 4UUIA 2WVVB 3DH7A 5F4XA 3O07A 1MWOA 5TIMA 3GXFA 2F7OA 2AAMA 2DZXA 1WYIA 2B7NA 3W2KA 3TDFA 4HNTA 3N14A 4RCXA 4MFDA 2Q8LA 3TR2A 2WCGA 3TQKA 5AYYA 2Q3OA 1VLWA 3H55A 3P7YA 2OT1A 2NT1A 3CIXA 4MLJA 3W9ZA 3GXIA 1CXKA 3BPWA 3CPRA 5HMSA 1LLWA 4AWUA 4NXKA 3OVRA 1KM6A 4GO9A 2V5LA 1DEDA 3AMLA 3L65A 4O4WA 3L21A 3OHIA 4FX8A 1KTCA 3TW6A 3STCA 4TX9A 3QGVA 2DH3A 3NL2A 3F1QA 4FIQA 3CT7A 1W8SA 2CPUA 5F2MA 4CVWA 3VX1A 1O7DC 5CGQA 3P84A 5G2IA 1WOAA 2I14A 2ZDRA 4CQAA 4E2BA 2HS8A 5AHMA 5EMUA 1EWEA 3BUBA 3U6WA 4O1DA 1B4EA 3IEBA 3W38A 4X9YA 3N19B 4HSOA 3DKLA 4BWLA 4P61A 1CXFA 4JD4A 5LZLA 2QKFA 4NVTA 3IGUA 3OLDA 3O6CA 4XTDA 3AO0A 4CGTA 3DFPA 1TTIA 3WDJA 1I2OA 4JDBA 4IXHA 4JX4A 1ZHAA 4AW7A 3WK2A 3LHWA 2OCZA 1EUNA 1NSJA 1WXJA 2YYUA 2E6YA 2FQIA 5HPOA 1G67A 3ZR6A 1JDDA 1H7PA 2Z1KA 1KFCA 2FPYA 1V5XA 3W23A 1WZMA 4GINA 1L6WA 4NJGA 3N34A 1W9XA 1VB9A 5AHEA 1J0JA 2RDWA 4FHAA 5DXXA 3EDJA 2CXGA 3BVTA 4GIAA 2X16A 4A29A 5I3IA 1LWJA 1SU5A 3UPBA 1XD1A 1U83A 1KGUA 5T26A 1X1OA 4GXMA 5U4NA 4MB1A 3C61A 1JDCA 3UXDA 1K3UA 1EWDA 5LSMA 1Q4NX 1UA7A 2QCDA 2ZZ7A 1PIFA 5HWJA 5I3KA 2WKJA 4MY9A 5C54A 4CN1A 4GJ1A 3PB0A 4C1KA 1EA0A 1NF7A 2A21A 2NWRA 3EKLA 2GVYA 4PSPA 4WY0F 3ZWTA 3UD6A 4X0NA 3FS2A 1CDGA 3GB6A 5AC6A 3WY2A 4D2JA 1MW1A 3C2FA 3SSJA 1JFHA 2FPVA 2B4GA 3I7QA 1BWKA 1EO5A 4LU0A 2ATSA 2VRQA 3I6RA 1AMKA 1EUAA 5EA9A 1LWHA 3M0ZA 3WJZA 1W5QA 1P1XA 1SSGA 1K7FA 1VRDA 1KW1A 2WSKA 2VEIA 1L6YA 3M43A 2YPIA 1DJNA 3S1WA 3ABRA 3PC0A 2QR6A 3O16A 3F4WA 4JX5A 1OYAA 1BKSA 3NQ2A 1JRCA 4UQEA 3WNMA 4PH6A 3ZQ9A 2QEZA 4JS3A 3W1XA 5FF3A 1OT2A 2YOCA 1AVAA 1B0IA 3UG5A 4JFWA 1GQNA 2CLIA 4JTKA 4LS0A 5K9XA 2ZX5A 4UZUA 1Q3NA 2FH8A 2V0TA 2ZWYA 1WZKA 4DELA 2Y7EA 1P0NA 1X8FA 1E51A 1JUEA 4AIEA 3KHJA 5D04C 1KWGA 4O14A 1HL9A 2P10A 2D0FA 3DGRA 1G9HA 2GQ8A 3PM6A 2VOMA 1JCNA 4H7VA 1OYCA 2WCSA 4LXFA 3M5ZA 1DVJA 2ZUWA 1J5TA 1CGTA 3EX4A 1QI3A 4WXYA 3G0SA 1TPC1 2RDUA 2GJPA 4ZQMA 2CLOA 3UPWA 4ALDA 4UTUA 4O18A 4GI8A 2GVGA 3TXVA 4E2OA 4AMXA 2C15A 3QH2A 3BC9A 4HNUA 3IVUA 4BFAA 1ZALA 2Z6JA 2P0OA 1JXKA 3DU0A 3C6CA 3RILA 4PCTA 4MYXA 4NNBA 2Z6IA 1XBVA 4FF7A 2Y24A 3UYCA 1T0OA 3HF3A 1FQ0A 4JCLA 4U3CA 3A5FA 3GR7A 1FWSA 3WELA 1TPWA 3BW4A 2HTMA 3G1HA 4K36A 2I9EA 2WNZA 4JL1A 1HUVA 4Y6GA 2NV1A 2QPUA 3WDHA 1TPVA 4NI3A 2X2JA 1H63A 2CFFA 3IIVA 2ZRXA 2AAAA 3OLEA 2GVJA 4WD0A 1OSEA 3DX0A 1QWGA 5EYWA 2ZZ4A 4RZ4A 4O13A 5FEZA 2XN1A 4AEOA 1KXQA 1TJPA 1SW7A 3T7VA 3BG9A 5DY2A 1WOBA 1IV8A 4O10A 2GJLA 1XFBA 4EOUA 3BAWA 1GPWA 2H3BA 3BUQA 3USBA 2ZXDA 3E96A 3STGA 3HG3A 2R8WA 3MHGA 3NR0A 1SFLA 3M7WA 1CXEA 3IGXA 3SI9A 4NQ1A 3QMSA 1R30A 1OYBA 3IV3A 1RP8A 1R34A 5EL1A 3PUEA 4Z1DA 2F1AA 2ZIDA 1MXGA 1HNYA 1KFEA 3A9IA 4Y9AA 2NXGA 2FHBA 3W1MA 4HT3A 4AAJA 2WNQA 4TVUA 2YKKA 4LW7A 1GG1A 4QIUA 3IVSA 5HUPA 1LCOA 4N9CA 4LTSA 3MHUA 3E49A 3S2CA 4FMVA 1K03A 2QAFA 5EBUA 3A6OA 4JCMA 3TJXA 1WZAA 5F2LA 3PUDA 1GZGA 1KA9F 1VHNA 3RF9A 1B9BA 3DI1A 3R89A 1UD6A 1MFUA 1W5NA 3C4UA 3P82A 3EKZA 1KWKA 1JXJA 2IGTA 2F18A 3C2OA 3NNTA 3LCLA 4AHQA 1XUUA 4MZYA 5H2ZA 1JF6A 4UOZA 3CLWA 3S5ZA 3R5EA 3SIZA 3VM5A 2E1DA 5CLWA 1NVMA 3W71A 1SPQA 4M7SA 4HPJA 1LP6A 5CPNA 1IZKA 2R91A 1TMQA 2ZICA 4DO5A 1G4PA 2C19A 3W7EA 1TPB1 3C2VA 1GYNA 5LNRA 3TC6A 3TAOA 2X1RA 3T44A 1QWNA 3V75A 4BR1A 2YA2A 2B7OA 4JGDA 1UB3A 4J3SA 3FJ6A 2GUUA 3M5YA 1K8XA 1OFQA 1D3HA 1JG9A 1ZJAA 1IIHA 4FXSA 4WUIA 3LI0A 1OFBA 3N9RA 3ZR5A 3O15A 4R33A 4RZ6A 1RVGA 1YDOA 4WX2A 3TC7A 3LPOA 4PFMA 2A4AA 3TMLA 3EX2A 4RK8A 1JCXA 3UWZA 4MJZA 3W1AA 1VS1A 3PF3A 3WNNA 2F2HA 4UQDA 1JULA 1KM3A 2ISSA 3LCFA 3PBYA 1QOQA 4TO8A 1PHWA 1HTIA 1MEIA 3EX3A 4KFNA 4UTTA 4IMGA 2H8XA 3KRUA 3PSVA 4HPXA 2Y4SA 4Z0JA 1F05A 1D3CA 4LC6A 1Q6OA 1CGXA 1MW0A 4M7TA 3VFLA 2DIJA 3G0XA 3OBKA 5LGZA 3EJQA 1QO5A 1PEZA 2FTPA 3AMKA 3B4UA 1SO6A 1P4CA 1W54A 1SQ7A 1XH2A 1KTNA 2BLEA 2O7QA 3VGBA 1UH2A 2ATMA 3RLUA 1WBHA 1L0PA 4LRTA 3W72A 4CQ8A 3NL3A 5BOOA 4Z1AA 3FA5A 1L2UA 5BRBA 2WPBA 1UCWA 3GDMA 4K38A 4O11A 4DF1A 4AHPA 4QM1A 4NJKA 1CXLA 4AEFA 3GXPA 1W5OA 3BVXA 1TMHA 4RLIA 4IXXA 4IPJA 1XM3A 3ZT5A 1TPEA 4JTLA 2X2IA 3TW7A 2NXIA 5K4ZA 4W93A 3K8LA 1PIIA 3CHVA 1E3XA 4HA1A 4O15A 3TTYA 1O5XA 1TV8A 4GE8A 2YYTA 4QQ3A 3M47A 1LZOA 3W84A 5FESA 1RZMA 1LOLA 2FJKA 1JI2A 4JIQA 3O6YX 2JBMA 1GT8A 3O8AA 4MKNA 4A3UA 4LWWA 3W37A 1KM1A 5AFDA 1TB3A 5HULA 