4FNTA

Crystal structure of gh36 alpha-galactosidase agaa a355e d548n from geobacillus stearothermophilus in complex with raffinose
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
718
structure length
718
Chain Sequence
b'KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSNNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 225
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fntA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fntA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fntA02
2A6NA 1L0PA 4J27A 1VHNA 1UH2A 4XZ9A 5CG7A 1WO2A 1L6YA 3ZWTA 3EJUA 3NQEA 4EWND 4RXGA 3CZNA 4JIQA 1FUYA 3IGXA 2V2HA 3W7EA 2B4GA 3KVMA 3PB0A 4UNKA 3OLGA 2WSYA 1YPIA 4IXHA 2OW7A 1GVSA 5AB3A 3E12A 5LKYA 3LERA 1LM1A 3ZR6A 5AFDA 1K7XA 4UTJA 2C13A 4UTWC 2XVLA 1Y7VA 1IXNA 1QO5A 3NDOA 1Z41A 3CZGA 4Y96A 1TTJA 2CXGA 4XBSA 1EA9C 2ABAA 1K7EA 4LS1A 1E3ZA 5A8GA 3B4UA 4AH7A 4PEKA 4ORMA 1WAUA 1Z44A 1JDDA 3EDFA 2GOUA 4GINA 3ZT6A 3C2OA 1TRDA 3CZEA 3L5LA 3W1PA 2Y5EA 3CB8A 2I14A 1M5WA 5DY3A 3IIPA 3O6YX 4UQCA 3P82A 2DZTA 3QW4B 3EB2A 4LQ1A 3CU2A 3FJLA 3L0GA 2C7FA 4FXSA 4JXCA 2E5BA 5F4SA 2XN0A 4ZQCA 3EJSA 4K8EA 2CZEA 2QUVA 1D3GA 4JTIA 1TPVA 1JCYA 1V7YA 1YYAA 3BLIA 4I7UA 1W37A 3W83A 3CPRA 3CV5A 3WFZA 4R53A 1JD7A 4UQBA 2NWSA 4LV9A 2X2JA 1LOQA 3TSMA 3IIOA 5MHBA 3IJ8A 4DF0A 1W3TA 1S5VA 4JFSA 3UNDA 1VS1A 4KFPA 1LWHA 5C55A 2EAEA 1BVNP 3II1A 5T26A 1VJSA 4Z08A 1A53A 2J27A 2YFNA 4K7VA 3IGSA 5FF4A 4Q4KA 5D32A 4O1DA 1VFOA 4MVAA 1KCLA 2PWHA 1K8YA 3HGOA 1MXGA 2ZUWA 3CWOX 4AXKA 3WDHA 2GQ9A 3T78A 5E70A 2ZA2A 3EDJA 3MO7A 3ZSTA 2A7RA 4ZZ9A 1X1ZA 2WVTA 1ZJIA 2ZXQA 4J3TA 1MW0A 4CNOA 5EYWA 2ISVA 3LBMA 4JCMA 3A5VA 2WSQA 3TONA 1PHQA 3QMRA 4OGZA 1CXFA 3QGVA 1QHOA 3HMJG 5G5IA 3VFLA 1R46A 1VC4A 4UQEA 1QR7A 3NQ8A 4DF1A 3P8JA 2CLLA 1BVZA 4O11A 4A2SA 3HG2A 3W7DA 1CW2A 3PUEA 1H61A 1O5XA 5K2ZA 1JI2A 4WSKA 2TAAA 1KGUA 3NVTA 3L5MA 3JRKA 3W71A 3VE7A 3EXSA 3CZKA 4JFUA 2CLIA 1RR2A 2V2CA 3AJXA 1EIXA 2WNWA 2NUYA 1BKSA 4NI3A 3B06A 4UIOA 4FLQA 1TQTA 5E93A 3NPVA 3W7JA 5CZJA 1H7PA 5FI8A 4U4MA 2ZFAA 2ZRUA 3F4WA 2YDAA 4I9AA 3HG5A 4J3VA 4MJZA 1XM3A 1S5WA 3GDTA 4MFEA 2WKGA 4GI8A 1HL2A 1G94A 3GBDA 3TR2A 4LUIA 1PIFA 5GVJA 3MI3A 4Z1BA 2YX0A 1L6SA 5CSRA 3HJEA 1YDVA 2VNCA 4QM1A 3I6RA 5K4ZA 1KXTA 2ALDA 5FF7A 1M6JA 1QOPA 3ZS4A 3DFQA 4O1BA 4NJKA 1FCUA 2BHUA 1WE5A 3NQAA 2PWGA 3GTNA 3NYZA 3C8FA 4ADTA 4M6PA 2V5BA 3DBPA 1J0IA 4N2YA 4LVAA 3MYOA 3BVUA 3EWBX 5F2LA 1RD5A 1AMYA 2WPBA 4HKPA 2WSKA 3EJRA 3LXBA 2C19A 3TTYA 1QW8A 3DDFA 4AEFA 3NQDA 2ZX7A 4FLOA 1KA9F 3U6WA 4A22A 2F61A 4AEEA 1KW1A 1HUVA 4UMAA 3FKRA 1KFBA 3N19B 3W74A 1YLVA 1P6WA 4NNCA 4DBEA 1BAGA 5LGZA 3N9SA 3DKJA 1TMQA 5DLCA 4JFWA 4KWWA 4JTUA 1D7FA 4NT0A 2J9XA 5DBUA 1XC4A 3WNNA 3G18A 1GQNA 2F1BA 3O6DA 1OX5A 2ZZ4A 3GIYA 2CLOA 4CKQA 1PS9A 2CFFA 4WLCA 1XSIA 2QCDA 4POCA 2JGYA 3UXAA 1SMAA 5AYZA 1KV8A 1EWDA 4A2RA 4OBTA 4EVZA 2C3ZA 4U2ZA 3WNKA 5DFAA 3WNPA 4Z1AA 2D0FA 2EHHA 1DHKA 4FF7A 2YA0A 1MSSA 3WNMA 3EX2A 1UCWA 1MWOA 1U83A 3VX1A 1XUZA 5CGMA 3YPIA 4GRSA 3LRMA 3QMSA 3EKZA 1UASA 2YR1A 3SR7A 4GUFA 5LGXA 3GXTA 4K39A 1N55A 2AAAA 2VRQA 3VMNA 2ZRZA 1C8QA 1HO4A 3SJ3A 2ATSA 4IUOA 3RK8A 1QO2A 1YDNA 3DX1A 3VGEA 1I2NA 1K8ZA 2QCNA 2QF7A 3U2OA 5BMXA 1JVNA 1VAHA 1TQSA 4G1KA 4K6AA 1O5KA 3LCXA 3KLLA 2GQAA 1DBTA 3GAYA 1XL9A 2VELA 1NAL1 4JDYA 4DELA 4IMDA 6TIMA 3ZO9A 2DJLA 1QPRA 4B9YA 2QJGA 3PS7A 4GO8A 3NZ1A 3NQ2A 4JTLA 2H6RA 3FAWA 4P2VA 1I2QA 3G1FA 3W7QA 1P4CA 4K8HA 1RPKA 4JX4A 5C6MA 3K30A 5FEWA 3TJXA 2GQ8A 2O7SA 5EBUA 3UY8A 4CN1A 4X9SA 1XGZA 3LHWA 2ZUSA 1VH7A 3HG3A 1ZFJA 5HQEA 3LCLA 1NM9A 4UTTA 3NL6A 1XBVA 3TFCA 2E68A 3F1QA 3PUDA 1QHPA 5HR7A 3M16A 2EPHA 1ZALA 1OK4A 1G6CA 4OJYA 3IGUA 3TOPA 4FX6M 5CGQA 5J5DA 4AIEA 3LHVA 4K37A 3VI2A 5LNSA 3I7QA 4QAWA 1K3UA 4JX6A 1A5SA 2QCCA 2QCEA 3UG3A 4UR8A 1DQWA 1LBLA 1OX4B 1WBJA 5D2TA 1HT6A 4RZ6A 4O1CA 4O16A 4GI6A 4MYXA 4ALDA 1KFJA 4UFHA 4DPPA 1SO6A 1AVAA 1MFUA 5I3FA 3DXIA 1H7WA 4WZHA 1IXQA 2NWRA 4RX0A 2FGZA 4HN4A 2ABBA 2DZVA 3EDEA 4AAJA 4UNIA 4YXGA 2RH9A 2W0UA 7CGTA 2UV8G 2ZZ1A 1AW5A 3TUUA 4CNPA 1HTYA 3N2MA 4HT3A 1PJ9A 3W84A 1XFBA 3K1DA 1WZAA 3E96A 3BK0A 1V3MA 1KGXA 2FPTA 1MZHA 1UA7A 4UMCA 2ZYFA 3BLPX 2WQPA 1KBKA 3GDLA 4K36A 5LNUA 1M7XA 3VGDA 4UOQA 4JS3A 4OHQA 3SZ8A 1KTNA 1W1ZA 2Y89A 1YPFA 1WX0A 4KKXA 1E3XA 3DX2A 1AL7A 5D03A 3NPUA 4HSNA 4CN4A 3P80A 3VM7A 3DX0A 3Q37A 4JD4A 2XWDA 2PCQA 3M9YA 3NL2A 1E40A 5DXXA 1DTUA 1VFUA 1JUKA 4LY8A 2ZDRA 1FDYA 3RMJA 3UPWA 4NJJA 1QFEA 4PODA 1SW3A 3W23A 4JTHA 5F4WA 2Y7EA 5CZSA 4AHOA 3DI0A 2V9DA 3M6YA 4GUHA 3W07A 2E6YA 4RKAA 3PB2A 3AMLA 3QQ1A 3A24A 2OCZA 4AMWA 1FWNA 3STCA 3A47A 3DHPA 2P10A 3OG3A 1FX6A 1SZNA 3DI1A 4PEEA 5KSWA 2OT1A 3IIXA 1GVOA 3QF0A 5D38A 3TKFA 3BVVA 2DIJA 3BLEA 1SZFA 4XBKA 3GXFA 3ZR4A 3TQ0A 4NNAA 5KITA 4ICNA 2Y63A 3LCFA 2ZWYA 2QV4A 3R5EA 2A7PA 2BLEA 4LV4A 2WSPA 1KFCA 3O63A 1HO1A 4DF2A 1RP9A 3EX4A 1VRDA 2VEIA 2WNQA 1Q4NX 3IVSA 4ZQMA 1ML1A 4ZQOA 3VGBA 4AMAA 1TPH1 3UG5A 3CIXA 4N4PA 5D37A 1VHCA 4UTWA 3DU0A 3G1DA 4DBDA 1XKYA 3CLMA 4EF9A 3TQVA 4KFOA 1H3GA 4P61A 4GJ1A 1JF5A 4LVFA 2OX1A 3C0JA 