4FNTA

Crystal structure of gh36 alpha-galactosidase agaa a355e d548n from geobacillus stearothermophilus in complex with raffinose
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSNNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 225
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fntA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fntA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fntA02
1KFJA 3LTSA 5F1UA 4K8HA 2G97A 2A85A 3BG3A 2VT0A 3NM1A 3ZWTA 4WZHA 5D2YA 3KVKA 2EQDA 4JFVA 4DO4A 2PCQA 4GUGA 4Y96A 3W87A 3GVGA 4EF9A 3UWYA 4TMCA 4UTMA 1FXQA 1JUKA 2CLOA 1TV5A 4LVDA 1WZAA 2J6XA 3SIZA 3PM6A 3FFSA 3NZ1A 1V5XA 5T26A 3BUDA 2WPGA 5DN1A 4K36A 2LLEA 4QJ1A 5LNSA 2ZXQA 1IGSA 2A7RA 4JTHA 5EMYA 3W1RA 1TPWA 3KHJA 3MYOA 1LBMA 1JCXA 3JS3A 3G1SA 1OFEA 1HG3A 2FH8A 2C3ZA 4QITA 1UA7A 1RPKA 2Q8LA 4BFAA 2BXZA 3TK7A 3D50A 1P5BA 3G1XA 3I65A 4AMAA 1TQUA 3IJ9A 1YDVA 5CPMA 2RH9A 5MHBA 4XTIA 1A50A 2G3NA 1KFLA 2YIHA 2Z1KA 3ZFHA 4ONVA 4AEFA 1ZFJA 1SR9A 1KLZA 2R91A 1CPUA 4W93A 3TTYA 3PAJA 1NF0A 1LRTA 1D3HA 3BAJA 1OFAA 1K8ZA 4B9YA 2C18A 4UQBA 1N8FA 3OVQA 1TTJA 2ZZ6A 3P8IA 1OFRA 1W37A 2Z6JA 3N34A 3TJXA 1Q6LA 4FIRA 1K7EA 2ZRYA 4LV4A 5FEZA 4JFUA 4WF7A 4N9BA 3RNDA 1K8YA 4FLSA 3AMLA 4PCFA 3DX2A 4M56A 2GPTA 5H91A 1HNYA 1MEIA 3HG4A 3NL3A 4ZQNA 3FLUA 3W76A 2YW4A 1QX1A 4DQWA 2GUUA 4LY8A 3DZ1A 4M7SA 1PE1A 3BVWA 3W7OA 1TQVA 1XKYA 4UQCA 3BSGA 3NZRA 3P82A 5I23A 1XBZA 2QAFA 2VFHA 2WC7A 1KM3A 1HTYA 3IGXA 1XSIA 4GQQA 2EF9A 2Z6IA 3EX2A 3EXSA 2GVLA 2DZPA 2C16A 4KWUA 3LRKA 3PVFA 3W70A 1PVNA 1KTNA 1TPC1 4UTKA 3IV3A 1OK6A 1F6PA 3DHPA 2ZWYA 4BK9A 3DH7A 2VFGA 5LGZA 1OFQA 4I7WA 2V2CA 1SZNA 3OVPA 3FOKA 4IXXA 1TTIA 2XWDA 3P8JA 4JYDA 1U30A 2W0UA 3QW4B 1WOAA 2YR1A 3DI0A 3VE7A 1KGUA 4ORIA 4ZZ9A 1VB9A 2ZX9A 2D2OA 4BA0A 5K4ZA 4E2BA 4JTFA 3BW3A 5G2WA 1QHPA 4JN6A 2BLEA 3L4XA 1Y0EA 3M5VA 1F6KA 3EJPA 1HFBA 5AYXA 3N19B 2Y4SA 3BCDA 3EJTA 3KVMA 4IMGA 5C5YA 3BAKA 4KFNA 1AL7A 4Z1AA 1MXDA 3UPWA 4BZYA 3S1VA 1GVIA 1RP9A 2ZWZA 4YCOA 4FX7A 2QUVA 3C2EA 3EDEA 5CKSA 3MI2A 1L6WA 2ABBA 4AYGA 1LLWA 2FB2A 2P10A 1R2RA 4Z1CA 4DEFA 2PWGA 5I24A 1H51A 2V0TA 2I9EA 4NX5A 3IIOA 1H1ZA 4LC8A 