1M7PA 3HG4A 1JUKA 3NM3A 2JGQA 2BHUA 2X1TA 2JKPA 3HOJA 5LGXA 1XBYA 3W7PA 3DBPA 3DAQA 3P74A 5H91A 4CKQA 2BXYA 4GQRA 2JK2A 2BY1A 1W56A 2A2IA 2OYKA 1EH9A 3IIZA 2XN0A 4ORIA 2B7PA 4LT9A 5HWMA 5CXPA 1QPQA 3K1DA 3ZFHA 1KXHA 1PZ3A 2WC7A 1XKYA 1XL9A 3GDLA 4TR9A 4QAIA 2CZDA 2XVKA 3FJLA 4AYGA 1UUOA 1P6WA 4KKXA 3TROA 3DDFA 3BH4A 2ZTKA 1UUMA 1EO7A 3TAKA 1KCKA 1FWWA 1T96A 4BWLC 4PCSA 3QW4B 4IMFA 5D05A 4CLMA 5E1QA 1LBMA 1OB0A 4UXDA 1ZAHA 4RR4A 4GI9A 4Z08A 1J0KA 2F7PA 5CGMA 3ABOA 4O17A 4Z1BA 4M8UA 2ZRWA 5HDRA 4O28A 1AW2A 5DCBA 1OFOA 2PRLA 2PWHA 1VHCA 1ZJIA 4CNOA 4N02A 5AHLA 2ZZ6A 4QNWA 3W7CA 2YA1A 1SZGA 1CX9A 4NJJA 4HN4A 4JNMA 2QPSA 3L4ZA 4LUJA 1XCXA 2GVLA 1ICSA 4EF8A 3S42A 3W7IA 5KMYA 4DBEA 4XKYB 2ZRVA 3UWQA 3GKFA 3LCGA 1ICQA 4AF0B 3NXFA 3N2XA 5G2WA 3M1ZA 5D38A 3TCEA 3TOPA 1QAPA 3M16A 1NAL1 1SO5A 4H8VA 1KGXA 5HJLA 1QR7A 3CZSA 3L2IA 3EDFA 5G1TA 2ZRZA 4UTJA 3PSWA 3MWAA 1IGSA 4Q33A 3W1NA 1OFAA 1EPXA 2YSWA 2HSAA 2CU0A 2YXGA 2QJHA 4YLWA 2QCHA 1A5AA 3MMTA 1KFKA 5AHIA 1H7XA 2TMDA 1J0IA 3WJYA 5I0DA 5L9FA 2WSQA 3PG8A 1OX4A 1M53A 2FPTA 4N9DA 3DXIA 4GKLA 3Q2DA 1QFEA 3V1PA 3HQ1A 2VC6A 3TONA 3BUDA 3BLEA 7TAAA 1VYPX 1DBTA 1PS3A 1WBJA 2QUVA 3LX9A 4O0ZA 4S1FA 1DL3A 1Z48A 2CZ5A 4FEZA 3GXNA 3PG9A 3QF0A 3KLKA 4MYAA 1TPDA 4J3TA 3E02A 1AMYA 1RPKA 3HG2A 1TPUA 5DELA 1QHPA 3BO9A 2X2HA 1QWUA 1BG9A 2PWGA 2Z1BA 3FW6A 4XB3A 4OKDA 2Y5EA 3FKKA 5CSRA 3ZO9A 5AC7A 3BAKA 1PVNA 1F5ZA 1H7NA 4AF0A 3S9YA 4AVFA 1SMDA 4IQLA 2E5CA 2DU2A 1TSIA 2DIEA 1QMLA 4ML9A 1ODUA 1IXPA 2W0UA 1A50A 5FEXA 2C0AA 2WSRA 3DI0A 1VYRA 3KOFA 1FWTA 2YA0A 2CZFA 2FDSA 2VFEA 2CLKA 2VXNA 3G1AA 2WVSA 3AJ7A 2VNCA 3L5LA 4JYDA 4NUWA 6CGTA 2V9DA 3TE9A 2JKEA 1VJIA 4JDYA 3HJEA 1BWLA 1TQJA 1VFUA 4OHQA 4K6AA 3GXTA 3WJSA 1JCYA 5BRPA 1OF8A 2BTMA 1W3TA 1H7WA 2WNNA 4R7JA 2QJIA 1H7RA 3QRHA 7CGTA 2DP3A 2O7SA 3QW3A 5LHEA 1PPIA 1V3JA 1H1YA 2WO5A 4YWIA 3L68A 2E5DA 2ZA2A 5I3JA 2WPGA 1HWWA 1TQVA 2Y85A 3G3MA 1JVNA 5I3GA 1OVDA 3B05A 1KFLA 3T55A 2BHYA 1GOXA 2Y61A 1SZNA 5E9AA 2B0MA 1PHQA 4M19A 1ME7A 4I9AA 1UD2A 1TCMA 4UQCA 2AGKA 1Z42A 3NVTA 3VCRA 3WEOA 4PCFA 3EWUA 2QCEA 1EX5A 1LOQA 1VH7A 2OT0A 3LM7A 3BUPA 4BI6A 3IVTA 4UNKA 1MVYA 1G4TA 3VE9A 1GG0A 5DO8A 2WQPA 3VGHA 1SUXA 1Z44A 2A7PA 4ZL1A 1N7KA 2TSYA 4UTHA 4JICA 3L2MA 4JYEA 1TTQA 3WY4A 3GDKA 3LCIA 3MI6A 1WV2A 3WNKA 2V2HA 3IIPA 1W3NA 1E3ZA 1OFPA 2CHNA 2VFFA 5AHNA 1VGAA 1GJWA 2BZNA 2QMJA 1E43A 3FKRA 4R34A 4XBSA 4ZMGA 2PWEA 4UFHA 2G95A 3IJ7A 2V3DA 3M9YA 2E6FA 3EJPA 2OSWA 2Z2UA 8CGTA 4EWND 5G4EA 4JTSA 3EJUA 1KV8A 1C9DA 1G5AA 2NT0A 1LYXA 1ONRA 1YXYA 3ANYA 4M6QA 2FHFA 4U28A 1CGVA 2J24A 4JTEA 4MJMA 3UERA 4L4LA 6ALDA 3GLCA 1JF5A 3TH6A 3TV8A 1J2WA 2OYLA 3TQVA 1MO0A 1SZEA 1HL2A 1QW9A 1O60A 4FLRA 1KBBA 5A2CA 4I7UA 3IK2A 3HB9A 5HQEA 2NWSA 3S5NA 1RQBA 3QJAA 3IIOA 3AXIA 2ZX6A 4E2DA 4ZQPA 1KLYA 2V5BA 3BV4A 2E4TA 3KFTA 3PR2A 3W7GA 2EKCA 1TQTA 1R46A 1CW2A 3D52A 4JFUA 2RH9A 3CZKA 1EA9C 1CGUA 1XCWA 4N4PA 2D0HA 3CZGA 3LBMA 1FBAA 1LRNA 5F4WA 1SZFA 5D09A 3G1FA 2V3FA 2XFWA 1RQHA 2NX1A 4UR8A 5D37A 5MHBA 2C16A 2F84A 3B03A 1W5MA 2WVTA 3CQ0A 1IIGA 1R33A 1UH4A 2WV8A 4QJ1A 3S0CA 2CLLA 4B5NA 1Q6LA 4GUIA 2FE0A 5AYZA 1YTKA 1OABA 1Q45A 1IXOA 3P5ZA 4M6VA 4NNAA 2YFNA 3PUOA 5AN7A 1S5WA 3EWXA 4OGZA 3WDIA 3ZSSA 4Q4KA 2EHHA 3R8RA 4UQBA 1TYGA 2VEKA 4PSRA 3OIXA 3NQAA 4UTLA 3R12A 1LBFA 1YDVA 3L2LA 2ZA1A 4JY8A 2GUYA 3CZEA 3P8JA 1LDCA 3QQ1A 6TAAA 3U8GA 3TA6A 4M5PA 4PA8A 2ABBA 4ADTA 4DO6A 3LV5A 1I8JA 3O06A 3YPIA 1XGZA 3PAJA 3RK8A 2ZXQA 5K2ZA 1GJPA 1KLZA 4UZSA 7TIMA 1YLVA 5LHFA 3D50A 3KL3A 2D3LA 1M5WA 5GVJA 3C0JA 1HVXA 1MEWA 1G7VA 1YYAA 5C5YA 4O4VA 3CGTA 3MI2A 2E8ZA 3B0UX 1SFJA 1ME9A 4NX0A 3TFCA 3GK0A 3Q94A 1EIXA 5D32A 3TJLA 3W75A 2EJ1A 1K02A 3WK1A 2G97A 3I7SA 2H6RA 1JL8A 5TD4A 3A47A 2FH6A 4OIFA 4OJYA 4FNTA 3P5YA 4JFSA 1BF2A 5HINA 1WDWA 2OMAA 1KXTA 1RQEA 3TSBA 3TFXA 5KTLA 1P5BA 4IOTA 1W37A 1GVOA 1FDYA 3DENA 1P0KA 2G3MA 1VZWA 2E5BA 3VSVA 1DQWA 5D2YA 1HT6A 1R2RA 3KVMA 3SY5A 1R2SA 4IGHA 5E6YA 1J0HA 2V2DA 3TSDA 3QFEA 1ALDA 3LI1A 4H6KA 3GVGA 3W7QA 2CLMA 5SWUA 3SGZA 4PL2A 2ZYFA 2OZ0A 2YJQA 2XVLA 3Q58A 2E8YA 2Z0IA 1EHAA 3UG4A 3P8IA 1WP6A 3B8DA 3BG3A 3KWXA 3UWVA 1QPKA 3RIKA 2FB2A 4QITA 1V3LA 3W7KA 1YTEA 3LHZA 3QPZA 3RMJA 4JIPA 4ZQCA 4L4MA 3UZ5A 4O57A 3BSHA 1FXQA 2BHZA 1UKQA 4HNNA 