1GJPA 3BG3A 1PIIA 4FNSA 2WOQA 5FEXA 4O4WA 3DENA 5CXPA 4TVUA 3LRLA 2JKAA 2YA2A 2QJIA 3I65A 2BWGA 1N7KA 4BR1A 4M5PA 1AL8A 4GI9A 1UKQA 2CLMA 1XH2A 4XKYA 1H7RA 2FHBA 4L4LA 4MAZA 2O7QA 3P62A 3DC0A 3PM6A 2EJ1A 4MY9A 3H55A 1CGTA 2BXVA 4U28A 5LHFA 1V3LA 4FLRA 3NL3A 3IK2A 3OLDA 5DO8A 1KLZA 4O19A 3WEOA 1CI1A 1E51A 1FCQA 3IEBA 3S6DA 2WVUA 5FEZA 3ZQ9A 4AVFA 1VQTA 3W7GA 1NVMA 3UQNA 1O7DC 5G1TA 1W3IA 3C2EA 2DZSA 1P0NA 1XBYA 5U4NA 1CPUA 3GZ3A 1EHAA 3RF9A 3TC6A 4UTUA 4IX0A 1F7BA 2QAFA 2QMJA 4LW7A 1QPKA 3AMKA 3DKLA 4BI6A 3HF3A 1YTEA 8CGTA 3FYOA 4FB7A 3P61A 4UFJA 3SIZA 4MPQA 3CTTA 1VPXA 5I3IA 1SO3A 4FNUA 1JFHA 1WP6A 3Q94A 3GXPA 3DHUA 2H90A 1VB9A 2LLEA 3BGJA 2QDHA 1W5MA 1GG0A 3P5ZA 4I7VA 4RLIA 2YCEA 4LVGA 4BK9A 4GO9A 3MWAA 5C5YA 1YADA 3HPSA 5LNVA 4JN6A 1QX1A 3GNDA 3QYQA 2EADA 1QAPA 3WK0A 2A2IA 4IX2A 3FYPA 4CQ8A 4MY8A 4EF8A 3OEXA 2BY3A 3WDJA 1VLWA 3B0UX 1V3KA 2E8YA 1I2RA 1E43A 2XFWA 3FIGA 3W2LA 3AXIA 2D2OA 5FF3A 4GUGA 2WVVB 3D51A 3QM3A 3K8LA 2WCGA 2YIHA 4R34A 5BMWA 3W1NA 4LC8A 3KEHA 1OB0A 3QEZA 1FQ0A 1MEWA 4WY0B 3U8GA 5D09A 4XQ6A 4RXFA 3ELFA 5H2ZA 3R89A 3A5FA 3NR0A 3NM3A 4N9DA 3BV4A 3VNDA 1Q6QA 2H3BA 4H8HA 2QJHA 1TPDA 4Q33A 3ZWSA 3W70A 3UWVA 1OFPA 2QR6A 4UCGA 1KM5A 2C15A 3DX4A 1BWLA 1D3CA 3LTPA 2YKKA 2ZA1A 1KXVA 3LHZA 4N6EA 3BAWA 5I3HA 4H2CA 1FWWA 4OV4A 1RQEA 4RCXA 1QWNA 1SFJA 1KM4A 4M6QA 1DL3A 3S5YA 1C29A 1TRIA 2NXGA 1OFBA 3QZEA 3INPA 4GBUA 1FY6A 1FDZA 3LCHA 1HTIA 2CLEA 3LV5A 2YJQA 4MZ1A 4YLWA 1F6PA 1FWTA 2DU2A 3G0XA 1JQVA 2E77A 1GTHA 2VR5A 2F18A 2ZRVA 4JTTA 3NL5A 3FAXA 1GYLA 2TPSA 1BLIA 3L4ZA 3GKAA 1GPWA 3WJYA 3HIJA 1X7FA 2OZ0A 3W7RA 2ZX8A 4GE8A 3THQA 3KL5A 2X1SA 5EPDA 1EO7A 2BX7A 5AN7A 1U5JA 3W9ZA 2RDWA 3PSWA 4AWSA 5K9DA 3LLFA 1DEDA 5K7JA 4ATWA 2NUXA 4U31A 4FNRA 3GK0A 2A5HA 3SI9A 1CXLA 3W3OA 1UD6A 1WA3A 1ALDA 4GQRA 3WY4A 5F1UA 2GJLA 1H50A 3L65A 2VFDA 4UZUA 2VUYA 5G4EA 4HNVA 5EMYA 1N8FA 3EJPA 2F7OA 4M19A 3BVTA 2PE4A 5HNRA 3VSVA 2Y6ZA 4JY8A 3LRKA 2OT0A 4K7YA 1LTDA 1XD1A 3WEMA 1U2YA 3BUDA 3IJ7A 1DHPA 1EUAA 7TAAA 3LXCA 3KVKA 4Y8FA 1EO5A 1CX9A 1W9XA 5I3KA 4OKDA 1TSIA 4JTEA 3NQ7A 3BVXA 3B03A 4UZSA 1WOBA 4J3SA 4LS2A 3EXTA 1KTCA 3LDVA 3N73A 2ZUVA 3MYPA 3D52A 1WZLA 1FCVA 2A1YA 1R34A 1XBXA 3CM4A 1KXHA 3GLCA 2VFFA 2G95A 1ZJAA 3W7KA 3AXHA 1G9HA 4H4IA 3PR2A 2E6FA 4N9EA 3TA6A 2F7QA 3EWYA 2CW6A 1SUXA 3EKLA 4LT9A 3RNDA 4RJEA 1B2YA 1JUEA 3O6CA 1KB3A 4H6KA 3BUBA 2ZZ5A 4AWUA 1L6WA 3VU2A 4O1AA 3LBCA 2C0AA 4JYFA 3V75A 1DORA 3KXQA 4BA0A 1Q45A 3CWNA 4FNQA 1UBSA 1T0OA 2YOCA 3ABOA 3LTSA 3USBA 3BLBA 1ME8A 1XSJA 4OT7A 5I3JA 5DXYA 1NOFA 1WDWA 2C18A 1YDOA 1JULA 4Q32A 1R2SA 2FE0A 1BPLB 5D2VA 1W5QA 1A47A 3I68A 1DJQA 3P7YA 2BY1A 1TTIA 2GJRA 2X1RA 3H53A 1JCXA 4CLMA 2YA1A 1LLZA 1GZGA 3M43A 2XVKA 1VCVA 2VT0A 5FESA 2GPTA 3PULA 3B0PA 1PIGA 1GG1A 1CLVA 3NA8A 1SFLA 1W31A 4UTHA 1R33A 1EH9A 1VCFA 1W0MA 2QCMA 2E9BA 4TIMA 1JL8A 3C61A 3BUIA 1PCKA 5HWJA 1UOKA 1ADOA 4MB1A 4HNNA 1W5NA 1KFLA 1PHWA 1B0IA 1GCYA 3KFTA 2ISSA 4X2RA 4RZ5A 2G96A 5K9XA 3UWQA 2Y7DA 1TQVA 1SPQA 3G8RA 3C2FA 3C2RA 3FLUA 2ZX9A 1PV8A 3A6OA 1YXCA 2Q3RA 1KV5A 1PS3A 2B0MA 1GVFA 2V81A 4IJBA 3SSJA 2NX1A 1KM2A 4WF7A 3TV8A 5EKYA 4B9ZA 3EX3A 5D05A 1F74A 2ZICA 4MLRA 1B3OA 1OK6A 5LHEA 1OYAA 5LZLA 2Q8LA 3GBEA 3C6CA 3W2NA 4YMZA 3PWAA 4AF0B 3LGEA 1UD4A 1UUOA 5HDRA 2WC7A 3FFSA 4JFTA 3RLVA 4CCCA 2ZE0A 1JAEA 2CLHA 3G1SA 1OABA 5KMYA 3R2GA 2GVLA 2J25A 3NO5A 2GVJA 4OV9A 1ME7A 1PPIA 2W6RA 1ZNNA 4PH6A 3STGA 2I1OA 3I7SA 4J28A 5CPLA 4S2CA 3E0IA 1L9WA 2E6AA 3KRSA 3C2VA 1QWGA 3BUQA 1KLYA 4R33A 1TV7A 3GDRA 2YFOA 1T99A 3CIWA 4X9YA 4O18A 1DJNA 1M7OA 1S3HA 1W5OA 3LLDA 4R7JA 1LBMA 3QRHA 2RDUA 3E49A 3GDMA 2A0NA 4I7WA 3M5YA 3HZ3A 2BXYA 1VFMA 4IWWA 1XBZA 3E02A 1PVNA 5L9FA 2GUYA 4QJ1A 3BPWA 2D0GA 3NZRA 5CLTA 3TX9A 3HGRA 4UTKA 5SWUA 3TAOA 3BG5A 1QI3A 3O8AA 5D02A 3GYEA 3MHGA 4UCFA 3KHJA 6TAAA 1EX5A 4JR5A 3UWUA 2WNNA 3QW3A 3S8HA 3KRZA 2E4TA 4JTGA 3MP4A 3VCRA 1LDCA 3C3NA 4IPIA 1H63A 1M7PA 4KWVA 1ZJBA 2QCDB 2BTMA 4DO6A 1KFEA 4JNMA 2VC6A 4AHPA 2YGYA 4AYSA 4FHAA 3LXAA 1P5BA 4ZQRA 3O16A 2VKZG 1I75A 2AMGA 3CEPA 3QSTA 3G1VA 4Y9AA 3W2UA 1JRBA 2WNZA 4JY9A 4IXXA 1I2PA 1DKWA 3DFOA 3M44A 2DP3A 5A2BA 1OF6A 1MEHA 4PFMA 3L66A 1MEIA 3GXNA 4JTKA 2R14A 4LU0A 1B9BA 1GEQA 2FJKA 2NLIA 3EDKA 2ISWA 4UQ9A 3W88A 1H7NA 1GVIA 1FWSA 4FX8A 3OHIA 3O06A 4ADSA 5LNWA 3T4CA 5I23A 1BG9A 2OYKA 2QUTA 3EX1A 3TC7A 1XCWA 2YPIA 3CZLA 2FPYA 3R13A 5FF2A 4PCFA 1AMKA 1JGIA 2Y24A 1G4EA 1F6KA 1VLIA 3BSGA 4NJIA 3LHYA 4AYGA 2A85A 3BAJA 2A7NA 3DFSA 2Y88A 1JI1A 5A6LA 2EEXA 1GYNA 3L2IA 3SGZA 4HOXA 2JKEA 3W87A 5EY5A 5HUPA 3UZJA 2CHNA 3TW6A 5BOOA 2EF9A 5H91A 2D73A 3T55A 3UPBA 5E6ZA 4UFKA 5FEPA 4LC6A 5K3VA 2E1DA 4HSOA 4FLSA 1K7FA 2HS6A 3EDDA 3VGFA 3M1ZA 4O0ZA 1XCFA 4GKLA 4E0CA 3KVJA 3BARA 1TPWA 3L4TA 2WKLA 3PF3A 4AHQA 1BTMA 1RPXA 3FW6A 1G5AA 5K9CA 3Q2DA 3MMTA 3NQVA 4TO8A 1HVXA 1WOAA 3S5NA 1LROA 1CGWA 3ATZA 4FNTA 4WOQA 2ZBTA 4MJMA 3LCWA 3STFA 1VGAA 1MW2A 1QPQA 5D2XA 3JR2A 3L4XA 1DQXA 1XSKA 4BFAA 3CHVA 1ZCOA 4O52A 1LWJA 3L2LA 1VIWA 1OYBA 1TQJA 1RQHA 3BW2A 4MYAA 3DHDA 2R94A 2GUUA 2CPUA 1Z32X 4DO5A 3MHFA 1I4NA 