1TQSA 1OB0A 4DO6A 1YDOA 2G95A 4GIAA 2ZUVA 1H7NA 3BGJA 4OIFA 1P0KA 3L4YA 1CGWA 3BVXA 3EDFA 4CQ9A 1FCQA 4OKDA 3EWUA 2NX1A 5TD4A 4LVFA 5LHEA 5A5WA 3L4UA 4LRSA 3VSUA 5G4EA 4RXGA 1S3HA 3WEOA 3NNTA 1SMDA 3O15A 1Q6OA 1F74A 4E2DA 3S5YA 3TC6A 2NXGA 3DHFA 2F61A 3W72A 3W85A 2ZA3A 4MZYA 5E93A 2A7PA 3G0UA 1OX4A 4JR5A 1OX4B 4N9DA 1U5JA 3EJSA 2I14A 4YWIA 2DZUA 4FNTA 3LDVA 3BMVA 2ALDA 2QEZA 1IIGA 2WSQA 3OEXA 3DC0A 2QPUA 3BO9A 1MFUA 4JGDA 3MYPA 5KTLA 3LPOA 3TQKA 3OA3A 4DXVA 3FIGA 5L6UA 1GG1A 2YX0A 1EA0A 4O57A 4UOZA 3EB2A 4UMBA 1TYGA 4JL1A 1BAGA 4L4MA 1QI3A 4A3UA 3BVTA 1AW5A 1I4NA 1VFOA 1KGWA 4GO8A 1TQJA 3PF3A 3V75A 3NQCA 2WCSA 3VNYA 4UQ9A 3DFSA 4K7YA 4YL2A 4MUZA 3H54A 2NLIA 2NZLA 1WAUA 2H3BA 1RVGA 3KL0A 2QCCA 1X1ZA 3LX9A 1VC4A 1YXYA 3EXTA 3PC0A 3ELFA 3BARA 3B8DA 1AL8A 3HGOA 3G8EA 4OHQA 1I2OA 2F7RA 4IWWA 1DV7A 3STCA 3QPYA 1LRNA 8TIMA 5F4XA 4GXMA 5TBOA 3EDDA 1L6YA 1HWWA 2AAAA 1H7OA 4DBDA 2BY0A 4D2JA 2JKAA 3SSJA 2E6AA 1K8XA 4LWWA 4QAIA 1UH3A 4AH7A 1QHOA 1DTUA 1Q3NA 3TDFA 4UTJA 2B4GA 2TAAA 5FEPA 3KEHA 3A9IA 2C6QA 1RQHA 4Z1DA 1UB3A 1MVYA 1OVDA 4JCMA 1F7BA 1H61A 5DLCA 3TX9A 2DZWA 4IMEA 1Q6RA 3UG3A 1H63A 4JIPA 2X1SA 3BW4A 4POCA 1J0IA 3QMSA 2CWNA 3QGVA 1YPIA 6ALDA 5AHFA 4MKNA 1X8FA 4M19A 1VHCA 1XDLA 2FFCA 4O52A 1GG0A 3NQ7A 1QPQA 4MY8A 5CG7A 2FQIA 1KBIA 1XBXA 3F1QA 4HP5A 1LP6A 1SW7A 1Z48A 3C4UA 5CGQA 1RQBA 4LUJA 4JTJA 1W9XA 2FDSA 3O8AA 1G7VA 3LI0A 3DI1A 5C54A 5A6LA 2YSWA 5I5RA 2OZ0A 4X9YA 3W71A 2DH3A 1TPH1 1KCLA 4PEKA 2CLIA 1JCJA 5D2VA 2ZZ7A 2CW6A 4RZ5A 2QCEA 5AYYA 3GZ3A 2YA2A 4O1DA 3WDJA 4GFSA 1R33A 7TIMA 3T44A 2C1HA 1D9EA 3WY1A 4LPCA 1GQNA 3TV8A 4NT0A 5BRPA 1SFJA 4ICNA 1WV2A 2CLFA 4HKPA 3RIKA 3CZEA 3W1LA 4UTWC 2V82A 4U4MA 5GVJA 1PPIA 4MB1A 3QH2A 2EAWA 2VEMA 4GE8A 3TQVA 4NXSA 3UNDA 3Q58A 3GKFA 2JKPA 4A22A 4YLWA 2Z1BA 3NAVA 4LUIA 1SZGA 3LBCA 4UTUA 4MFDA 4ZQCA 3W2LA 1WPCA 2ZYFA 1EWDA 3LXAA 1TPEA 3UXDA 4UFIA 4U33A 2WNQA 3VKJA 5CSRA 3W37A 3LCLA 1HUVA 3W2KA 1QPRA 3L4TA 4FLOA 3GX9A 2AQWA 1B0IA 1OFBA 3G1VA 4MFEA 2NT0A 2BHUA 2ZTJA 3W7HA 2OCZA 2BHYA 4GUJA 3UZJA 3WJWA 4K7VA 4GWEA 3EX6A 4UZUA 1E51A 2F18A 1IF2A 2YYTA 4OJYA 1GOXA 1KM0A 4NJGA 5HUPA 3A6OA 1E43A 2D0GA 1JIBA 