2ALWA 1O95A 3FLUA 1F73A 1VC4A 3BCDA 4I7WA 1B3OA 1R47A 2V81A 2Y62A 3LTYA 2PC4A 3BARA 4A21A 3VGFA 3E12A 3CPUA 2Y70A 5BRQA 3DX3A 3M44A 1XI3A 3UWYA 3RNDA 3W2LA 4U2ZA 1H7OA 1CI1A 2AQWA 1UA3A 4XQ6A 1UOKA 3VO0A 1YXDA 3LTSA 3MBFA 1RR2A 5G4WA 3NDOA 2ZFAA 1THFD 1VFOA 1QI4A 1B57A 4NXSA 1FWRA 1FDJA 4K39A 5AOUA 2A85A 1RP9A 1U2YA 3JS3A 2DZVA 3GBEA 2A5HA 4XWUA 1B2YA 3QQ0A 1UJPA 5DCEA 5A6MA 3BVVA 5I23A 1XXXA 2J9ZA 3CZNA 3OVPA 4UC5A 4PEKA 3ZSTA 2EAWA 3S1VA 3M41A 3W2UA 1VIWA 3O1NA 1FXPA 1V7YA 1QPNA 5AYXA 1QO2A 5K9DA 5KEZA 1CPUA 2VFGA 3G18A 2CZEA 4LV4A 3S5YA 4IX2A 4IWWA 4NU7A 4ONVA 4UOQA 2J9XA 2C14A 3KE0A 2ZWZA 1JCMP 1ZCOA 2V8ZA 4JTGA 4O8RA 8TIMA 5F1VA 3BAXA 3KL0A 1T99A 2Q3RA 2V3EA 3CEUA 1W1ZA 4UTIA 3W7MA 4KWUA 5J5RA 1YPFA 4JN6A 1QNVA 4UTTC 1AW5A 1XDLA 5LNSA 1L9WA 3A21A 1BLIA 1FWNA 4GUGA 4RXFA 4O54A 1UD4A 4J3VA 2A7RA 5A5WA 2D73A 2QLYA 5E70A 1SR9A 1XSIA 2QDHA 4FNPA 3VMOA 5DBUA 5FI8A 2ZQ0A 1KBJA 3CWOX 5LNWA 1LTDA 4TIMA 4GQQA 1KM2A 1TPH1 2ZZ3A 1VAHA 4NJIA 4UR7A 3L4YA 1NM9A 3O05A 4BA0A 2OW7A 3H54A 4CCCA 1PAMA 4FNUA 2NZLA 1VYSX 4CN6A 2QCGA 3BLKA 1JQXA 5CZSA 2C3ZA 1UH3A 1SO4A 3VI2A 2J88A 4ZQNA 3BVWA 1UD3A 3F4NA 3W1RA 2WJZA 4MY8A 4JTUA 3NQEA 4A22A 1BTMA 4IX0A 4DPPA 2ZZ5A 4AMAA 1GTEA 1TPFA 4HOWA 1G94A 5EMYA 2DORA 1KCLA 1XV8A 1SW0A 4AEEA 1UKSA 1C29A 3LTPA 1H50A 1VCGA 3L4TA 4HOZA 3CB8A 1LORA 3W1TA 2TPSA 3NEVA 3PBUA 3VX0A 2B7QA 1K8YA 4UMCA 1QHOA 4J7RA 5A8GA 4IUOA 2WVUA 5F2IA 3LCWA 1AL7A 3FFSA 1PCKA 1A5SA 4J3UA 2GQ9A 2D2OA 1XSJA 1UBSA 3L67A 3UXAA 3L0GA 4J9JA 5CG7A 3W86A 2CWNA 3BK0A 3WY1A 4C1LA 4OV9A 4FNRA 3OEXA 5U7SA 4BF9A 4NNCA 2F1BA 3II1A 3BAYA 4GFSA 4O16A 3FOKA 2NUYA 1AQMA 1V3KA 1Z32X 5ABTA 3GYEA 2RHGA 2J27A 1S46A 2F7RA 3C3NA 4GUHA 3W7NA 1VQTA 2ABAA 4UTKA 5F2GA 2NUWA 4M56A 1EB3A 2VEPA 5K3VA 3NL6A 3NPUA 4MUZA 3W85A 3DFTA 2OYMA 3TMQA 2QCDB 2ZZ1A 2VFDA 1NEYA 4LS2A 3MW7A 5A2BA 6TIMA 2BY0A 3FYPA 1MFVA 2QV4A 1GYLA 3G3DA 4H3DA 4OU1A 2FB3A 4PC8A 2XVGA 2F7FA 3W73A 3NQ6A 4QISA 4H8UA 3MBDA 3LRLA 5CZJA 1HXKA 2CLFA 3NOEA 4UFLA 4RXGA 5KINA 1ZNNA 2RKXA 3FEMA 3TKFA 5IBXC 3BLIA 2R94A 4FLQA 2C6QA 1MXSA 3ABQA 1CYGA 2VT0A 1AL8A 3UCQA 3GXDA 4AB4A 4ZZ9A 4K8HA 4DF2A 2ZX8A 3EX1A 1FCVA 3NO5A 4CQ9A 1JIBA 1D9EA 5AHFA 1U5JA 3DZ1A 1HL8A 1Q6QA 4OQVA 4X3ZA 1XCFA 1CGWA 4J27A 4PL1A 1JQVA 1XBXA 3NQ8A 1X1ZA 1KM0A 3LERA 3QSTA 1H62A 4DPQA 1I2RA 3EX6A 3KVKA 3L5MA 2ZUSA 4HIBA 1UASA 2V30A 1F2JA 2GOUA 3BLPX 3HGOA 4O50A 2E9BA 1BVNP 2EPHA 4N6FA 3PS7A 1DHKA 3W74A 5I24A 5F1UA 2XN2A 2DZWA 3ECQA 4WF7A 2NLIA 3VGEA 3L4UA 3THAA 1PE1A 1OHLA 1HX0A 4H8HA 4IMDA 2WSPA 1H60A 2E0PA 4PEEA 1YADA 2PRHA 3GAYA 4X22A 3G8EA 3CEPA 3VU2A 4YCPA 2FLIA 3R2GA 4X9SA 3HPXA 4HP5A 4TMBA 3HG5A 3INPA 2XWDA 4DO4A 3KX6A 1OFDA 4WY0A 3W1QA 3DX1A 2A1YA 4MZ8A 1TIMA 2GJRA 1I2NA 3W6YA 4HSNA 2J25A 3QMRA 1IXQA 4JR5A 3MP4A 3VSTA 3NPXA 3ZT6A 1VPXA 3BW2A 4UNIA 3AXHA 4S2BA 1BSIA 3HGSA 1TV5A 3GNNA 5C55A 3FAXA 3ABSA 1F76A 1KBIA 4O19A 5E93A 3QM3A 3KL5A 2OW6A 3CV5A 1VCVA 3W3OA 4LPCA 5A2AA 1HO4A 5CZ0A 3NZRA 4LVBA 4AMWA 3G1VA 4A2RA 3LXBA 4ATWA 4OWGA 4FB7A 3SJ3A 3EXTA 4KMQA 3A5VA 2ZRYA 3DHUA 5A6LA 4CCDA 3OLGA 4ORMA 1QI5A 3VNYA 3K8MA 2QCFA 5CPMA 3PBVA 2OX1A 3L0NA 3EJTA 3TIMA 2EAEA 1OG0A 3DKJA 3G1XA 1GJUA 3O6DA 1K8ZA 2PCQA 1S5VA 2VRKA 3HZ3A 2DJLA 4PODA 5D2XA 2YW3A 2YDAA 1H3GA 2YGYA 1LROA 4O0KA 1O94A 3NQDA 4BK9A 3EJRA 3KEHA 1QDSA 2E68A 3W7DA 3N9SA 1IF2A
chains in the Genus database with same CATH superfamily
3ZDXB 2BNJA 4NQXB 1HCYA 2N0KA 3TH6A 4L4VB 2DYPD 5LJYH 4HWEH 1IQDA 3EWYA 1WICA 1MFNA 4Z9KB 4O8AA 1P1ZB 4O1AA 3BVUA 3WQDA 4Y7EA 1LNUA 4K23H 2ICWB 1CTOA 4OCNC 5F7NC 4DLFA 2QUTA 1JJKA 1H51A 4LBUA 1PX3A 5EDSA 3FDWA 4O1CA 2ESVB 2OKOA 4FAMA 1ISZA 1FCUA 5AYTA 3TH2T 8XIMA 4QHMA 5LGHH 3A22A 3EJCA 4Z7VB 2ZKXA 4AQEB 3HZKA 1IARB 5DQPA 4BZ2H 3IETB 3RIAK 1ZPUA 2E9WA 4F37F 4YHZL 5C2UB 5JDJA 2C3XA 5JW4R 3CQIA 3WKZA 4PIBA 3NDZA 5AB3A 4F7EA 1V10A 1ZRUA 1YRKA 2R56L 2YPVA 4N0YL 5D1XC 3A6CL 1IT9H 2OR7A 4OCYL 3BMWA 5A3ID 3W39A 1KZQA 1YDNA 3POHA 4YX2H 3LAFA 1DQXA 2WWCA 2UXTA 3RCYA 3VNDA 1E28B 4OZIA 1IAIL 1NAKH 1TETL 1ZIBA 2J73A 4UNUA 1TKWA 1A7PL 4D8PA 1SFDA 2IAAC 5B38G 3X3XA 1KLGB 2CFDA 1YNTA 2NQ9A 4GSRA 2WM0A 3STLA 3T77A 3GUFA 1L9MA 4WZ9A 2DH2A 3MNMA 4GX8A 1NPNA 2R0LL 3BKJL 1T5WB 2ALDA 1JGEA 2NUXA 1NTDA 2VKZG 