5G2HA 7TIMA 5HWNA 1MFVA 5E0FA 4C1KA 4WX2A 3BAYA 3VNYA 4AB4A 1VYSX 3TQKA 1ICQA 4Z1CA 3W1AA 3JS3A 3ZT5A 2HTMA 2NT1A 3R12A 5CGTA 5TD4A 4H8VA 2D0HA 5KZMA 1ME9A 2ZUUA 2XN1A 1O94A 5KINA 4O8RA 3C56A 3TMQA 2DH2A 3PBVA 2VFHA 4WXYA 3W76A 1WV2A 3KX6A 4H3DA 2NXHA 3G22A 2ZCGA 1IXOA 3B8DA 1FXPA 1TIMA 2OSYA 4ZQNA 1PZ2A 4XB3A 2VEKA 1VYRA 1EP1A 4JGDA 1LOSA 1KCKA 3BC9A 2ZXBA 1SO5A 4WY0F 4BZYA 1CDGA 2JBMA 2QUUA 2NXIA 2VEMA 2ZZ7A 4Y90A 4NXSA 1J0HA 4HOWA 1AK5A 1EP3A 1F5ZA 2TMDA 5AHEA 3TSBA 2WKJA 2NSXA 1G1YA 4GUIA 2VOMA 2NZLA 5I0DA 1OSEA 1K02A 4GXMA 3NGJA 2RDTA 3W75A 3W1XA 3H54A 3EWWA 3WENA 4A3UA 4DQWA 3G0UA 1DVJA 3WK3A 4BWLA 5D04C 1W5PA 3B04A 5HULA 4IGHA 1AQMA 4YCPA 3P60A 2QMKA 3M5XA 3W7MA 4M56A 3HOJA 3C52A 1TCMA 1AG1O 3A9IA 4YCOA 1OGSA 1GVQA 3UWWA 1XD0A 3L5AA 3PBWA 5HXMA 2FDSA 4M7SA 4O17A 5TBOA 1GJUA 4ONVA 2EKCA 4UR7A 2J9YA 3KAOA 3RLUA 3BH4A 2F2HA 3BUPA 3PUOA 4NUWA 1J4EA 4IMGA 1UKSA 3DDGA 1LLWA 1XDMA 2X1UA 1CXHA 3CEUA 3MHUA 3NG3A 4UNLA 2P1FA 4Z0JA 2A6LA 3P84A 3WELA 3BCFA 2J24A 3UG4A 3TU9A 3B0VC 4PA8A 3L4VA 4AWTA 3TE9A 2I9EA 3LPPA 1D3HA 4LXFA 2A4AA 4JYDA 3G1YA 1B57A 5F2IA 2J9ZA 1RQBA 1SU5A 2WJZA 1KWKA 1FXQA 3WMSA 4WXZA 3VGHA 3GDKA 3VGGA 4HPJA 1TQUA 3LTYA 1TO3A 4DEFA 4UFLA 3AO0A 1UD3A 1XI3A 1HFBA 5DELA 2G97A 3RIKA 3BCDA 2WV8A 3CT7A 4J3XA 1O60A 3W7LA 2ZTKA 2AAMA 4WY0A 4N4QA 2BY0A 3N34A 5F1VA 2E8ZA 3BVWA 1GVRA 2PWDA 4NNBA 4PSPA 4AW7A 4BF9A 3VSTA 2QCGA 4N02A 1ZY9A 3GXDA 1IF2A 2FB2A 2OSWA 3BMVA 5EA9A 5F4XA 4O53A 1OX6A 4O28A 3MI2A 2TSYA 4Y6GA 3A23A 5E6YA 2QKFA 1LCOA 1WYIA 2YW4A 1HNYA 4ZVJA 2ZQ0A 3WJWA 1OT2A 4AMXA 2FH6A 1G67A 1UUMA 3K8MA 3ABQA 4WUIA 3QH2A 4MFDA 1CGXA 1THFD 3DFNA 3WJXA 2X2GA 4GNJA 5F2MA 5A2CA 4UQDA 3EX6A 4O12A 4CCDA 1XH1A 4O0KA 4JX5A 2V3FA 2ZZ6A 3WY1A 4U2YA 2YZRA 1Z48A 3TIMA 5BRQA 2PC4A 3P81A 1JRCA 2X2IA 1SZGA 3OA3A 3PC0A 3NXFA 3VM5A 3NQ6A 3WDIA 2PURA 3G24A 1PAMA 2JK2A 2RFGA 1T8XA 3LCGA 1RV8A 2XIIA 2E09A 1RP8A 3HB9A 3RFAA 4HNUA 5DN1A 3VSUA 4O50A 2ZIDA 3W1QA 5DCEA 1Q6LA 1PCWA 5D2YA 3VE9A 4HIBA 3MJYA 3NQFA 2FHFA 1CIUA 4PTNA 3FJ6A 5AYYA 1TQXA 4Z0SA 1ONRA 2WVSA 4NX0A 2G5WA 3BLFA 3W37A 4JEQA 3QJAA 3LB0A 1TCDA 3TDFA 5EMUA 2FFCA 4OIFA 1R2RA 1V5XA 4GFSA 4WJEA 2YW3A 1TYGA 3S2CA 3WK1A 3DH7A 4YWIA 3N14A 1EUNA 4BWLC 1VCGA 1TQWA 5FF0A 4OQVA 4LVDA 2XN2A 1P0KA 1OFDA 1TTQA 4J9JA 4X22A 4XWUA 5CZ0A 5HINA 1M53A 5KZEA 4KWUA 2NX3A 4JTSA 5E0KA 1UKTA 2EO7A 4RK8A 3EJTA 1YTDA 2Y85A 3D0CA 5IBXC 2Y61A 3CPUA 2Z6IA 4LVBA 2HS8A 1QI4A 3FA5A 5U7SA 3M41A 1ZHAA 4HP5A 1TPEA 3N9RA 4FXRA 4FX7A 2FTPA 3SFKA 1YXDA 1MVYA 3CZSA 4IPJA 4BI7A 3PG9A 2Y62A 3S1WA 3BMWA 2VEPA 4CGTA 1XCXA 2DH3A 3L4UA 3TXVA 5BW6A 2HMCA 1Q3NA 1OFRA 5I5RA 1LOLA 3W1LA 1SW0A 3L9CA 1Q6OA 3UWYA 2Y70A 1EP2A 3IV3A 4ORIA 5CPOA 2C6QA 3GAKA 4E38A 3OVRA 4N6FA 5C54A 4WSJA 2BXZA 3TFXA 3GB6A 3CLWA 1I8JA 1KBBA 3L2MA 2EGZA 3OBKA 5D30A 2A21A 1NFBA 3HJZA 1PZ3A 5LSMA 1ICPA 2H3DA 5AC7A 4W9TA 3ZOAA 2VRKA 3L67A 2FPVA 1MW1A 4PCSA 3G3DA 2V8ZA 1KM1A 2Q3OA 1LORA 3OIXA 3LI0A 3TNOA 1WBHA 1LBFA 5DCDA 3WNOA 1VZWA 1K03A 3BW4A 5HWMA 3TMLA 2CU0A 2C16A 3W73A 1YXYA 4DXVA 2EQDA 1F76A 4UFMA 1EB3A 3T7VA 3S0CA 4HPXA 4JFVA 1ZS2A 1JCMP 3RU6A 3UXDA 4UOZA 4QISA 2H8ZA 4RV8A 1XUUA 4MOZA 1LYXA 5HMSA 5CKSA 4IOTA 4O4VA 3EWXA 3EWUA 1AW1A 4UMBA 1K8XA 1VR6A 2NUWA 1YTKA 2OJPA 1IZJA 4E2OA 4NX5A 5CPMA 4AIOA 1A5AA 3G3MA 4OU1A 3T44A 4AEOA 2V82A 1XV8A 1KGWA 2FLIA 2E5DA 3CQ0A 3IRDA 4XTIA 3LOTA 1O95A 5TQLA 4A29A 1HL9A 1H1YA 1C8VA 1OFAA 1QPOA 1UH4A 4IQLA 3W1TA 2ZX6A 5KTLA 2Y7GA 5IM51 2Y4SA 2C14A 4N9BA 4JTJA 1IXPA 3D4ZA 3FOKA 5HR6A 4CVWA 3KVLA 4NU7A 3TH6A 2QPUA 3NM1A 4UXDA 2BHZA 3STEA 4JL1A 1SZEA 4QIUA 5AHLA 1QW9A 1OJXA 1ZAHA 3W72A 2OSXA 3LX9A 4M6VA 3UD6A 4FO4A 6ALDA 2ZXDA 1IIHA 1JQXA 1H7XA 2IQTA 4LS0A 5G2IA 3UYCA 4NVTA 4JTFA 1LRTA 4NXKA 4TU1A 5A6MA 3S5OA 1QI5A 4HHPA 2OYLA 4AF0A 2EABA 5BRPA 1JG9A 2V2DA 2FHCA 3NEVA 5KZDA 2YSWA 1V3JA 3NPXA 3BAXA 1SSGA 5AYXA 4EOUA 4CN6A 3GXIA 3P5YA 2GJNA 4NQ1A 1Q6RA 3BVJA 4J3UA 1KBJA 1QMLA 3G0SA 1R47A 2WO5A 2X2HA 3HQ1A 4O15A 4QNEA 5D2WA 5BRBA 3EXRA 4JIPA 2ZA3A 2G3NA 4O57A 1OVDA 5EL1A 3KL3A 1GT8A 2YYUA 1SO4A 2CZ5A 1A5BA 1BEUA 8TIMA 4O14A 1A50A 3HGJA 3UZ5A 4HNTA 5E1QA 1G7VA 3N2XA 3GR8A 5LNRA 5C2XA 2V3EA 3P74A 1HX0A 1LZOA 2ZTJA 2PRHA 4TMBA 5AHIA 1OFOA 5TIMA 2QPSA 3VNZA 1KFKA 3WK2A 4JCLA 2WANA 1G69A 3GNNA 1UD2A 3NAVA 4XUGA 2VXNA 1XH0A 3A21A 3L4WA 4IMCA 4UUIA 3W1MA 2IGTA 1FWRA 1TJRA 4LUJA 3QQ0A 2Y2WA 4LRSA 3W1RA 1VJIA 2B7OA 5HPOA 5F7UA 1DOSA 1JCJA 4J7RA 4B5NA 4LTSA 1Y0EA 1IIGA 3TXZA 2P0OA 1W3NA 1H62A 3E9AA 3GVGA 1OT1A 2FQIA 3VKJA 1JR1A 5CLWA 2Y7FA 4ADUA 1CXEA 9CGTA 3LI1A 4M7TA 3LPOA 4CQAA 2B7PA 1HWWA 2XIBA 4PSRA 1NF7A 4S2BA 2F7PA 1AQHA 2GVYA 2DZUA 4QNWA 3AJ7A 3GXMA 3S42A 5K4XA 2XWEA 4S1FA 1QNVA 1AW2A 1FDJA 3MUXA 3OVQA 1F73A 2DJXA 3TROA 1GOXA 4IMFA 3TK7A 2Z0IA 1TB3A 3W7IA 1TPC1 1S46A 3QC3A 5A2AA 3QPZA 4JYEA 3S1XA 2F7RA 4NJGA 2Z1BA 2NT0A 4NZFA 3F4NA 1JD9A 1KXQA 2ZWZA 1CYGA 4OE7A 1IV8A 2QCFA 2WSRA 1OHLA 1C9DA 3ZSSA 2ZZ2A 1GTEA 4UTLA 3O1NA 5HJLA 1WZMA 1JDAA 2J88A 1TV8A 2ZX5A 2HSAA 4FIRA 2YYTA 2ZUTA 2F7FA 1NEYA 4U3CA 4NJHA 1X8FA 3IVTA 3ZFHA 3V1PA 3NQGA 1EWEA 3KLKA 1QCWA 4X3ZA 1ZAIA 1QPNA 3UY7A 2CZFA 3HG4A 1Z42A 5CZTA 2PWEA 2QDGA 4MZYA 3EWZA 1UD8A 1B4EA 1TPUA 1U30A 4U33A 2NX9A 3IIZA 3T40A 2NV2A 3WN6A 3EEGA 1OX4A 2QEZA 3M47A 3DZ1A 3CC1A 1U33A 1IGSA 2V0TA 3L0NA 3BO9A 5KEZA 1MXDA 1R2TA 2RKXA 4O10A 2E5CA 2V30A 3L0KA 2BZNA 4FIQA 1TPFA 4O54A 3I7RA 3M7WA 3W2JA 4YL2A 3UEQA 3UWZA 3WFAA 3WNLA 3O07A 3LHTA 1H5YA 3F03K 2FIQA 2Z6JA 4PL2A 3TSDA 2BHYA 1SQ7A 5BNKA 1X6UA 3UERA 5AC8A 5AHNA 4CNNA 3SGUA 1CGUA 4K38A 6CGTA 3ECQA 1ZENA 1WQ5A 2J6XA 4ZL1A 3WJZA 3TJLA 3TTSA 4UC5A 1GJWA 4KMQA 2DIEA 5AHMA 1UB3A 3KE0A 4WD0A 2CWNA 3QPYA 4TR9A 1WZKA 3IVUA 1WXJA 2BSLA 2H8XA 2FB3A 3BAIA 2OMAA 2PRLA 2R8WA 3HPZA 2CZDA 1P1XA 3BSHA 3W22A 1F05A 3P67A 2C1HA 3PG8A 1UA3A 3FS2A 4NZJA 1NF0A 1TPB1 4Z1DA 4RR4A 2G3MA 4N9CA 3IJ9A 3G1XA 4MKNA 4MZ8A 5CPNA 1EA0A 3LHUA 3WY2A 4GWEA 3OVPA 3TW7A 4IMEA 3L68A 4RZ4A 1ODUA 2XVGA 1CGVA 3DAQA 2AQWA 1WPCA 4FEZA 1OYCA 2W79A 3PSVA 4UTIA 3C4UA 2VFIA 1R75A 3PY2A 4L4MA 3WY3A 2ZRXA 1JDCA 2RHGA 3ANYA 5A5WA 1XXXA 2X16A 1G4PA 2ATMA 4GIAA 1L2UA 4A21A 1JF6A 3W7OA 2DZXA 3WJSA 1UD5A 3S1UA 3EJQA 2WPGA 4JDBA 3R8RA 2JKPA 4UFIA 1EPXA 4OWGA 1J0JA 1J2WA 5DBTA 3KWXA 1CXIA 2EACA 4J3WA 2NV1A 1W54A 3DHFA 3S1VA 3GR7A 2VENA 1KTBA 4GQQA 3UCQA 4CCEA 4KFNA 2GJPA 4H7VA 3DGRA 1ZAJA 3BG9A 2ALWA 2JGQA 3L21A 3ZT7A 1SR9A 3THAA 1BSIA 1HXKA 5DCBA 5DY2A 2EAWA 3MP3A 5G4WA 3W86A 1H51A 3KOFA 1LP6A 3BW3A 3SY5A 1JUBA 1G7UA 5L6UA 5G2WA 2KZHA 3VMPA 3W38A 2F84A 3MBDA 3D50A 3W85A 3A22A 4LPCA 5AHFA 2QLYA 1LRNA 2QCHA 4XTDA 5F2GA 1DV7A 3QFEA 1KM6A 4LNYA 1UH3A 2ZRYA 3TAKA 1XDLA 3W2KA 1CGYA 2OYMA 4FNPA 4PL1A 1MW3A 1S5TA 3L4YA 4E2DA 5AOUA 1I2OA 1TREA 2ZXAA 3FKKA 4UTMA 3CGTA 1D9EA 3G1AA 1JJKA 2ZZ3A 1F2JA 2F1AA 5AC6A 4D2JA 5J5RA 2DZWA 3QMTA 4ML9A 3HBLA 3PBUA 1IZKA 1RZMA 3CTLA 3KL0A 3BGGA 1A5CA 3GKFA 4C1LA 2PRMA 1NSJA 2D3NA 1T96A 3ZR5A 1HG3A 3FEMA 1TTPA 3Q58A 2VFEA 3NPWA 4DO4A 1H1ZA 4PC8A 1HL8A 1TV5A 3DFTA 4EIVA 3O15A 4QQ3A 1OG0A 2TYSA 1JXKA 5IBXA 4JL2A 3OLIA 4MIMA 2E6DA 3W7HA 3O05A 1G4TA 4UTTC 1PEZA 3A4AA 4WQ6A 3BLKA 3M0ZA 3HO8A 3VMOA 4ZMGA 3PBYA 5I24A 5G1YA 5I3GA 4LWWA 3LM7A 1J0KA 1SSDA 1W56A 3MW7A 2QCLA 3LCIA 2FH8A 4GUJA 2FYVA 2D3LA 4W93A 2OW6A 1OF8A 4XKYB 3QSRA 4PCTA 1QWUA 2DORA 2V3DA 2BY2A 2E0PA 3M07A 4TX9A 3BAKA 1H7OA 1O4UA 2X1TA 1W8SA 3VO0A 1VYPX 1KM3A 2DZPA 1KM0A 3D4YA 3W6YA 1LRQA 3W7CA 3OLEA 2WVVA 2X30A 1JCNA 4MUZA 2YXGA 3KRUA 1QOQA 4ZQPA 3NQMA 3PVFA 4M8UA 3HPXA 3S9YA 1OFQA 2PWFA 2CLFA 4HA1A 3ATYA 1R30A 2Z1KA 4JICA 4DPQA 1TMHA 3W7PA 3G1HA 3NNTA 2Z2UA 3MBFA 1UJPA 1B4KA 1PE1A 3M5ZA 3SW6A 4MY1A 3W2MA 3NOEA 3ABRA 3LV6A 2Q8ZA 1MO0A 4BI5A 2GVGA 1QDSA 1KBIA 4X0NA 3DX3A 3RILA 2VFGA 3IIVA 2TRSA 2ZRWA 5D33A 5ABTA 2B7NA 3HGSA 1MXSA 1H60A 2C8NA 3DFPA 4MLJA 2CLKA 4H8UA 1I45A 1SW7A 3SECA 4E2BA 5E9AA 2AGKA 3K8KA 3S5ZA 1JCLA 1TJPA 2R91A 1SMDA 4O13A 4TMCA 3MP5A 1BF2A 3TCEA 1FBAA 5CSSA 4LRTA 1ICSA 1FCBA 1RVGA 1JXJA 4QITA 1CXKA 4HOZA 3N3MA 3P8IA 4GC4A 1JIBA 4WOZA 1BWKA 1J5TA 3GX9A 4UQAA 1GWJA 2V5LA 1X1OA 2B7QA 3MI6A 2WCSA 4FMVA 3NQCA 2QAPA 3W1UA 4HPHA 3PAJA 4QAIA 3G8EA 3W7NA 1KWGA 3ABSA 5HUOA 3B05A 4QSHA 3VX0A 1EEPA 1G4SA 3M5VA 4CQ9A 1OFEA 1PL9A 4LOCA
chains in the Genus database with same CATH superfamily
4O2FB 1KY6A 2W9DH 4IIQA 5IFHH 5B3JF 2G9HA 3P3BA 2ED9A 1MCKA 1BWWA 2RACA 3CZNA 1IKFH 1XTMA 4AWJC 1IL1B 3F84A 4JO2L 3K2MC 4EI5D 4UB0H 1A7OL 1PZUB 4WK9A 3V9EA 5KVFE 4U1IA 2JFEX 2EDKA 3NDOA 3GRWH 4Y96A 3DRTB 4NHUB 2ZUYA 1A9EA 3HC0B 4BWTA 1NA8A 4Y1AA 1DUYA 4Z76B 1WAUA 1GKPA 3RL1B 1IGTB 4P5RA 2XFXA 3B4NA 5DY3A 4HMCA 1GKOA 1P4LA 3GG8A 4XBPB 4H7ZA 1ZD6A 2QTEA 3AS2A 4HHHA 1JCYA 2XQYG 3WQOA 1YQVL 1A3QA 1EJ6A 4LV9A 4KKNA 3BZ4B 3GZOA 5T8IA 1M68A 3MWXA 3KG5A 3LKOB 1R86A 3MGAA 2P44B 3T04D 3VKDA 1S5VA 2J66A 1LF9A 3H3PH 4GOAA 4TQTA 1IC5H 4P7QA 2EIKB 3V0UA 3U0TA 5HI5C 5D6CA 4UIMB 2OK0H 1TU5A 4W9GC 3FFDA 2CETA 2JI2A 3AROA 3AG1B 2VRJA 1ISVA 1O6VA 1HF6A 5ENWA 3BWZA 4JCMA 4PBWD 5ABAA 2A3CA 1JYNA 5C0IB 1TO4A 4HZ7A 1CI5A 4ZOEA 4ES4A 2ZUQB 4YXKL 3OZPA 4GD0A 5ISZB 3NCBB 4YEEA 2GQ3A 3N4EA 3B34A 3BE1L 4JG9A 5E1IA 2DEXX 2P3EA 3O6MH 3OMAB 3GPEA 2R1MA 4NQDE 4YWGH 1ZGLA 1K72A 3AT0A 5FW6A 4S3DA 5FR3A 3SCRA 4ZMVA 4S0HA 2J1KA 5E4AA 1KXTA 1BLNB 1VZIA 4U1MB 2HLEB 2DTML 1WE5A 2WYZA 1IM9B 1YYLL 5EUKA 5F9AC 4ELMF 5REQA 2ZCKH 1MNUH 3TTYA 1RLWA 3S5LA 4AEFA 2ZX7A 5EOCH 1Z66A 3N19B 3W74A 4JM0A 3PZ9A 2B9BA 1TMQA 4KWWA 1TFHA 2BDNL 1ISWA 4JMNA 3TOYA 1MQ8A 3WYZA 1T4WA 2ZZ4A 4N8CH 1BVKB 3QH3B 3C8KA 4XNBA 2X6CA 2W0LA 5D8ZA 1KV8A 5AYZA 5EA0L 5D1XD 3VFMA 3NSJA 1A5MC 4Y7MA 5KANG 4GRSA 5CH9A 3GHEL 2YR1A 1YC8A 3KTXA 1W72B 3IGKA 3D25B 1A9BA 1JVNA 4LSQH 3UR2A 1TQSA 1YEKL 4AYMC 1DBTA 3GAYA 4TXVB 4JS7A 3UZVA 4JDYA 1XFCA 4RFEA 1QPRA 1RLBA 5A94A 3Q8CA 1MF2L 1SNRA 2WGQA 2YGNA 3S4SG 2X0SA 2J6VA 4K8RL 1NBVH 1LM8V 3FX4A 2PW2B 1IE4A 4WO4B 2ZUSA 4KROD 3NL6A 4JPGA 3EIFA 3OKDB 1RUSA 4WW1B 4YMPA 5IVXB 4F0RA 3LYRA 1SYVA 1XF0A 4HJTA 4MDRA 5KS9B 2V2XB 5JIDA 4X99B 4JO8A 3U7AA 4ESKA 1HT6A 4R7WA 4YTQA 1P7QA 3UP6A 4DPPA 1XQLA 3HU7A 1JZ6A 4BXVA 4YPJA 4JRYE 1E28B 2XWBB 4APQD 3QY7A 5E23A 3N50A 5JW4Q 4O1FA 1XQKA 