1CK0H 1KLFB 1CU4L 3FSWA 1H54A 2I1OA 3MJMA 3VC5A 4PRIB 2P1FA 3BEVA 4NWTL 3TXAA 1NH6A 3C5QA 4KEMA 4ZFMA 3R8GA 4J1UB 1KJ3L 3RWCA 4W88A 1JYWA 5KS9E 1GSMA 2CIIA 2YMXH 3KPSE 3MZTA 3QEQD 3RGVD 1D6ZA 3Q67A 4RAVA 2AXHA 5CCHE 4N9EA 3M5XA 1TJRA 4AQ1C 4F9PA 3WQFA 1QZ1A 2P7TA 2X4SA 4FXJA 1WQVT 2ORBL 5EA0L 3B04A 3OZYA 3BQVA 1M65A 1PZ1A 3BOLA 2CLEA 5HJXA 3VZYA 1VADB 2V5SA 3KBHE 1PDKB 5F3HA 3KPRA 4XWUA 6XIAA 2NY4D 2X41A 5D7LD 2BC4A 3HIJA 5FJRA 2WAQA 3QUXD 4X5WA 3C6SB 4TNVF 1ILSA 1F6KA 5IBXA 2HFEA 2GGJA 4O2FB 1NGYB 2I85A 4OFYA 1G6VK 2OR8A 3DDGA 5I74B 1AKJD 2FD6H 3J2PA 1EXUB 4DGYL 4U1KA 4G8GE 5CLTA 5CMAA 3T81A 2BWGA 3CAFA 5SWQA 1DQMH 2CYGA 3EOUA 3S1UA 2H32A 4G6AD 4XO8A 3TBTB 5MI0B 1EHXA 1GCFA 1KJMA 3ZL2A 1KXVA 3BKMH 2MOGA 2OR9H 1OADA 1JDFA 4KOCA 1GOFA 4N9BA 1TG7A 1DVFD 2BNRE 4JFQB 4ONGL 2RDTA 1NIDA 3BUIA 5C0EA 2N59A 3ZVIA 3BD3A 3PTQA 2P43B 3P14A 2OQYA 3RRAA 4KWVA 1SN5A 2QJGA 1UCBL 3PAUA 5BOEA 3LQAC 3WIRA 2GEEA 4NF7A 5DLCA 1PJWA 5KBMA 3KXFB 3K8KA 4YXKH 3OVQA 5CPLA 4JYFA 4ALAH 1KFGA 3FB7B 2NUPA 3QEHA 4X6CE 3U9WA 1AA1B 1DBAL 1H49A 4PLJD 4JM4L 1LWRA 1SDDB 4N0CC 2WZTA 3DFNA 3IDGA 4GABA 1ZKAA 2QF7A 4PBWD 3S0PA 3GJFH 5TQLA 4AM0Q 1EP2A 1IC7H 3IIXA 4KFPA 3WFAA 3MJ6A 2AJUL 3W5MA 1JGUH 1R2TA 2VGLM 3U1PA 3ML9A 5HJ3B 3IGLA 1MNUH 3GTNA 4HKXB 4LSRL 5HI5C 2AMGA 4Z2JA 3KDOA 3W9EB 4UTWA 1ZEAL 1E4KC 1JERA 2WLKA 1Q8MA 3GRBA 4K2UL 4W9DC 4EVNA 4QRRB 1RIVL 3G5EA 4GRSA 1IGML 5TFSH 4AIUA 2X6VA 1C12B 1HAWA 1OFRA 1CLKA 2HS6A 4G7EA 1GK8A 2V17H 4WKHA 3GHSA 3IWUA 4JFXA 3LNPA 4WWID 4U31A 1Y5WA 1EFXD 3A4JA 3BSMA 4EPEC 3STEA 5CCKL 4NHCL 3N41F 2ZG2A 1QNQA 2A79A 4ZDHB 3LLDA 4LLVA 3CU2A 4P05A 1QX1A 5MEPB 1W5PA 2DUAA 2JQZA 4DQWA 3BWAB 1N4XL 3WFLA 4LKXB 4X4ME 3PU7A 2Q8AL 5BQ7A 4U6TA 3GS6A 1Q1JL 3HFFA 3KDNA 2VENA 3ETBJ 4P2YA 4WI7A 1E5BA 5EZLA 1TQSA 3QPQC 4W89A 4NJ9L 1W3IA 2RA1A 2YCLA 2EZ0D 3RURA 4H88L 4H9YA 4OQTH 4F7PB 3PZNA 2X28A 5FM5M 2A5UA 5CILL 5HVGB 3VXRA 4ZBCA 3Q8FA 1X97A 3C60D 5BPPA 4HK0A 3B06A 2LE9A 2IDCA 3FTYA 3HCVA 3LKPA 3W7WA 4LRNL 3APYA 4IMCA 3M07A 2YWZA 2VN6A 5BRZB 1F4YH 3LA4A 5BZAA 1AGFB 1ML0A 1YRRA 1RK7A 2GG1A 3H3PL 3ZTJH 4LOFA 1TFVA 2CEQA 3OZOA 4K1WA 4FFWC 4N6EA 2CKNA 5I5RA 1V6TA 2SEBB 1AZUA 5DN1A 3CXHJ 4ZW7A 4C6NA 3FHAA 2A74B 2OJEA 4XPFL 4ICNA 3VIHA 1UB5B 2XTJD 1A3HA 1XGUB 1NFAA 1XLAA 3SECA 4TSBL 4L6DA 1G1YA 4AVHA 4PB4A 4HG4K 3NGBB 1XF5A 3UGXA 2ZP8A 3U2IA 2ZC1A 4BINA 3TBYA 3RUGB 2ISFA 3IJQA 3ME3A 1ZMYA 1B1YA 4XWGL 4RAHA 5ECGA 3H2AA 5IMOA 3HE6C 3GNMH 2CW6A 4Q8MA 1DE4A 1F4HA 2NZIA 3JWDC 4PTTA 4R7NA 5ELIA 2OJPA 1ZLUH 3D05A 1R3WA 2YW4A 3ARBB 3QO0A 4R9XA 4KXZI 5I75B 3OBAA 3MRDB 2Y7FA 3LGGA 1Z9NA 3T6XA 2BERA 4PS7A 3BP7B 4YSTA 3ITGA 4B5VA 3CFKA 4RNHA 3CG8A 2PPCA 4OIIH 2WZ6A 4V2BA 1O9ZA 4W9KC 3FTUA 5ANHA 4AIZB 5BVPL 4AUBA 3K71A 3AHYA 4W86A 3EXSA 3DHFA 1PL9A 2GHZA 1NA8A 3U0PA 2DV0A 5DJ0A 4QEHA 1WBZA 2AJZB 3LXAA 4NERA 1UPPA 5I03A 1NSNH 4RGNE 4M1RA 1URZA 5D93B 5DEFB 3SE4A 1OF6A 4ZXLA 3ARED 3VMPA 3AROA 3SJVB 2IBZY 2DWDA 1HTYA 3MRMB 1H6FA 1D3GA 5TK2A 3O2DA 5I1HH 5JHLA 3AJXA 2BGQA 3QZEA 3QEZA 3GNDA 5CLZA 3D3VD 2HVJB 3K30A 3T40A 5F9OL 1OIMA 2P5ED 1PWLA 4JZJA 4PJBB 1EX0A 2XSKA 3EJJX 5E2WL 1M1XA 4G8IA 1SY6L 4F15C 1TKKA 4FNSA 2DJXA 1FPTH 4QYOA 3ZO0A 3OG3A 3W22A 2CO6B 3MCYA 4WSKA 1FV1B 2W07A 4UCFA 4ZO9A 1BX2A 4R53A 4HEPA 4KITB 4UIKL 4IMKC 3RNQA 4ZFGH 5I19L 1NU5A 3PVFA 1F13A 3SAZA 1DQUA 1EJFA 3PF2A 2DZSA 2PLJA 4H1LB 1PBGA 5F7BA 2QUNA 4AE1A 2P5EE 2GBVA 4YDIH 1AOZA 4E9YA 3BZEB 1FLRH 1RJYB 2ADJA 3GMOB 3HG1B 1G7MB 3LRHA 4JFTA 4PS4L 5I1DB 1AH0A 3VG0H 1C8VA 2IH3B 1R3IL 3MSDA 4WVXA 1YY9C 2P8LA 2YMXL 1S7UA 4JEQA 1VERA 1AS8A 1C5CL 2E6QA 2GIXA 1KJ2A 3GIVA 3MYJA 2PW1A 1HXMA 1M56B 2KZ1B 3MZGB 3SX1A 2XJ7A 1GWJA 2EPOA 3PN8A 4IF2A 4M93C 2EUXA 1RA5A 4QTIH 2GB2A 4ZBJA 3W2MA 4HK0B 3VFSA 2NXHA 3EWZA 1GAFL 2JKNA 1A6PA 4U6YA 3RYMA 3E2HB 3F2LA 3V16A 2PR4L 3E2VA 4HA0A 3I02A 2GBTA 1JCTA 2JEPA 4QJ3B 1R19A 3MACL 4LRIC 2OFQA 4PJBF 3VCLB 1GUVA 3S36L 1TRIA 2PF6A 3B9DA 3EDDA 1FRBA 4K8EA 3FO1B 1OJOA 1DKWA 2C3VB 2DF3A 5AVSB 5T5NF 5E5RB 3TN0A 1G4EA 3AYVA 5AOKA 3NBJA 1PFCA 4ZUSB 1HE7A 4UIMB 3NYKA 2GUOB 1XF4B 1I8MB 1MQKH 1OZUA 4S1RL 4DK3A 2GGEA 2UZYA 3D6NA 3DX2A 1WPCA 3G5ZB 3GR4A 4ELKB 2FTAA 5I30L 1JR1A 4WU7A 1QRNB 3TNOA 3B0VC 1MRFH 1QFHA 2BSED 3PWNA 4K9JA 4KHXH 