2RH9A 1JUFB 2ZZ1A 3UTTA 4L18A 3BS6A 1XFBA 4Q0XL 3BK0A 5D5MA 1UA7A 3TJEH 1RK0B 4HIHA 4MHHG 3OJDB 3EYSH 4DCQB 5JIKA 4LY8A 2E75C 5F4WA 3EHBD 4W9KC 4R9HA 3FQ2A 4ICXA 1VCBC 5IHZB 2C34A 3HS0B 3DV6B 3A47A 2P10A 4UFCA 1FX6A 3DI1A 1LE5B 1GVOA 1R1CA 3BQUD 1A7PL 3LCFA 2CSPA 2QV4A 2WSPA 4GXUN 5F9WC 1CL7L 1V7WA 1QOKA 4TF4A 2X0HA 5HD8C 1L6GA 2R0ZL 4NAQA 5EO0B 1TKWA 4YK4B 1R3HB 1PIIA 4FNSA 5K9JL 4OLWL 5DUMH 4TVUA 4XWGL 2FBJH 3Q1NA 1G6RB 5KVGE 4G6KL 3MU3A 4IDLA 2FHBA 4L4LA 3Q5YA 5AALA 2BXVA 4U28A 4K3AA 2XZQL 2DS4A 1MHPH 1GS6X 2G0KA 1F9CA 5FEZA 3SDXF 3DVIA 5GRVK 1VPOH 4NKDA 5EF0A 5F7KC 1IJ9A 1RJLB 4RNFA 2XSGA 5I1HH 2Z35A 1F6AA 4MMHA 2CDEB 4MPQA 3JYCA 4FNUA 1JFHA 4Z7NE 1N6QL 4WEMB 1YADA 2DWYA 2QADC 2JIXB 1AE6L 2JB6A 3FVDA 5HQMA 2EADA 1NCAH 3FYPA 1EEXA 2FB4L 1V3KA 4GRLC 3ANUA 4L1WA 2XN9E 1QW7A 3TCLB 5FF3A 5DJZB 5IG7B 4LBEB 5F2FA 3OQ3B 1W32A 1UR8A 1XGQB 1X5FA 3BV4A 2H3BA 1YYCA 1TPDA 3UWVA 1DIEA 5HHME 3N91A 2QR6A 4FFYL 4Y5VC 1AD4A 4RAUB 1I8LC 1BZQK 5IUCA 1X5YA 3LOWA 4PJHF 4N87A 4RCXA 1KLUB 2XU9A 3DRTA 4NHUA 2BVDA 3VD4A 1TEGA 2IGFL 3HC0A 4WCJA 2DU2A 4Z76A 1YEEH 2MEJB 3GKAA 3VDGA 4NP4L 2ZP9A 3RL1A 2Z31D 2RGLA 3UYRH 1MVUB 1ZRUA 1SJAA 4UIKH 1EO7A 3LLFA 3SURA 2A5HA 4JREB 1LQ2A 4B60A 4W7UA 3E80A 4UZUA 3WQEA 5F1SA 3LKOA 4S1QH 3IJ7A 1EUAA 4TQIA 3K5SA 1E0UA 5I3KA 5DZOA 4R90L 2ID5A 2J21A 1A80A 2BSBA 1KTCA 4UIMA 1YRKA 1A6UH 1XPYA 4WJXA 2VAJA 1HZHL 5FDWB 2CH8A 1ML0A 5CZKA 2YQGA 7ODCA 3GHBH 2DN7A 3WH6A 4GUQA 3VIOA 3CAKA 1UM5L 5C0IA 4GYFA 3W00A 4XMUA 2K3HA 1L6WA 1WYJA 1XSOA 4WI0B 1W3JA 2NNCA 5ISZA 4OJDH 5D2LF 4FNVA 1MEXL 5FF6B 1XIHA 2C11A 3I3EA 2DWXA 3S3DB 1QEWA 2EDMA 2E9BA 1GYMA 1WKDA 3MFGB 5GS3A 1BLNA 4HKBB 3BGFB 4U1MA 3MLTA 3SDAD 2J6WA 5GRJL 4N20A 3R8BB 5A69A 4XCCL 2IGLA 1DJZA 1T1YA 5K9XA 1NARA 4HKJA 1W8NA 2YLLA 2WLMA 2XY1A 4WF7A 3TEZA 5AOLA 3PUCA 2YUVA 2EE9A 2MCPH 4N0FB 3QH3A 1JAEA 1JZ2A 4AM0Q 2W6RA 4Z5RB 2OVLA 3RFZA 4TUFA 1TZGH 2KMWA 1JP5A 8FABB 4P59H 3LLDA 3PY9A 3V7MA 3E49A 3AIRA 3NTYA 2CDFB 1WZ1L 1VFMA 3TWYA 3GK8L 3T6XA 2I5IA 2AV1B 1MCIA 1KYOK 4OZIF 4HU3A 4OVUA 3QWRD 3D0AA 1G43A 4HIXL 2WNNA 2E4TA 2JIEA 3CJJA 4C55A 1K8CA 5CIPA 2N0MA 5CR1A 1HZYA 3R43A 4FDWA 4DLMA 4DEUA 4X6DE 1W0VB 4QO1B 5ANME 4WO4A 2AMGA 4K3GA 3A64A 1MH5A 3FB8A 4LGXA 2ALAA 4WW1A 2XRAH 4P06A 1DQJB 4REQB 3IEAA 2YCJA 2V2XA 4X99A 5T5FH 2HNHA 5HATA 5T1JA 1ZP3A 5C0DA 2NZ1A 1DSYA 2NQ9A 4BINA 3ZN6A 4D3CL 2JSFA 4W86A 5IBTL 3LHYA 4AYGA 3ZXAC 1UJTA 2X44D 4DK3A 1JUFA 3HRZB 3FRPA 1J12A 4C47A 4AD0A 3WLHA 3ZQWA 1FIEA 4AYBA 3HR6A 1RK0A 1ZA6A 2YXVA 3KPSE 4D0BB 1HS6A 3MGOB 4C4KO 3HLAA 4FG6D 1XLKA 4Y8AA 1DLFH 1VD6A 3VTRA 2W60B 3KVPA 3OJDA 2VMJA 4DN4L 5TDOA 4AHQA 4HYWA 3NPZB 2PO6D 1QLEB 5K9CA 5C0GB 1EPVA 2DMHA 1CGWA 5T1LD 3ATZA 3STFA 3DV6A 4PTWA 1YC7A 1LXKA 3VC6A 3KXFA 2OQYA 4WX2A 3VNYA 3WJJC 4AB4A 4QOKA 4QRFA 1VKFA 2P3YA 1Z89A 4L61A 4IBQA 3W1AA 4XMTA 1DQLL 3LBOA 2VWTA 3TWCH 4EAYA 1AXTH 2KDGA 1AD0A 1SJCA 2BFGA 2HT4C 2VFHA 5GQBA 2MPAL 5EO0A 2DQCH 1EP1A 4O0QA 2Y9RT 1LOSA 5L4JA 3S98A 1F1SA 1YDYA 4BZYA 2QUUA 4XVOA 2NXIA 1RZGB 2WKJA 4M4PA 5L2KE 1JK8A 2RDTA 3I6LD 3H54A 1E1CB 3CMJA 1RZFL 2X4SA 3G1RA 1AZ1A 1AQMA 1AANA 3SE3C 2AQRA 1BQ5A 2Q6ZA 5C08B 3FU5A 4IKNA 5BS0E 4NOBA 2CDEA 1J8SA 5FCZA 1XDMA 3WZ0E 4UNLA 4N2CA 4LNVA 4B3KA 4DWSA 2M1KA 4ROPA 4BEIA 2HWZH 4K7FB 2BWDA 3PPGA 3KPMB 4JYDA 4RH4A 3GDKA 1K1WA 1TQUA 3NABH 1Y5WA 4M7KH 5AAMC 4EX4A 3TNNB 3LEPA 4OOUA 1XIJA 2MHAB 5DJZA 3CT7A 4N2DA 5IG7A 4LBEA 3S3CB 5KSVB 3NZ8B 1IKNA 4CNUA 4PMJA 5EBAA 3BVWA 4KH2A 4LYKA 3W0WE 4ABWA 1ITQA 2QCGA 4GSDL 1HJUA 2FB2A 3P4NB 4LVEA 3S8GB 1A5LC 1WYIA 3CHXA 3D5OF 4XP5L 3QCTL 2ZQ0A 3QJHB 1UUMA 3ABQA 1BMGA 4UQDA 1KLUA 3SE6A 4C6MA 5L6YL 4O02B 1XX1A 3SUUA 5LIKX 1PAMA 3HB9A 4Z7VE 1XIDA 1MVUA 1XLAA 5DMLA 3HMXH 2Q10A 3H42L 4CMHC 3QJAA 5FWRA 5EG6C 2VDMH 1US0A 5BROA 5A16B 5FJOA 4DQAA 3MRIA 3ARPA 4KERA 3PL6B 3ILPA 1BGAA 1UKTA 3ETBJ 4D7BA 1E2ZA 1J93A 1F97A 2K70A 3C5ZA 2BFVH 4FXRA 3QUMA 5FDWA 4LCSA 3EO9H 4KKRA 3QPQC 1SW0A 4FQLH 4W6YB 4JG0L 3DX8B 2IQDA 3OBEA 3SDDC 3OBKA 3M7SA 4ERSH 1FORL 3ZKMD 1BVLB 4WI0A 1KM1A 3WA3A 4UMSA 1WTGT 3VNKA 3BW4A 1DBML 2CU0A 5FF6A 4OFKA 1NDYA 2B8OT 4QHPA 1U36A 1KCZA 3VXRD 1VR6A 2NUWA 1IZJA 2J8UF 4BJLA 1MFAL 1MCOH 4L0YA 4KVPA 2IAND 2DWEB 1XF3B 3WO4B 2KAUC 1IAIL 4PJ7E 1W1A1 5HR6A 1R3IH 1DXIA 1RZ7H 1U22A 4PMOA 3EZJB 4IIBA 4LS0A 2APWA 3NZQA 2V5TA 2DWTA 4Y9BA 4EE2A 4JKMA 1KBJA 1QMLA 2GT9B 1EBGA 3TJIA 3BUTA 4AISA 5LQBH 4XODA 1GT8A 2GABA 3B8UA 2OQHA 4QBXA 5DTFB 3N18A 4AX3A 3ZVHB 4FQHB 1OFOA 1C5BL 3D12B 3A21A 1KR0A 4ONFL 1IWPA 1FVCB 1DOSA 1YBQA 2BVOB 4Z3JA 1H62A 5IMOB 1OT1A 2FJHB 4NUPA 4E0RA 3UCCA 4AZ7A 4OZFG 4YSDA 1NKRA 4XE0A 1RUQL 3JYBA 3EF4A 4XE5B 5DWUH 4QO1A 2OX5A 4ALAL 4RGND 3VXMD 5E6UB 3UO1H 3A3HA 3V95A 4WFFE 2X9WA 3NBJA 3TX4A 2PS2A 5JU6A 1LUCB 1HAUA 1QKZL 5EORL 2ZWKA 4YTRA 2H9AB 1DQJA 5T8GA 1WZMA 1E56A 1UZGA 3EH1A 4PMFA 1MQKL 2F7FA 4KQ4L 4Z7QB 1EWEA 3D8MA 1QPNA 4Z17A 4JN1H 3TVMD 1OACA 2ISFA 1NMAH 1OTUD 1MCWM 1TPUA 5TF0A 2YLHA 1R3KA 4OCXH 1XVSA 5B1KA 1I1FB 3HRZA 4CNTA 5GISL 3T8VA 4Y1TA 3U4EB 3TR9A 5L2JB 2BG5A 3KP1A 1TZOA 2WCOA 4HHGA 3W2JA 2Z2BA 4HAKA 3URBA 2H1XA 4M02A 3LHTA 5J3HC 4Y8DC 2WXKA 2YUWA 1B0GA 4NEIA 3E3QC 1X6UA 2W60A 5JW4N 4CNNA 4GP5B 1KCRH 1X5KA 2G2PA 4B9GA 3K4WA 3HPZA 3THDA 1GYAA 4OLZL 5I1GL 3MROA 3VZZA 5L9DH 2NR6D 3B2PA 1NGQL 3WY2A 1VPQA 2V9QA 3MC0A 3QDGD 2MKLC 4V1YA 1AS7A 3T3PE 3ANYA 4HMNA 3CL8A 4E5XG 4OWGA 3LNDA 5FM8A 3KWXA 5K9OB 5FL1A 2OODA 4GQQA 4AGLA 1MIMH 4CNSA 4W4QA 3HKFA 2NY2B 3CHDA 2VUNA 3MP3A 1WT5C 1TWSA 4X4XB 4YZFF 3VMPA 3W38A 4WEBL 2F84A 3MBDA 3Q9QA 3ARXA 2BCMA 1DBJH 1UH3A 3WN5A 3QYCA 4F79A 1MDAA 3CHCA 5AOUA 4A6GA 3CGTA 2ACRA 5I19L 2OEJA 1A1MB 5C08A 1PZ0A 3BWSA 1TJGH 4C58B 2O30A 3MLWH 2WOFA 4MMXC 3TO4A 1EWHA 2VEFA 4QROA 5HYEA 1HU8A 2ZAGA 3NIDE 4K7FA 2WO0A 3KPMA 1QSVA 3BDBA 3C8HA 4NQVA 5E4EB 3U0WH 3TNNA 5GRVL 2YRBA 1KEGH 2MHAA 2GJ6B 2MQ3A 3MV9E 5KSVA 4W93A 3NZ8A 4PCTA 3K6FA 3GINA 1MIEL 3CUHA 3UZXA 4NWUH 2NY6D 1B4JH 2AMXA 3KRUA 5DT5A 4ZQPA 2QSCH 3MREB 2Y1AA 3ORJA 4MSWB 1HZLA 3KLDA 3HV9A 3FU8A 3SCWA 4ZSTA 3C09B 4UILH 2Z7UA 1W17A 5AVUB 5DZPA 3W2MA 2ZWLT 4H5SB 5CLXA 1JK9B 1V51A 1Z3GH 5HGBB 3RILA 3O11B 2TRSA 3CDZB 4PJ5E 1QSEB 3OP2A 2R91A 1SMDA 1UI8A 5AB9A 2X6AA 5D7JD 1OTTD 3P0YL 3ZJ7A 4WOZA 1YY9D 1JZ3A 3PAJA 2RH0A 3TPUA 4ICWA 5SV3A 5A16A 4CQ9A 4MQSB 3O8XD 4MZIA 1IBGL 1W16A 2PF6A 3PL6A 3ZZSA 5LKYA 1NAMB 1BQLH 3U25A 5IXEA 4EE9A 2OEKA 1Z41A 4XBSA 1FBIL 2XZCL 4LS1A 3Q2LA 2W63A 1SO0A 3K1GA 2C1OA 2AC0A 5E99H 5AB0A 3L5LA 5DD3L 4XD6A 3WE6B 1LO3L 5INDA 4LQ1A 3OKOB 4K8EA 2AABL 3BT2L 1OGTB 4DP8X 3IS4A 3W83A 1JD7A 3H2EA 2LVEA 1KACB 4XN9A 4K23H 4ZBJA 1BXXA 3RZCD 1DFBH 3A3XA 3VI4E 1YNYA 5F8RC 1VFOA 1TJHH 1XF3A 2SEBB 1VSCA 1PVHA 4ETYA 1OP9A 4LSPH 4NHCL 5FYJH 2QJJA 2RQEA 1KJ2L 5J89A 3NAAH 3QPEA 3TONA 2P24B 1KPVA 4YDLC 3CVIL 1DUZB 1T5KA 3P9LB 4D6DA 4WWKD 5T5NG 4MAVA 1KGUA 3SXXA 5CZRA 4JFUA 2GT9A 4LDEB 1HXMA 5FJJA 1KXVC 2ZAIA 3GS7A 4BFIA 5DTFA 1G94A 3HM7A 2VMEA 5GVJA 1B3IA 4X5WB 2V5YA 1I9RL 3RVVC 4JQVC 1I8AA 2JB5H 3QFJE 4XVJH 8XIMA 3CFKB 3OGVA 1R9YA 3NQAA 2G3XA 2BVOA 3EKCA 5F2LA 4HKPA 3EADA 3DYOA 2F61A 1A8JH 3MSDA 3AWOA 4PLJC 2X40A 3VFCA 4ODVH 4JTUA 4NT0A 4K0OA 4MJIB 4K94C 1NCGA 4YDVB 1BM7A 3CN4A 1LUCA 3O2WH 4CC0A 1MPAH 3WLKX 3BJLA 1DHKA 1MSSA 4G5DA 2KT6A 4ZX5A 3LSCA 4Q8UA 4F7CB 3SGEH 3WMPA 1XUZA 2VDNH 4GUFA 5TE7L 1EJOL 5FGBA 5FO8B 2AAAA 4LHUB 3N9KA 4A3RA 3RMEA 5TE6H 2JI1A 1I2NA 2PSNA 1R3JB 1PKYA 3LU2A 1XLLA 4DM1A 1I1FA 3GSRB 2IFFH 5L2JA 4GO8A 2F19L 2XQ0A 4HJ1A 4NN7B 3S2LA 1TMCB 1JZ7A 4OCYL 5DK2B 5ADOH 1OAYH 4UBDD 3CUPB 2Q2EB 4H25B 2J6EL 1IGFH 2CLRA 3LHVA 4QAWA 1D5RA 5LBSA 3K80A 3LNIA 4WGHA 1LP9A 5K59E 4O16A 1JGDB 4D94A 1FE8L 1AVAA 2YK1H 1MRCH 3VINA 4WTZA 4WZHA 2F53A 1ZWIB 2CRMA 1V0NA 1JGVL 2OXHB 5G5DB 2Y1YA 1HCVA 5AW4B 5K9OA 1PJ9A 4KUCD 1AQFA 2BVPB 3BWUF 1R8LA 1V3MA 2YGQA 2WQPA 5LNUA 3O45B 3SGKC 4XXCA 2Q01A 2ADFH 2A3LA 3GM8A 3KDNA 1SHXA 2XT1B 2LU3A 4X4XA 3NL2A 3MA9H 4RMQA 1QFEA 2E7DA 4ELKA 3K4ZA 3MRHB 3SCNA 2FEDD 3QDJE 4A04A 3IDMA 1HM3A 1OSZA 4PEEA 3A4DA 3DURB 2OT1A 1A1MA 3KAAA 3QWOB 1SZFA 5F6HJ 3VAEA 2P5ED 5IJCC 4R2GC 1RP9A 2Q3XA 3O9NA 2WNQA 3LMJH 2PPEA 5CAKA 3ESVF 4MQTB 4YDMA 3PUGA 4X6EB 4GVFA 1MLCA 2WJFA 3CLMA 4OIBA 3TQVA 2APTA 3B8YA 4FQ1H 1TG8A 4MMIA 6FABL 4XPTL 1FHLA 1N7KA 4V15A 1H7RA 4MAZA 5EU6D 3PM6A 4MY9A 1L7KA 3N3EA 5DO8A 4UM9B 1W1PA 4DUOA 1E51A 3B3BA 2ARJA 1LO5A 4F2MB 3AU2A 2DT0A 2ESVD 5IW1B 3UQNA 3MREA 3KLHD 3C2EA 4H44C 3FEQA 1BYNA 1TUPA 2XI9A 4X42A 5E5CA 2ZD0A 3TXAA 4CKVX 2A3BA 1FTXA 5F93C 3U6RB 3C0LA 4H5SA 4MJ2A 2Z4QA 1A65A 5DQ9B 1FHVA 1MG2C 5F97E 4D9RE 4M6NL 3RGTA 3Q94A 3T07A 5HGBA 1X5ZA 2IG2L 2YCEA 3CDZA 1QSEA 1X4YA 3EOTL 1ZBKA 2X41A 1KFAH 4B5UA 2ORBL 1E43A 4NZ1A 2C26A 3ONCA 2X1OA 4KTPA 4NQTA 4LC8A 3KEHA 4PY7B 5DS8A 5F7NC 2GITA 4QPEA 4WO0A 1OF0A 3MRQB 3J27A 4Z95H 3QHOA 1JWMB 5ABZA 5DS2A 4H2CA 1X7IA 1NAMA 2NXGA 3I75B 3APDA 4HQQL 4GBUA 1JXDA 5M17A 3PP3H 4NC0B 4YLWA 3RVWC 5FM5O 1I3VA 4JUTA 3TBVB 3ABMB 4P5MB 2V0AA 43CAB 1TXKA 3AICA 4TUUA 4IIQB 1O0VA 1G9NC 2G9HB 2YD5A 3GK0A 2QHRH 1OGTA 5I1IL 3Q1SL 5T33L 3SI9A 4ZPVB 1TJ1A 2ATAA 1UPPA 4WTXA 4U3SB 1WAAE 2ZKYA 3CN3A 4KXDA 1N8FA 4YHZH 4U1IB 3EGXB 4LLYA 4OR1A 5JQ6L 3MT1A 4DFHA 1W9XA 1A9EB 4ERIA 1DUYB 1Z9SA 4LS2A 3GRBA 5ECJE 2SEBA 1FCVA 5D9MA 2XFXB 3HE6B 4BZ2H 3T0EC 1SN0A 3IRPX 4XK2A 1XT5A 1FHDA 3V4PL 4GUPA 5IREA 1KB3A 3P9LA 2IOOA 4PMDA 2PDMA 4XC3L 3B8SA 5D1ZC 2VXQA 2CHOA 3CZJA 2C18A 3IWPA 5GRZA 1UFUA 3T2QA 3U0TB 1A4AA 5D6CB 5BV7H 2XX1A 2CG1A 3S4TA 1E27A 1J1XH 4UTHA 2ETWA 1THCA 4WGWB 3NWRA 1NM4A 2OZ4H 1F3RB 3FFCE 1KB5B 3CFKA 1T03H 2EG7A 1MJUL 4XHJD 1B0IA 4X2RA 4AKQA 3VXUE 2BZCA 2G96A 3QYSA 2DAVA 3FLUA 1KV5A 3U2JA 3E0VA 1RURH 4DJFA 4HS8H 3MN8A 1OK6A 3GBEA 3PWAA 4LCCB 4GIOA 1DQUA 4BS0A 1UUOA 4MJIA 1MCRA 1U3NA 3AQUA 4JQAA 4YDVA 4G6ML 1ZGLB 4I8YA 2CLHA 1PLCA 2AK1H 3WS6C 3G5XA 1ME7A 1ZCRA 4F0SA 1L9WA 4HMEA 1QWGA 3FQ1A 2WHLA 4F7CA 4W5UA 5I76A 5EUKB 5G1MA 5DVLA 2BXYA 1E9IA 5REQB 5EGRA 5L9FA 2GUYA 4H8WC 5C9WA 5CC7A 1PXGA 3MKGA 1KO0A 3GSRA 2IEPA 2VLKA 5C3TA 4KY2A 4AGPA 2PR4H 3N85H 4YBQD 3C8KB 3ZGHA 3P0VH 1U91A 3WIQA 4KHTL 1W2KT 3MLRH 1I75A 3AY2A 1R6WA 2WNZA 3VFMB 1AZCA 5HVWA 3WIHA 3TJHC 4H25A 1XH3B 