5TPWL 3TP4A 1A0CA 3LSOB 2B4CC 5F3BB 3PWJA 1RPXA 4LO9A 5HWNA 2FYMA 1G69A 2A0NA 4NYUA 4QS6A 1W1PA 1OV8A 3ALPA 3QIWD 4E3TA 3WFDL 2CFKA 4BZYA 4UNTA 1XLMA 3W1LA 3CSTA 1OM3H 4PJ9A 3TT1L 2YARA 3CHEA 3N1GC 4EF9A 3OAZH 2DAVA 1Y6KR 2H8PA 1R3IH 4HCIA 3F7VB 4IEFA 2WNGA 2YS4A 4XI5C 4KFEA 4R5VA 1PY4A 3GBDA 5IQMA 4NENB 3N3MA 4MAYD 5HY9B 5G55A 3BGGA 4B5ZA 3MV7E 3CFEA 4RNRA 2BIOA 3LMJH 1ZAJA 5A8MA 3QC3A 4FP1A 4BE6A 4NZFA 2W63A 4HCLA 3HMWL 1U9KA 2ZAHA 2O5NA 3WJJC 4NT0A 1BD2A 4NP4L 1VBHA 5LCVL 2HTKC 1L2QA 4NEHB 1WBXB 2NSXA 3EMQA 3AM8A 2YB4A 2N3JA 4AZHA 2Z4QB 1C8YA 3S3GA 5E2UH 2D2CC 3WFCL 3O3EA 3GRWH 3NCMA 1I9RH 3QUYB 4PTVA 3TWAA 3HC4L 5CZRA 4KK8D 5IKCB 4GBXC 1XDMA 5IJBC 2VFIA 3MYOA 1U8HB 4J28A 3TVMB 2HVJA 1F90L 4UDTB 1JPGB 2QSCH 5B3JE 3WQCA 3TN4A 4QLWA 3XINA 1BQKA 5TFSL 1RD5A 4LYQA 5F88A 5CLYA 3PWPA 1F74A 5EFDA 3LZLA 5ECUA 2ZOLA 3BJLA 2EEXA 1OANA 4JDTL 1JXGA 4ERSL 1U3HD 2W6RA 1SN2A 4JY9A 4DBDA 5HR6A 5IOKA 4I2XE 3TNMA 5MEOA 3PREA 1UR2A 4H1LA 3OR7A 2VL5A 4N2BA 4LBEB 5DU7A 4YE4L 4CCEA 4ADSA 4LIQE 1FL3B 1RK0B 3H9ZA 4TQ8A 3SZ8A 4R84A 3WLLA 3L4XA 4JVUA 5FO2A 2Q6WB 5AOZA 4WU7B 3QV7A 4KFMA 1NBYB 1OJNA 1IWBA 3N0PB 4FIRA 3FT0A 5XINA 3D5OF 2RAMA 1A5BA 3MQIA 4QRPD 5ILTL 3UYPB 2PS2A 5BS0D 1OEZW 1T1YA 1BF5A 5CZXD 1S7XB 4YS1A 2COVD 2FJUB 1N55A 3F6LA 3TC7A 3RWEA 1Q9WA 4H9UA 3ULUL 4G71B 2X9ZA 1QPPA 4POUB 3NZ1A 3NABL 3GGWA 1BMWA 2CIRA 3HFMH 3TQPA 1JYXA 4LVAA 4WLCA 3FUKA 1WE5A 2WYSA 1KCSH 2FJGA 5D9MA 1IBHA 4NRXB 1OCQA 4Q8QA 3NPWA 2FQDA 1EWHA 1OACA 3T6VA 4UBDC 5GZOD 1BEUA 4N2MA 1TVNA 3CDFA 2ZRUA 1ZK5A 3AITA 5E9DE 2QKIA 2UVEA 2VMDA 4A2LA 1R75A 3ZMRA 3GVVA 2DZPA 1Q6RA 3GLZA 3NPZB 4F2FA 3HPZA 2FZMA 1LBLA 2QW5A 1BZ9B 1FYTA 2O26U 1CFTB 5C0AE 3QIUB 4GA8A 2WXRA 2EE6A 1XH0A 4XB8A 1CYWA 1MCDA 3NCJH 4QF1A 5L4FA 1P0EA 2BW4A 4G1EB 2VSCA 4QSHA 2J6EH 3U46B 4Z2GA 5ECVA 2W9MA 4HNVA 5HGHA 1JP5A 1XQ4A 4XPAL 1DBKL 4TU1A 3BDYH 2DBLH 3ZKXC 3OGRA 1UD8A 4AWTA 2Z7UA 3MOBL 5GISH 5AYIA 1HOCA 4LLYB 4MWAA 1JCJA 3BDBA 4GXVL 5ABZA 4HGKC 1QR4A 1RU9H 3ARDB 2E2UA 3NJXA 3PWPB 3GRGA 2VDKL 2CH8A 1MWAL 1BV8A 3D8MA 5E00B 2BVDA 3QIWA 5EKYA 1JCKA 4PWKA 3ALWA 4GUJA 1NUFA 1UR0A 4ERIA 2JB5H 4YDJB 4DLMA 4TUOA 1PG7X 3HHMA 3HTLX 3ZLQC 4EDWL 4HSAC 3GC4A 3GSNB 4DQOH 4C5ZA 2WMIA 1EGJH 1O7DE 4G6FD 2FJFA 3FFCB 1ZGLM 1HJXA 1NIBA 3BP5A 3CTLA 3L4VA 3PHSA 4MNHA 5CKAA 4FAAB 2NR6C 4OZFA 4R4BB 4TL5A 5DMYA 4LSRH 3PPEA 1OK0A 4Z3TA 1XLLA 3LKRA 1HKKA 2NX3A 3N73A 2WTPA 4A3YA 3C5JA 1EP3A 3N42B 1FORL 4J3XA 3FSOA 3IE4A 1KBKA 1XR8B 3NTCH 4LS1A 4WIWA 4A7GA 5GW7A 1V6UA 5AC8A 2V5MA 4P23A 1CD9B 1J05A 4W9FC 3EH5B 3M0VA 1L6XA 3NO1A 3P62A 1U93A 3X2QB 1SMAA 3JVFC 2DW6A 3HPAA 2ADIB 5JQIB 3GSRA 4L9ZA 1HQ4B 1Q9KA 1T1WA 4DZBB 1L6SA 1LLZA 4GUFA 4MNGB 5DJCA 5HDLA 4LBEA 5I79A 1AW1A 1XIGA 4PLJC 1V3IA 3SCMD 4AT6A 4NPKA 1S9WB 4XP5L 1K8IB 4YAQB 3FU0A 4WZHA 4YWSA 4IG2A 1FNAA 1NS4A 3GXUB 1SO3A 3R1GH 1FFTB 2JKIS 2J6EL 2XQBL 3G3LA 2X4PB 2FAUA 1YC7A 2W0LA 3I9PA 5D6DC 3NCYP 1TQWA 2AVFA 4I18C 3ZMEA 4F7EB 1NOFA 5B3NA 1G6CA 4AZCA 1M7OA 3KPLB 1MLCB 5TDNB 3WXWH 2JF7A 1RCXB 5DYFA 1UXMA 4HHPA 3KWUA 2O9PA 1M7IA 2CLRA 4JPGA 3TUUA 4IP5A 5I3FA 5CHNB 2PP1A 4PJ7B 4QLRA 3OTTA 2DN7A 3PJTA 5KJ7E 1A6VH 4DWSD 2J88H 3OZ9L 4AYFB 3EH1A 3NESA 4G5ZL 3TO4A 4QRUB 1HHJA 1I2PA 2DWXA 1R4XA 5HGBB 4HEMA 1WD9A 3AFBA 3S96B 3LKPB 4MDPA 4M3HA 3HRZB 1RURH 3VFMA 4Z3HA 2PPGA 4Q8BA 5AFAA 1SJBA 5HHNB 3GTVA 3MV9D 4FP8L 3ZDZE 3HE6A 4U1GB 5DHYA 3WAKA 2D1ZA 2XVNA 3QGKC 3EKGA 2X4SB 4R4FL 2VD8A 1S9YB 2EIEA 4WI0B 5BUPA 1B31A 3MUXA 1MMFA 3MFGB 4RX0A 4OKVA 4BH7A 3AS1A 5F7EL 3WHE0 7ODCA 3H0TB 3C5JB 2IXVA 4P2RD 3H53A 5DCDA 3S37X 3MYPA 3L9RA 3TYCA 5AVWB 2XIDA 2Z0BA 5HHQA 2Y6ZA 4U4MA 5KZDA 3TIDA 2CCWA 3VE0A 4F0RA 1OAUL 1L9PA 2GCYA 4K55A 2E7MA 4OV6F 5D96B 5C08B 5J9PA 1WCBB 3N0AA 2QGCA 3VWKA 1R3RA 2CQVA 5CMAB 1H3UA 4GSQA 2ZPKH 3VMNA 1EJVC 3A24A 3KPPB 4N5ED 3FDGA 1DV7A 3WKML 4BWWA 2JELL 2G3NA 4NOFA 2OA9A 4J6RH 2V2CA 3GW3A 1PKLA 1R85A 4N6RA 2ITDA 4KBPA 1DORA 4K7YA 5LA1A 3VFRA 1UM4H 2R1KA 2FEDC 5DWUH 2WOYA 3D4ZA 3C87A 5DUML 5FYKH 1Q0YL 3O4LE 1NMCC 2XIBA 1II4E 3HZVB 4BFNA 1HKVA 1UWAA 3NYDA 1RLBA 4O52A 2PE4A 4DEFA 3VI4A 4LL9A 5LBSL 5C3TA 3PYCA 4Z8FH 4S2CA 3S8HA 2R29L 5AB9A 2IQ0A 3MLXL 1J4EA 4JM4H 3DETD 1LO5A 4OV5A 1XC6A 4Y4HA 2VCOA 3VGDA 3TXZA 5LKYA 1T5KA 