3GLEA 5IQ7L 1EHLH 2AJYL 2G8ZA 4XMPL 3NEOA 4G7VL 3N17A 1GHRA 1A9BB 4AE1A 2AP2A 2GB2A 4F9PC 1JGDA 4OFDA 3C5JB 1N7NA 4O58L 3BO8B 4J3OF 4YQXH 1ZWIA 4XP9H 2A85A 3GIVB 5G5DA 5I0XA 2O61A 3UZJA 3TW6A 2BVPA 4GAGH 4P5TD 3T55A 3UPBA 2NYYD 4P2OD 1ZV2A 3O45A 3E0WA 1CE6A 5ICXA 4KFDA 5FA4A 2W62A 3NK3A 3WF4A 5DVOA 3JV6A 2YAQA 5A1AA 1JPSL 4PUMA 1P7QB 3HB3C 3O7UA 3ESOA 2RCSL 2OYPA 5BZXA 3QK0A 1OGPA 3ZE2E 1LWJA 3L2LA 3V4VL 3BW2A 3DURA 3MHFA 3WIFA 4KQ0A 3V6ZB 3WLWC 3UTTB 3ANVA 4OB5L 2XWRA 5I79A 4OLYL 3LHAA 3ESUF 5D5MB 3EJZC 4Y4FA 3APMA 3OPSA 5LA1A 3D39B 3B1UA 1A5FH 2FECL 4I4WB 1FNGA 3GNRA 3JU2A 3BC9A 1SO5A 5CJBA 1YEFH 2DBLL 2NW2A 1I85C 5I15H 4GUIA 4MQXD 4HIPA 2NNAA 4NHVA 3NP3A 4L9LC 2EXYC 5C0CB 5DFTA 4PJEA 2LTQC 5D96B 3IDXH 3LKQA 5F3BB 5EZLA 4M7SA 5TBOA 3NDYE 3NSCA 4HEME 3HVDA 4DAGH 3FY1A 3R1GL 4NUWA 4BY3A 1SQMA 5DQ9A 1YLBB 2ZUXA 1TKWB 3WELA 3UG4A 3QYNA 4WVRA 4G6AD 1C12A 3QXBA 3TE9A 3CXDH 2NQHA 2I5QA 4IIGA 4P2QD 3VXQB 4HK6A 4LOFA 2Y2YA 5DELA 4MWAB 3X12A 4GJJA 3NRFA 3KPSD 1IX2A 1OE2A 3MBEC 3HC2A 1CYXA 4PJCA 5JIHA 2F54E 5EOQL 2R29L 3VSTA 5JHLH 3UJTL 1OCZB 3MRQA 5CPSA 3BMVA 3KPOB 1OX6A 1SN5A 3LS5H 1HNYA 1J1OH 5KVFL 3QH2A 1CGXA 3BKCH 1YKWA 3I75A 2ZZ6A 2WIMA 2JB6B 1RWCA 5EF2A 3TIMA 1TUFA 5LIUX 4KKPA 4O4YH 2ZP0T 2ZKWA 3WNJA 1FLTX 3TBVA 5FXCH 3LCGA 2GC4C 2P49B 2KC0A 4P5MA 4GXVH 43CAA 2EE2A 2P26A 2YLKA 5D2YA 3QN3A 1NCCH 3E3HA 4XZNX 1XRTA 2C9VA 3CU1A 2R1XA 3GH5A 1H0DA 4DO7A 4ZAKC 4EZKA 7PTDA 4ZPVA 4K5NA 5DHXB 4M6UA 2VDGA 2XV0A 1R2RA 2G60H 2WGXA 4U3SA 1X5MA 1BZEA 3GIPA 4EOWL 3EGXA 4LPUA 4WUUB 5L2KD 5AVZB 2JTYA 1UUNA 4H83A 5I5IA 4DAFA 1OSPH 4JQXC 4GXFA 4WKZB 2R1YA 3NBNA 2WXRA 5B1JA 3SFKA 2EKJA 4A3HA 1F00I 3BKML 4ZMWA 1CD0A 3HE6A 1LOLA 4I9JA 3L9CA 4XAZA 2AGJL 4J4PA 3GO1L 1LG2A 4S3JA 3V6OA 2ITFA 3BHBA 2NXYB 2DKMA 3KGTA 1PDZA 4AZGA 5FYJE 1SOQA 3N1MC 2H1PH 3LI0A 2R82A 1U5VA 4XH2B 1T66D 2JF7A 3AHZA 4M6ML 1U8IB 3PGDA 4RV8A 1LYXA 1BSLA 5HMSA 1AW1A 1BRLA 1NUNB 3OHXC 3W0WD 1GOIA 3LQAL 3I9AA 1P53A 5ID0A 3DIFB 1CLCA 3FH8A 2QJMA 3TCTA 2OMYA 5JHBA 1KB5A 3WH5A 1C8VA 1ZCCA 2ZX6A 4UV7H 5T1MB 5KTLA 4UWMA 4N9BA 4JL1A 3PHSA 4C60A 3A4WA 2J55A 3SE8L 2LU4A 4TPRH 4NZUL 1AXIB 4Q9RH 3TV3L 4LCCA 1V3JA 1QEWB 2HEJA 1TWIA 4J2MA 4CN6A 4FALA 4XBEH 3HQ1A 4O15A 4L4VB 3RCMA 5F6HI 2G3NA 1U6AL 5I0VA 3MLTB 2CHDA 1HX0A 4V11A 5GSVB 3L1FA 1T1YB 1UFGA 2AEQL 2QKIA 3ARFA 1IFHH 2QUNA 3NAVA 1XH0A 3GS4A 3NIGF 4HKJB 1T7WA 5BXTA 5CGBA 4LRSA 4LPYA 1Y0EA 4RFOL 3TXZA 4XVUC 5EBGA 4ZTPL 3DETC 1T7YA 5DFVC 2K1MA 3L1EA 5B8CC 2XIBA 4QNWA 2YSTA 3L9YA 3TZNA 3VZXA 1RJQA 3RFZB 5L8KB 3SB3A 1TPC1 3GSNL 3DVNB 2E27L 3I6TA 1KJ3H 1XH3A 3TYCA 1GTEA 1BM3H 1JDAA 1MUMA 3H2FA 5EHFA 4OFCA 3TVAA 2CLVB 1ZAIA 3NA9H 3C5JA 4F37F 3BO8A 1U30A 1OX4A 3DZ1A 3GIVA 5CIPB 3CXFA 1ZGLP 3U5YA 1IGSA 2JALA 2CUIA 4C83A 1HKVA 1MH5B 4YSCA 3FB8B 4YLCA 5C92A 1NJJA 2VDQB 4FTDA 4L80A 2WHKA 4XMKH 1AR1D 3RXZA 1M3JA 3ECQA 3QV9A 2YGOA 1W2VA 1ADQL 5C0DB 1HOEA 1UENA 1P4BH 1F05A 4O8AA 3ID7A 1UA3A 3LS4L 2PZ0A 3CV6A 2OTUA 3FRPB 3OW1A 3V6ZA 3TW7A 4RZ4A 4UTIA 1R5WB 3FKUS 3WY3A 4A21A 2WLYA 1ZA6B 2HPIA 4H0LC 3N41B 2FX8L 3HLAB 2V9TA 1OAQH 3OODA 1XYFA 1W54A 3D39A 5TDOB 4I4WA 1J9YA 5DY2A 4FXGC 1SR0A 4GG6E 2RTTA 4HULB 3D50A 1HIMH 5M7QA 5TFSH 3O9WB 1VGEH 2ZRYA 3KXFB 4X4ME 1CGYA 1OLZA 1NJ9B 2VCBA 2AJVH 4E9VA 4QOKB 5C0CA 4B97A 3WUEA 2CQSA 2FFIA 4NFBA 1MFBH 5F3BA 3HBLA 3GQFA 4QDGA 1DTNA 1QALA 3MLUH 1AD0B 1YJDC 4Y9NA 2YDRA 3EOUA 3AREC 2OOGA 4LB4A 1IIIA 4EIVA 2YDQA 3OLIA 3INUL 4UTTC 4MAUH 5BZWB 1RZKC 1SEQL 4QRPA 3B9AA 3LN4A 4IBVA 3VXQA 4OV5A 5G1YA 2F5BL 1JK8B 1FG9C 1TCRB 4MWAA 1JRHL 3M1BA 5DDHB 2X4SB 5CD5D 2V3DA 1O4UA 2UV3A 3KUMA 2YC1B 3DIDA 4KKAD 2X30A 4TLUA 4MA8L 3KPOA 5I0YA 1BFOB 1PLGL 1ECZA 5DLLA 2CLFA 5IUSA 4ILDA 2ADGB 2QHLA 4DWSB 3FC8A 3VE0A 3CQPA 1B4KA 3GSUB 4YE0A 4WI7A 3KP0A 3P3TA 4L4OA 1PFOA 3FYYA 5TDNB 2EDHA 2VFGA 3NSDA 2B7NA 1MXSA 2BVYA 2FMNA 1WKYA 1PQZA 2DYPA 3WKYA 1HDMA 5HDQL 3H9SE 4C5ZA 1CXKA 3ME3A 4ZO9A 4GC4A 4UB9A 1JIBA 4WW2C 4FNLH 1PL9A 4LOCA 1L0PA 4J27A 2NV9A 2GBTA 1I53A 3NYKA 4ISVA 4RWYH 1IFGA 4WUUA 3BSZH 4JW3A 4JEGB 3STBA 2W9EH 3QARA 5AW8B 3MRFA 5F7EL 4IZGA 4KNQA 3ZR6A 3WLPA 4WKZA 1D2OA 1AS6A 1MDRA 1EA9C 1QNQA 2ABAA 1TQCC 2ONEA 1OCCB 3DPDA 3GSQA 4GINA 3JW7A 4LALA 4R5EA 2BODX 2IOIA 1G84A 5AVRB 1S7TB 3MCLL 4JXCA 4JGNA 1URLA 3MRIB 3EFDL 5CBEB 1FYTB 1W37A 3ILPB 3VYPA 1VADA 2POTA 3WFZA 5FO7A 4XH2A 3UACA 3C5ZB 1U8IA 3QUMB 4Z8FL 4C4BA 2CLZB 2BP5M 3DIFA 3IGSA 1KKRA 5T1MA 4IIDA 3QNFA 2YD8A 2F38A 3TESA 1BYCA 5GGTA 1ZJIA 4X7CC 3RI5F 4PP1D 2B20A 5EZIL 4IQHA 3NEXA 1DYZA 1N8OE 1E1FA 1CXFA 3K5XA 3V4UH 3O3RA 1CW2A 1O5XA 4JFDD 4DUVA 1N26A 4U1KB 4L4VA 3GHSA 2EINB 1TITA 4FTVE 5C07E 2GSHA 3LYEA 4JQ3A 1AJ0A 2WAHA 4MQ7B 2O9RA 3CVHB 1E8ZA 5GSVA 3R25A 3OR7B 2YX0A 4O1EA 4M43L 2C1GA 4F4RA 3I6RA 3NRQA 4XNUL 3C86A 5EO1B 2A9NH 2WJDA 1OY3B 1XINA 4CQBA 3FO2A 2XH2A 2JELH 5L88H 1AZZC 5IROC 1QNZH 4LUTB 4AEEA 1R87A 2IQ0A 4EN3C 3GY1A 4NSKB 3ARDD 4JFWA 5F9DC 1AZRA 1D7FA 4PB0H 3CE1A 3IGLA 1E6XM 3FT1A 1M42A 5AY7A 3DO3A 4RNHA 3M0MA 3DVNA 2NXZD 4KRPD 2VDRB 4FYQA 4J1UA 4YYCA 4DYJA 4QE5A 5DA4A 