2IXQB 1XM3A 2Y22A 4PW9A 1NMBH 3HBZA 4K68A 4UQ9A 1NCGA 3FQ1A 1BQHG 4OCXL 4CL7A 1E9YB 2EG7A 1QSED 4FLSA 4F7CB 2BOBA 3AUVA 4J6IA 3H2WA 1UQYA 4UFKA 2OTDA 2KZBA 1H5BB 5SWSD 4QGCA 2HKHL 5C0BB 2V5RA 1ZHNB 2C9RA 3UTTE 4JIHA 2CBUA 4L37A 4BF7A 4Q8TA 1OP5H 3FYYA 4LSTL 8A3HA 3VFWB 3KLHC 4IRZL 3OSVA 4LNVA 5IUCA 1KFJA 4WY7L 1U4FA 1UKTA 4U33A 5I1EL 2G5WA 5CWSB 4YS4A 43C9A 1GPOH 2VVSA 1BVZA 4GKSA 2AL1A 4KQ3L 5GSVB 4KCTA 1H5YA 1AC6A 4QO1A 5EU4A 3SGEI 5GSRB 3S35L 2Q8XA 5DT1H 1LO0H 3MJYA 3NQMA 1A1MA 4PTNA 2YPLE 4PR5B 3P40A 3UDWA 3E9AA 1UWUA 5C0BD 3WIIL 4HZAA 3H22A 4AQLA 4R4ND 2LTQB 3D85D 1O4UA 2B08A 1YW1A 2ZUXA 3VKKA 3UTZA 2OMVA 4I3GA 4LFYA 2EDEA 1ZVSA 3KN4A 2LGNA 1L3WA 3MSPA 1O5KA 3NVDA 5L6YL 2WBWB 4GYKA 1E4XH 1EMTH 4PJAB 2WTRB 2YCLB 1MI5A 3AHXA 3NAVA 1OGSA 3G1SA 4UMAA 5JXAH 1IZCA 1RSYA 2PWFA 1F3JB 5TBOA 1HYRC 3T0XA 4JKWA 3H4XA 3BLBA 4NM4H 5K7JA 4NWTH 4YCOA 2V33A 5HHOB 1MJJB 3P0XA 3SUSA 1YEHL 4PJ5B 4WRHA 1J8HE 2B81A 4NC1E 5FAGA 2A9DA 4XE5B 1DQLH 1XB6A 1SDDA 2AK4A 2EYRB 3LMJL 2PCQA 1FJ1A 1TOXA 2EYSB 3CC1A 1N3NB 5HYJD 1V3HA 2HXAA 1GY2A 4MCNA 1EBAA 1W31A 1RU9L 1IM9D 1GKOA 3GMRA 1TEFA 1Q6DA 2GCYB 4LOCA 2F08A 3CVHA 4H25B 4A4AA 3DH7A 3RVXC 3GKWL 5C3IA 1OCWH 3K6FA 4KV5F 3B34A 4KDVA 5C09E 2DZXA 3B2DC 1WYIA 2B7NA 4XWGH 3ULVC 4GAAA 1GW9A 1UZHA 3TN6A 4HNTA 4L4JA 3CFNA 3ANUA 4RCXA 4MFDA 2Q8LA 2W9LA 3TR2A 1FNEA 5E5MA 3WS6C 4YHKL 4J2XA 3FU7B 2Q3OA 1TNMA 4LSUL 3M1CA 1PZSA 1RZ8B 3ECBA 3N2BA 3MRKA 1J48A 3M1OA 1RULL 3NAAH 2Z65C 3RTQD 3RLSA 3VWKD 3CIXA 5JQHC 4MLJA 1M7DA 1BZ7A 3NJ3A 4I5RA 1JFQL 2BP3A 2X70A 1YNYA 1LLAA 4FQPA 3CPRA 4XX6A 1JK8A 2XV3A 3DX7A 1LLWA 4G8EA 2XUWA 3QNXA 4HJJL 4IYKA 4PRIE 3L65A 2RGMA 4B4FA 2WZ0A 3L21A 3MO1B 3WQVA 3AU1B 2Y1VA 2Y07L 4TX9A 1X7TA 2DH3A 3C5SA 3GT6A 4NLHA 5EZJB 3CT7A 2IF7A 3QDME 1W8SA 3ALFA 1ZVHA 5TDPB 1Q9LB 4CVWA 2HJKB 3VX1A 1KEGH 1O7DC 3S3SA 5D2NE 3ROOA 1U41A 1CYXA 3SRKA 3P84A 1WBZB 5G2IA 2CUHA 1OAKL 3HMXH 5EMUA 1D5MB 2OMZB 3BGAA 4ONFL 5HD8C 1MRAA 3CXFA 3IEBA 3LZ5A 3W38A 3N19B 4HSOA 3LRGA 4PG2C 5D1XA 4GW4A 3TIEA 4BYHA 3DKLA 4IFKA 4C4KT 3C6EA 4P61A 4YJ5A 4N8VB 1UQSB 3CBJB 4J1UA 6A3HA 4HUCA 3WIHH 4NVTA 4NP7A 4XTDA 3SRHA 3WAJA 3AO0A 2YZ1A 2ERJC 2G5RA 3GMPB 1R38A 1TTIA 4JDBA 5D4YA 2QEJA 4KH2A 5I0VA 1TELA 1BFVH 1PX4A 3T3ME 4KGJA 4AW7A 3MCKA 4AD1A 4LNRB 3RNKB 3RVWD 4E41A 3LHWA 4U0RC 1F3TA 4MNQE 1NSJA 2DJSA 1SPUA 2WQRA 1AO7E 5E94A 3L54A 4X80L 3IS4A 5D7IF 2QV5A 3QUMH 2RGLA 4Z7UE 4E9TA 2Z1KA 3W26A 1EEZA 5GGTA 3MNWA 4GINA 3LEVH 1RJYA 3D4CA 3SRFA 3QLDA 4NZ1A 2BDNH 2JH2A 1T1YB 4P04A 4U1KB 1AOHA 3AREA 1ZVSB 4A39A 4YSEA 2G30A 1TSRA 1VB9A 4R7XA 5DXXA 2IH1B 2AQOA 5F7LB 3EDJA 2CXGA 3BVTA 3X14A 3JUGA 1KG0B 4P8QA 2VAJA 1LWJA 3AT0A 4IS6B 4JZ5A 3S46A 4CSPA 3UPBA 1XD1A 2YC1B 1U83A 3OIHA 4DP8X 2DQIL 4GXMA 4QHPA 5U4NA 3SO3B 4BZ1H 2VXQH 2F5AH 5I1KH 4OUIA 5AQ0A 3K5SA 3QZWA 2VD9A 1RJZB 3QRGL 4AXWB 4ZB0A 3DSNB 3RLGA 3ATBA 3MOBH 5EMLA 4PRBB 3HE7A 4QXGL 1QNSA 5E6IA 1F42A 1UJ3A 1Q63A 3PB0A 4REQA 1EA0A 2KZWA 2WP3T 2OTWA 3FQYA 2EICA 3KTXA 3CQKA 5LBSH 3FVDA 4UT7H 5C9RA 3ZKXB 1BVOA 1CDGA 3V0VB 3BANA 1AR2A 4TKWA 1QW7A 4D2JA 5AC6A 1YMYA 2BNUB 3QORD 1AGBA 3ENLA 1XB8A 3WF4A 1KGIA 1SN0A 1JFHA 1S2EA 2B1OA 4WDIA 3V6OA 5IJKA 2FPVA 4GYPC 4ZSTA 4XVTL 2B4GA 1LK3L 3LG3A 3B2MA 2D9CA 2HWZH 4OFPA 1BXNA 2BODX 4LU0A 1AO7D 1JHTB 1TTFA 2VRQA 3K2IA 3LEXA 3O9WB 3PHQA 2CO6A 5IVXF 3U9PL 1R9FA 1JXFA 2GOKA 1UQSA 1I8LA 3M0ZA 3FTZA 5D4HA 3KBVA 2EIZB 3MLXH 3HR6A 1W5QA 1P1XA 1SSGA 4S39A 3RPTA 1K7FA 3ZKMC 4YSUA 1KW1A 4Q4RA 1SRDA 2TSAA 1XLBA 1SUHA 4X7CC 1FCCA 3Q2WA 1N67A 4J39A 3MPHA 1RZ7H 2HJKA 5G4OA 2NNCA 2UWEA 1OYAA 3HBPA 3DRTA 3MV8D 2C4FU 3PV6A 2WHMA 5E94B 3RJDA 1OCZB 1BKSA 1E6SM 2R8SH 1CE6A 1KCVH 1JNEA 4JQXC 1IFHH 1NAML 4G8AC 1IR1A 1JRCA 5MEPA 2XISA 3SN4A 4I90A 2OI9B 3QARA 4OB5L 4UU9B 3VFSB 1E5AA 4JS3A 3W1XA 2CRZA 3L23A 3AY4C 3A9BA 1AVAA 1RMFH 3GSRB 4JFWA 4JTKA 3RN6A 3AUWB 3EG9A 2W65A 4Q9QL 3MRRB 4FLHA 5AKRA 1AV4A 1A6UH 1TF4A 4Q4SA 4ANXA 3BCJA 4NKOB 3RUGF 5I76B 3HCVB 1IHIA 4G5ZH 4WHBA 4DELA 4ZMQA 2Y7EA 4LPVA 3MRCA 4X8JA 4R7OA 1JZ3A 3GHTA 1P0NA 5EBAA 4JLRB 5DJ6B 3VDCA 4J4PD 3JZUA 4PJIE 2I5YH 1JZFA 1T1XA 2QHLA 2JXMA 4PG9B 1WLHA 4OD3L 4QXWA 1H3PH 1UJ3B 3MDJA 4PREA 3V4VA 5L4IA 4X4YA 1EYWA 2D0FA 1W1A1 2FZ9A 4G2DA 1PY0A 4XIAA 1T7XA 2HX8A 2VOMA 2WCSA 4HCRA 5JW4Q 1DVJA 4G7SB 5FIPA 3T0BA 1QI3A 4WXYA 3G0SA 1U8OB 1K9TA 2C1OB 1R5VA 1GZJA 1TPC1 3T6CA 2DJUA 5AKTA 3TJEH 3F58H 3ID7A 2WGNB 1NAMH 4P46A 2CLOA 4O18A 2EE3A 2VDNH 5I0YA 4YPJA 5J13C 4TQIA 4E2OA 4GO6B 4KROC 3VFMB 4AMXA 4L65A 1NOUA 2GGIA 3ARFA 5I2UA 1FAKT 2QHRL 3PLYA 3EO1A 3D2UA 3X1FA 4CSTA 2UY4A 2X7LB 4W8BA 3MU7A 2UZPA 1NS2A 2P0OA 3C6CA 5EDXA 3RILA 2ROYA 4OAWA 4IJ3C 4NNBA 2GFBB 1K77A 4HA4A 3KPNB 3MTWA 4IIGA 4HEME 3RO8A 4YO0B 4FF7A 4KNTA 3HI6L 1N10A 3KAAA 3QS2A 4KKRA 2X4TB 3PPHA 3VINA 3D7PA 3UTQA 2DICA 3B2XA 3BW4A 2HTMA 5IZ7A 2YPLD 4XODA 3OB8A 3O9WA 1JPFA 5C08A 1HUVA 2D03L 1XINA 3U4BL 2R1MA 2HLFD 1FNFA 1KCRH 4YUEH 3RB7A 4ENED 3GHEH 1ZCCA 4F27A 2QVHA 4K3AA 3LIZL 4NI3A 1TPVA 2Z92A 3QCTL 1BEYL 4JVWA 3F7RA 1E5NA 4M48H 1NC2D 1HQRA 3K0WA 5I76A 1OSEA 5I1AA 3V6ZA 2ATKB 1UXWA 4Y16A 1G7QA 1BGGA 5DRCA 1I1AA 3L3GA 4CC4A 3SBPA 2HZHA 3CFMA 3S3PA 2FO1A 3BVNA 1LEGB 3JV6B 4DTGH 2PXYA 5BRZE 5IBUG 3QXAB 1SW7A 3UGEA 1KDIA 2BSEA 4JFDB 4R0LA 5BZXA 2Z8WC 3UZQA 2QPXA 1UZDA 3UVIA 3RWFB 4L4VA 4JREB 3ZDZF 1TZOA 2FNBA 2VDQL 2YN5A 2JEQA 3ZDXE 3S5LG 1IGCH 3AG2B 3GIVB 1OARL 1K1XA 4RLIA 4ESKA 5I3DA 2GGGA 4MBRA 4Q0XH 3TYGH 2YLLA 3WEAA 3DERA 5A6BD 3OWEA 4MJHA 2BGNE 4FZ8H 4BJLA 3UABA 1W5ZA 2G60H 3SI9A 3QMSA 2XXFA 5DT1L 5H8DA 2QSQA 4KESA 1R30A 5EL1A 5MERB 3PUEA 4YHMH 5H37H 2F1AA 3RWCB 4KJQC 3BLOA 1V0MA 2PZNA 4R3UA 3C8NA 1MCBA 1UWXK 3EYUL 4L18A 1TUPA 2XDFA 3E6HB 4TPRL 1N18A 4ZFFB 2Y74A 1XF4A 1VEOA 1I8MA 1US1A 2WNQA 2PP9A 3PP4L 5TE7L 2O5XL 4G7VH 4N2HA 3ARSA 1EERB 4TXEA 2AAVA 1TIWA 2AC0A 2Z31C 5CU5A 1YJDC 1ADSA 3D9AH 5HUPA 4JG1L 1ZLVH 5KVDH 3Q2LA 2XFGB 2D7TL 3MHUA 1V7MH 4K94L 4HCGA 4FMVA 1K03A 3KRBA 2JIXD 3D69B 3DYPA 4I2XA 2QAFA 2PP7A 1Y6MR 4NO2A 1XIDA 1Z45A 1A14H 2YLHA 4JCMA 4H6RA 5EBUA 5F2LA 4ZENA 5KSUB 2CNZA 3BISA 2K4AA 2VXUL 2E9JA 4L3ED 4N0RA 3ZDZB 4Y9FA 4FNLL 5DUPH 4PMNA 3WIAA 3VTAA 3R4DA 4BKNA 1MY7A 3DI1A 4RDVA 1W91A 4L3CB 3QQNA 5FFOA 2Q86A 2WWKO 4FYTA 3C4UA 4AFYA 5F6HJ 5C0GB 2X42A 3EKZA 3WG6A 3W9DB 1JXJA 5ETUB 5KYYA 4OSUH 5EF3A 4ZTXA 5BJTA 3ZZQA 3B40A 4B90A 4ZEPA 3S98A 1NCIA 1H0IA 3LCLA 3HU7A 3NIFF 1XUUA 1QKZL 4MZYA 4WW2C 1Q2RA 4IGBC 4LDLB 2ZCLL 2AANA 2DL9A 2ZOTA 4K71C 2PLKA 1JTPA 3BN9D 4KW2A 3W71A 3GTXA 4IDJL 3MUGA 3F84A 4P4KA 4PRHB 5DRXA 5IHLB 4KZDH 2QZ5A 4G6AC 5I0WA 3PGFH 4GMTL 5EEYA 3W7XA 2W5FA 4M7SA 3BE1H 3W1PA 4OGAC 3AVEA 5A2JH 1JGVL 4FQ1L 2PDLA 3TYFB 4W9ZA 1PZAA 1A4KA 1A4CA 2UBPC 1XGTA 4AYEC 1Q72H 5GVJA 1CFQB 5C0DB 2ZICA 4DO5A 3SPVA 2YWYA 3IFNL 4QRAA 5C09B 1EZWA 1VBRA 1D9KC 1P5UA 2KERA 4TOYH 4OH2A 1TQCB 3IGAA 4Y4HD 1NSSA 1FHUA 5LNRA 2G9KA 1YJDH 1OM0A 1UVQA 2X1RA 3B9OA 2B7OA 4JGDA 3FJ6A 3M5YA 4Z78A 2XVBA 3QUMB 1X5FA 3TA4D 4N42A 4IQJA 1OFQA 1IIHA 1K4HA 4FXSA 5IVOA 3JTTB 1HWGB 4ZMWA 2FUQA 2GSIA 2AEPH 4OCSL 1B30A 1XIEA 2V7HA 4GB9A 3KPLA 4RFOL 2YAQA 3CSPA 1RH9A 3KPSB 2ITCB 4WX2A 3TX4A 2L3BA 1PG7L 2R69H 3MBEC 4M3KB 4X4KA 4K3JL 1UPMB 1ZP3A 4G5AA 3VOJA 4JRYA 2D2GA 4B3VA 1AXTL 5C0RH 1LQ0A 1XGRA 4XC1L 1I6NA 3O6KH 3ES8A 3WNNA 4UAOC 4R4NC 5E9DB 3U36A 5EU9A 4UQDA 1NCTA 2MQ0A 5A2FA 1KM3A 4K5MA 3SDDC 3HRZA 4GXUM 2HNEA 2VXQA 3W82A 3C0QA 2V5KA 1FGVH 2MSPA 4L56A 4BQ5A 4MXWL 2JCCA 3EYQC 4Z5RB 3IWPA 1PHWA 4JCWA 3VXRD 2ENQA 1HTIA 2VDNL 4YPGB 2J72A 2GWGA 4KFNA 2APVA 3OKMA 3QFWA 3Q6GL 3WI9A 3MX0B 4ZMAT 1XGDA 4TLTA 3VFWA 3QHTC 5DJZB 3WFBL 3MCKB 1QNPA 5F9JB 4RW5A 3TNBA 1V51A 2DIJA 3VWJA 3G0XA 5G5DB 1VFTA 2V5DA 4C6LA 3HE7D 1YPZB 1TDQA 1YJDL 3EJQA 4UM9D 2ICWJ 3RRSA 1QO5A 4E2BA 4PRPA 5GZNA 1A4JA 2FTPA 1ZCRA 3KWSA 3QIUA 4K5PA 1U4EA 4B41A 4ERSH 3CN0A 4ABWA 1RIHL 2R24A 2WZEA 3RWJA 5ICZB 1SO6A 2W62A 3G7TA 3CSYB 1HXYB 3G5VA 1KTNA 2VX4A 2J7LA 4GKOA 1DL7H 3VGBA 2WUCL 4HHLA 1U8KB 3VKCA 3RLUA 3LB6C 1UADC 4HIQA 2CRMA 3T8XB 1KPVB 3NL3A 1B3IA 4ETQB 4EPDC 4I0CC 3BWZA 3MU3A 2YC1A 3UP1A 3KS6A 3ARDA 4I9WE 5C0GA 3T1FB 1TJGL 3FA5A 1WAAA 4F8XA 2AP2A 1TA3B 2E9LA 3SKNA 1MFCH 4NZTL 4Z7UA 4S3AA 1BG1A 1XYCA 2NUTB 4FXLA 3SB0A 4AEFA 4HBKA 3GXPA 1W5OA 1NIAA 1WFMA 3CN4A 1BW8A 3BVXA 4TUOB 2X0VA 1A3LL 4I0PA 4Y0GA 5L8LB 1TMHA 5IESH 4P7LA 1AZVA 5J56B 2E3VA 3O41A 3O6LH 4GS7C 4PRDA 4RV3A 5HJYA 1VCBC 2A6KA 2H5UA 4XP9L 2WWOA 3ZT5A 3BP7A 3AQYA 3EH3B 4UT6A 5JIMA 4JY5L 1SHWA 1MIEH 2F5BL 2I69A 3ARFD 1SJEA 4OZFB 4W93A 2AJSL 5KYUA 1QR1A 2NXIA 2WQAA 