5D7LE 4GMEA 2WYHA 2IAMA 5C09B 3WNMA 2CLVA 3NVDA 1ZPTA 1QSFD 4HC1H 3EKZA 1YBQB 1GKRA 2XQYK 1N55A 4E0RB 4PBVC 5LGKA 2PDCA 3DX1A 4DHGA 3SDYH 1F8TL 5M3WA 2QGEA 2RR3A 2OX5B 1MFDL 1L7TL 1WTLA 2X53A 2A0LC 3HG3A 2WDAA 5BOPA 4OU3A 5ACMA 4HYTB 4OJYA 3FHQA 3IF1B 4U7SA 3P4OA 3OF6A 4L4TE 5AC4A 5D70H 2G4EA 4HFWA 4LSSL 2VM8A 1R3KB 2ZCHL 2E40A 3L7RA 1DXEA 1R5WA 5AENA 4OJEH 4DZIA 4AAJA 3OJVC 2O5YL 2WYTA 2FATH 1AIFA 1FNHA 3H2PA 2ADYA 4NNPL 1YMMA 1QYGL 1P6CA 1B0GB 1LQSR 3ES8A 3O2DL 2R8SH 1EZLA 3K6DA 1X97A 1QNOA 1X1IA 1NY1A 4OY9A 2WZEA 1R3TA 3BOLA 3WJLA 3ZTDC 3B0YA 2RBLA 1TELA 2EDLA 3MROB 3I02A 3O9WA 3SOTA 1YEHH 1NJ9A 3GZPA 1SXNA 4LRNH 4FR6A 4YVVA 2WIIA 2BMKA 3KYNA 3IIXA 3QF0A 3I3BA 5D38A 1V0KA 2ALRA 4S0SD 3ATAA 3ESMA 3TN0C 3EX4A 4PREA 3FQUB 3GVVA 4GY0A 3V0IA 2GW5A 4LASH 1FDLH 5BZWA 3E6EA 3FBKA 1L7IH 3WN5B 1TCRA 1N7MH 4GIPD 2VABA 5DDHA 3G6JA 2CLMA 4Z7WF 1MQRA 2KBGA 2YC1A 1OPGH 1T7XA 4ZW3A 3U6XA 2WBWB 1BFOA 2WP3O 1P0NA 1SZRA 2ADGA 3TO4B 2W9DL 3TC6A 1CLXA 4R96A 5IFHL 4IX0A 3AMKA 1HMUA 4R5TA 1IKFL 3GSUA 7A3HA 3QZNA 3B7RL 3GSVA 3KOWA 5GGRB 3GI9H 3R58A 4XPAL 4UB0L 3DHUA 1VB9A 5TDNA 4NQVB 4IMLB 3TBYB 1GGTA 5J5EA 4PI0A 2B1HH 4IX2A 4CQ8A 5TDPA 2BCKB 5IEHB 1BAFL 1OVZA 1MHCA 5IGXH 3U8GA 3CCHA 5AZ2H 4JBSA 2X12A 2UXFA 2AJSH 3N43F 5HHNB 1VGKB 1KCVH 2GIMA 3QDJD 3NEHA 2WWKT 4ECLA 3ZMRA 3WQFA 5KBNC 3H3PL 4G1NA 5GSRB 1IC5L 1HTIA 2CLEA 4RMVA 4PIBA 5CCGE 4MZ1A 5IHWA 2E77A 1NS0A 5FOJA 4TQEL 1XWYA 5MENE 5IJVA 1GPWA 3WJYA 1OZUA 2OZ0A 4YHYC 3TPUB 1BXNA 2BX7A 3TNMA 3ZDZE 3PSWA 4FQIH 1S7TA 2E4FA 5CBEA 1WAPA 1FYTA 4KJQD 4IGSA 1UD6A 2OWCA 3N2JA 5KYXA 1V93A 4YFLF 4C7GA 4AZ8B 5E08H 2Y6ZA 5JTWA 2IMMA 3WEMA 3MDJA 4Y8FA 2CLZA 4APQB 4LBAA 4LVNC 3O6ML 1UR1A 2C1OB 2W1NA 4YWGL 4ANXA 2ZUVA 5CJXC 2Q87A 4OQTL 1SXAA 4OK2A 2G95A 2GUOB 2IF7A 5INDB 4FMFA 2UY2A 3TA3D 4D9RD 1QD0A 5KJ4A 1TJIL 3MRDB 1IQWH 2D22A 1D6YA 2DY2A 1XIIA 4DWHA 4MYWB 2ZCKL 3F2LA 1JYWA 4DNHA 4OT7A 5EOCL 3B8WA 5K9KA 1NOFA 1RMFH 1JPFA 4U1KA 5PAZA 3FH5A 4N1HB 3X11A 3P7YA 3MRJA 2X1RA 4R3UA 4O2EB 1DBKL 5H37H 3WBWA 4MQ7A 4TNEA 3S88H 3CVHA 1CLVA 3RUGB 3L7EA 2VCAA 4PJ8C 2CM6A 3OR7A 3Q4DA 3D2UD 5EO1A 2VDKL 4WIWA 1W5NA 4WKHA 1QRQA 1WWAX 1CD8A 1LO0L 5J13B 1KPVB 3LH8A 1BF8A 3K0WA 4IOFD 2AVFA 3QZ6A 4LUTA 3RLHA 4LSQL 1EANA 4NSKA 4TUKH 1HXMB 1NUGA 2I5YH 3KZ8A 2A6DA 2BVTA 1KYAA 1BYOA 1UCBH 2ENPA 4PW3A 4BFIB 1RUAH 1W9BM 1NBVL 3KPTA 2A4CA 2BHFA 2UVFA 1GS8A 1K1XA 2XHNA 1OTSD 3VXTB 2E6AA 3O2VH 4IL2A 4FQ2L 5C09A 1I7UA 1TV7A 3GDRA 3P2VA 3QRBA 3QRHA 1OQFA 3GDMA 2ED7A 3U2ZA 4Z2HA 3R79A 2HUHA 3NZRA 5HOSA 4UTKA 3MLSH 1RV6X 3BG5A 4YLQT 1QI3A 1WITA 3C08L 3KHJA 2FYMA 2QVIA 5HPMA 4Q4QA 1M7DB 4FN0A 4GSUA 5SWZE 3PV7A 4I2XE 2C3WA 2VC6A 2YGYA 4CILA 3LXAA 3QZAA 3WD2A 2XXMB 1W1YA 4IXXA 1V79A 3TJEL 1U1JA 4U1GC 4FQXC 2BVQA 1NCWH 4TTDC 3IF1A 4L3ED 4PJIF 5GS1C 1HYSD 2RJHA 4FZIA 4FXJA 1FWSA 4WI2A 2HLFC 4MKTA 3BTNA 2OYKA 3M4HA 4D8AA 4FA7B 1Q9LB 3ZKNC 4M8VA 4K73A 5HBBA 4NJIA 2PUQT 2P46B 3FFCD 1N12A 1DVXA 3U7BA 2JVUA 1Z5HA 3WLMA 1BX2A 5K3VA 2ZOWA 1GC1H 3AMCA 3QFWA 2CLRB 4GKLA 4E0CA 1ET5A 3RVUC 3DSNA 4PMRA 5GJMA 1WGOA 1LP9B 3FW6A 1OARH 5CP7B 3MMTA 5DUML 4TO8A 2FBJL 1SJEA 2FEJA 1UA6L 1VGAA 3JR2A 4AU0A 2F53B 5HYSB 3CK5A 2GUUA 4DO5A 2VE6B 5LXGH 4HTBA 5ECGA 4V1DE 4XSMA 2OOVA 1H41A 1OHZA 1YEJL 2GYSA 5FX3A 3NFSL 3FQUA 1O94A 4YR6B 5I1HL 2VCOA 1DR9A 3TTEA 3GDCA 3HFML 4NFDA 3MAWA 2H7WA 1PZ2A 1RI8A 4QLRA 4ELKB 2JTDA 1BQHG 2VEMA 2TMDA 1NCAL 3IUDA 3IDMB 1OSZB 4ZFMA 4TLKA 3GTTA 3QR1A 1YEDB 3RGVB 5HHPB 3F12A 2C9QA 3NEEA 3W11D 4CDGC 1MAML 4YDZA 1N5YH 3K4AA 4M1GL 1W5PA 4YCPA 5I1DB 3RTQD 3ES6B 3C52A 1DJWA 1BD2B 3L5AA 4OLUH 2FDSA 1GJUA 2VRAA 4RE0A 2COQA 4Z3FA 2YHGA 1MCFA 3BH4A 4ZS7H 1MLCB 4JG1H 1UKSA 3Q6GH 5GGRA 2A6LA 2R0WH 3TU9A 4IMLA 4Z1PA 3TBYA 3RX4A 3UGVA 3PDDA 1B57A 2WBGA 3WMSA 3EA3A 2BCKA 5IEHA 1YEEL 4K7PY 4OGAC 4O9HL 5DHVB 2ARJB 1LO5B 2E9MA 3MXVH 4GFXA 1JWUA 5C9ZA 2UWEE 2FX7H 2A3HA 2J1WA 4AW7A 5C9JB 3D9AH 3GXDA 3VUSA 1CD1A 4GX8A 3S83A 1E5JA 1L9OA 5HHNA 1VGKA 2Z4QB 4WDXA 1BWMA 3MRMB 1FHUA 4S1QL 3PGBA 3GSWB 5GSRA 4LL4A 2BGNE 1LO4L 5DVNA 3DOPA 4C56E 1PDKA 1RV8A 5CSZA 2FEEL 5DS8B 3ESNA 4D6JA 2GITB 1Q6LA 4NUJB 4HIBA 3MTWA 1KIPB 3PK7A 3MUGB 1J6PA 4P05A 3ARGC 4JHUA 3O4OB 5TQ0H 2G5WA 4GFSA 2XZ9A 1TYGA 1I1AC 4G5ZH 4AZ8A 1TVLA 4KI5F 1TQWA 3SKJH 3GFXA 4XWUA 2D1ZA 4Y9FA 4APQA 2EO7A 1OP3K 3MNDA 1N82A 1ITBB 4XZHA 3EJTA 3AMOA 4ABVA 1KC5L 3MU7A 4PHXA 4ACTA 3V7PA 2GUOA 2Z3FA 3LZLA 1KY7A 2QBWA 3P6LA 3REQA 2OJEA 2L3BA 4WFHE 3NZSA 5JA8B 1WA2X 3MRDA 3ZBMA 1LG1A 4I48B 3KPQB 1L9RA 3HJZA 3ZKXB 1B6DA 5L8JB 5EU4B 2Q3OA 1LORA 3OIXA 1WF5A 4LLYB 1WBHA 3OXRB 4PUUA 4G7SB 4O2EA 1FZOB 3MPGA 2VVNA 1QFHA 1Z9SB 2X9ZA 4GUOA 3WLTA 3WLBA 5KYUB 3RUGA 4E36A 3BQUA 4OU1A 3SCMC 5I9QB 2ANUA 2HH0H 3THUA 4N5EC 4P59L 2KYIA 4GUPB 2EEBA 1R3SA 3DCDA 3WS3B 3D69A 3FOKA 5E2VH 3TZVD 3IMSA 4UXDA 3D6GA 6ALDA 2DZAA 2IQTA 1CICB 3OKEB 2XTJC 4Q3MA 5BRPA 2DMBA 3HPFA 1O9ZA 3NQKA 1QZNA 1UC6A 2AQNA 1E27B 3HNSH 4NDMA 3NCCB 5IOBA 5EL1A 3VXTA 1UT2A 1SO4A 2TRYA 1MNNA 4NN5C 3UXIA 1R7AA 3UNTA 3BIAX 5IVXF 2UBPC 5KS9F 3GNNA 3PP4H 4XUGA 4JAMA