5EN2A 1EF2A 2YD4A 3EBGA 4OLUH 2MPAH 2Y0SA 1F4WH 1LNUB 1M7UA 1KB9J 2CBMA 1O5XA 1TV8A 2WCAA 4Z42C 4F57L 4QQ3A 5D7JA 3TA3B 4AGOA 2WMJA 3B8YA 4PMUA 3W84A 4P57B 3T42A 1RZMA 5FESA 1GGYA 4JIQA 1JI2A 4FYSA 1UUSA 2FIKA 3H26A 4A3UA 2B1HL 2EEDA 4GAYB 3SCQA 1EC8A 1POKA 5JBDA 4A2MA 1PBYA 3W37A 2I17A 5AFDA 2VERA 3U4EB 4IP7A 4OZHE 5DQJB 1TB3A 3CYVA 3MTXA 1IC5L 5ID1B 3VXMD 32C2B 3HMXL 5TQ2H 3V5HA 5DD3L 1FWAC 5EO0A 2JGQA 3FQ2A 5IM7B 4AGNA 2X1TA 1BZ7B 3ULVH 2JKPA 1FWIC 4H6QA 4A66A 4ZW8A 5JW5A 4HPNA 2A83A 3W7PA 2AEQH 5GGSB 2QADB 1T7WA 3EEZA 4RUBA 3MLSH 3MREA 2VKWA 1NCJA 1PYWB 4LB4A 3AU1A 3FFOA 1JGEB 4G7VL 4CKQA 5DTFB 3IBEA 4HYVA 4C6BA 1P53A 2DY2A 3I6SA 2A2IA 1X5KA 4RISL 1NGWB 3ZHNA 2XN0A 2NY3D 4ORIA 4Y4FA 3CXDH 3QTPA 4IIFA 4ROQA 2RDYA 1GYCA 3VD2A 2WY3B 2ADFH 5IIEB 2NY6C 1AFVH 3H6JA 3RHWK 2IDFA 4TSAL 1XL9A 2NSMA 2VQ4A 4D2NA 1WKDA 4TR9A 2CZDA 2XVKA 4GW4B 3FJLA 4AYGA 1UUOA 1ES0A 2UZXA 4AISA 3DDFA 4MYWB 3VWJB 2JNZA 2DY3A 5F1NB 1DFXA 4Y9MA 2EYRA 4HWBL 3ES6A 1KB5L 4CLMA 2QQNH 1ZAHA 3HE6B 1ZAGA 5DHYB 2YD3A 5I16B 4Z08A 2MPAL 5G2NA 4S1SH 5T3ZL 1J5OL 3LPWA 1OIOA 1P2CA 2F7PA 1RUAL 3D30A 4HAFA 5DDHB 5F0MB 4X80H 5B3SB 5CGMA 5I5IA 1ELSA 3ATDA 2X5PA 1ND0A 3G6AB 3LD8C 2J3SA 5DMJB 1QHZA 4KNSA 1VPQA 4D8AA 4HS8H 3H0TA 4QRPE 2Q87A 2ZRWA 1U8KA 5HDRA 1W6GA 4QXTB 3IUDA 5EOCL 1OFOA 4X63A 2PRLA 4GUPB 3QC5X 1M05B 4I87A 3EOYG 1ZJIA 4IRSC 1U8IB 4GSXA 4P2OB 1YNTF 1BVLA 4WGVB 4YC2C 3UJRA 2DKSA 2NXYC 2PCPB 3UTSE 4N02A 2AITA 3CMFA 4LU5L 5J3HD 4HSQA 1V0KA 2K7QA 3FJ4A 2HTLC 3FH7A 4B9PA 3BGMA 3W6MA 3W7CA 3O3BB 3NQIA 1A5UA 4MAYA 4G8EB 2V5TA 4APQA 4M0XA 4RWYL 4PW3A 2D31B 2WINB 4NJJA 1ITBB 1JDEA 4Y5YB 4EAMA 4G3YH 3CFEB 4RNRB 4PM1A 2GVLA 1QBAA 4A63A 5TDPA 4KDTA 4XZNX 2YQGA 4Y9EA 3KZSA 2ZRVA 2OMUA 4LCWA 2AJVH 5FYLE 4ZDHA 4P7OA 4UT7L 4U05A 5G2WA 1T2QH 1S9XB 5D38A 4NLAA 2XWXA 2WZHA 1NCUA 3CXOA 1D6EB 4MNQD 3AWOA 1AR1D 1E6QM 4H8VA 1DBBL 3BP4B 1A8ZA 1KGXA 1P7KB 2XQYG 1N7ML 2WNKA 2ZCKH 3EYVA 5INCA 1PG7W 3HNSH 2DZEA 3QI9A 1W16A 4YXHH 1E65A 1Z69A 5C07D 2ZRZA 4UTJA 4QY8B 1FVPA 3MWAA 1IGSA 3VFGH 4JEJA 1ZHNA 2WHVA 4Q33A 1AUSL 1ZV5A 1QVOA 3FFDB 4NQVB 4QDGA 2JK5A 4TLSA 1EPXA 1OFAA 4PJFF 4FCAA 4AMKL 4F92B 4ZPVA 2GK1B 2X3AA 4L29A 5EU3A 4GLRI 2I25N 4DZ5A 5CLXA 3VFUB 4S0HA 1CZ1A 1KFKA 3KLQA 2MHAB 4XCYB 4DWDA 3O6KL 3WJYA 1NGZB 3SD2A 1JWSA 3QC6X 1JPKA 5FSEC 4JM2C 5F9DC 1XP3A 1OK8A 3DXIA 2OZ4L 3ILPA 3RVUD 1NQBA 1Y5XA 5D2NC 3F05A 5FKYA 3UDWC 1I9JH 2A0LD 4XT1C 1RZPA 1RLWA 2IMNA 5K1JA 4KRLB 1KBWA 1RL1A 3QUKB 3TONA 3WCYA 3QG6B 4M1GL 1N26A 3PNWA 1D7KA 1T03H 1T5AA 3L7FB 4WO4A 3TBYB 1DBTA 5GRVL 4BH8B 1AKJA 3UJ2A 1IGJB 2PW2A 3LX9A 4HFWB 1U8QA 3DA0A 3ENEA 4K71B 4NQDA 3UX9B 4BZGA 1U1UA 3KLAB 1VFSA 3CHDA 3FUNA 5HHPB 2PZ0A 3TKFA 1IGTA 5F1NA 5AC4A 3FFCE 2Q7YA 1I3VA 1EO8H 3EAKA 3KLKA 1IGYA 2BH0A 3DX9B 1J8HB 3AWFA 3OV6A 3P4MA 4JFYA 4Y4FD 1AMYA 2JWYA 1RPKA 1DSWA 4OLVH 2JKRM 2NR6D 3MRGB 3NZ8B 5K1VA 4N0UA 1TPUA 4NT6A 3FCTB 5AVNA 3LS4L 4L8SC 4PLOB 2FQEA 1UTDA 1RK0A 1BG9A 4FF9A 5AD0A 1FRGH 1YNPA 3HS0B 2F2KA 4BSJA 1XG4A 5I00A 4OKDA 1EJOL 1WFTA 2DQGL 1CLYH 1QTPA 4IRJA 3MVIA 3VD4A 1TWDA 1RJCA 5AC7A 2IANE 1M68A 4LCWB 3RTLA 1QA9B 3SADA 4Y4HC 1Q65A 4AQZA 1GGIL 3SUUA 1ZL1A 4WUUD 1UA6L 2WO4A 5DD1L 3K5TA 1E1EA 4DI9A 4UTBA 4IJCA 2W0UA 1PGRB 4OVUA 1Z3RA 4BFBD 2JJTC 4XMKH 1MFBL 2ZG1A 4PYGA 1RJQA 1E27A 1T20A 2N7SA 1VYRA 4ISVB 4C1NA 2E6JA 1NGQH 2AEQL 4AGPA 4BV1A 1FWTA 4NNXA 2CZFA 2VXNA 3G1AA 4E8GA 2EIJB 3P11L 2F58L 2VNCA 2Z64C 2ZCZA 3P54A 3Q1SH 3PBGA 3PJXA 4NUPA 2V9DA 1NJ9A 5IVNA 4NKIL 1OINA 3VFUA 1NMAH 3S7GA 1B3VA 2ACUA 4JDYA 5ABDE 1OGAB 1X44A 5TDOB 2BSSB 2X05A 3RKPA 3AIRA 4YC2B 2DQIH 3TCXA 4Q8PA 3APCA 3SY1A 4ICMA 2HPMA 3K5RA 3IVKB 1X7SA 3H24A 1LQSR 4PMDA 4HMEA 3HNVH 3DVGA 3HZYA 3QQDB 1J0NA 3QR0A 4YDIL 2CJ3A 3T0EC 3WJSA 1ETA1 4CEXC 3N2JA 4JREC 5ESAB 4PLNC 2ICWA 4YSAA 1TG8A 4MDJA 4EDXA 3FN3A 4ZFGL 1BGXH 1ZHBB 1LUCA 2WO5A 3X13B 1L9SA 4GUOA 3SDYL 3L68A 4QRRD 5FGCB 3FC8A 2XV6B 2E5DA 3SIKA 2ZA2A 2R2EB 1Y8BA 2HPIA 3G3MA 1JVNA 5I3GA 2AJ3A 1QK2A 1PSKL 4WCYH 1F3DH 4C8XA 1Z9LA 3FTWA 5FYJL 1KFLA 2A3AA 5I1AB 1GOXA 3B8IA 3O2DL 5E9AA 2O72A 5EIQA 3URNA 3ZIZA 4M19A 2CJUH 5I6PA 5LG6A 2VZUA 2AQPA 3CO4A 4XNDA 3VH8B 2XKNA 2P9RA 1Z9PA 2XX1A 4ZK8A 3WEOA 2B14A 4MZRA 2AKRB 2PNDA 5SWZA 4PJ8A 1WIOA 2VDOB<