2VUYA 4TX9A 2D73A 2FH6A 1DKWA 2JK2A 1OGSA 3W86A 4XBSA 1LTDA 2HS8A 1XI3A 3RMJA 3OLEA 2GJPA 4O53A 3W7NA 3C56A 4YXGA 4EIVA 5I3JA 4I7VA 5CPNA 4TR9A 3W2NA 3W7PA 3HJEA 3LRLA 3PBUA 4JS3A 2YKKA 3FJLA 3NQFA 2DZXA 3BVUA 1BWLA 1CXKA 1GZGA 1PS3A 3LHWA 3CEUA 2ZDRA 4BI5A 1M7XA 2VELA 3W7CA 2BY3A 1QPOA 2WO5A 2ZQ0A 4IPIA 4CN4A 2CFFA 4NVTA 4U2ZA 2G5WA 5EA9A 5DBTA 4QNEA 3DFQA 1MSSA 3D51A 1KFEA 2EGZA 3E0IA 3TROA 4O8RA 3S8HA 4J3XA 4M5PA 1MW1A 3RF9A 2W79A 3N9SA 1A5BA 3L4ZA 3KOFA 1TV7A 2FIQA 1XH0A 4UTIA 2HS6A 5FF7A 3NEVA 2NSXA 5HWMA 1TJRA 3HPXA 3W38A 3ZS4A 3TTSA 2PE4A 3UYCA 4A21A 4CN6A 4CN1A 2C0AA 3CWNA 4O50A 1YPFA 4PCTA 3MP3A 4DO5A 3W1UA 1FBAA 1I75A 4O17A 4CNNA 1KFBA 5A2AA 2KZHA 1PIGA 3KL3A 2PWEA 5KEZA 4LTSA 2RFGA 4BWLC 1IXQA 3P62A 1HL2A 4QISA 2OSXA 2ZA1A 8CGTA 3FJ6A 4CCCA 5D09A 1YLVA 3O63A 3HQ1A 3IVSA 3CGTA 4O19A 2WANA 2ZTKA 3PY2A 1TTQA 5LNRA 1A5CA 4ATWA 1A53A 3G22A 4Y8FA 4ZVJA 1K03A 3IEBA 3M9YA 5BRQA 1ZJIA 4JDBA 3M5YA 4AMWA 3WDHA 4DF0A 3QW3A 3DDFA 2A6NA 5E6ZA 3SI9A 5AN7A 2X30A 1VAHA 3RILA 1MO0A 1HO4A 3HG5A 1CGTA 1VCGA 4JX6A 3S5OA 4OGZA 3L0KA 3PBYA 3NQ6A 3Q37A 3TH6A 3UCQA 1Z42A 2ATMA 1LRQA 2VNCA 1A5SA 4NU7A 4UR7A 1XCFA 2RDTA 2QCDA 3CB8A 2QCDB 1QNVA 3B0VC 3P81A 1H5YA 3I7RA 4IMCA 3N9RA 4J27A 3QRHA 2FE0A 2F7QA 1QI4A 3INPA 3LCFA 1HTIA 5K4XA 1GVQA 2P0OA 1O7DC 4ZL1A 3WK3A 3DX3A 1SU5A 2V2DA 3VE9A 3PSWA 1S5VA 4MY9A 3L67A 2DIEA 1XBVA 3M44A 2YA0A 3QC3A 4FXRA 3L9CA 4E38A 2QUUA 2J88A 2Y85A 3DHUA 5AHIA 2V8ZA 3WELA 4O4VA 3W23A 1C9DA 1KLYA 2Y24A 1ZCOA 4JFTA 3L21A 4RXFA 4GINA 3GLCA 3UZ5A 2EADA 1RD5A 2EPHA 3TC7A 4J3UA 3BUBA 5HINA 4LS2A 1CGXA 1FXPA 1VLWA 3EX3A 4AHQA 3W7RA 1K02A 4QSHA 1CX9A 1OYBA 2ZUUA 1OYAA 3TE9A 3RU6A 1H60A 4NJIA 5DCEA 3FYPA 2GQ8A 2QJIA 1QWUA 3K8KA 2GJLA 1FDZA 1KA9F 3IGSA 2E0PA 5D02A 3NQEA 4RZ6A 3KVLA 1AW2A 2Q3OA 4H2CA 5K3VA 4LVGA 4QNWA 4CKQA 2V3DA 1OF6A 1SZFA 4GKLA 4LNYA 2VENA 5F2GA 4J3WA 3HB9A 3HZ3A 2TSYA 3HF3A 5KMYA 3G0XA 2V3FA 3DFNA 2Y89A 3EX4A 5DELA 2QJGA 2ZXBA 3ZR5A 2A21A 3PB2A 4JNMA 4O12A 1FWRA 3LV6A 4JTIA 3HOJA 3W7JA 3C2VA 2V5LA 1QOPA 2YOCA 4JICA 4NNAA 1KFCA 5AHLA 1KV5A 3HPZA 1LLZA 5F2LA 4FF7A 5E0FA 4FLQA 2CPUA 2YDAA 3GR8A 4CQAA 3EWWA 1E3ZA 1V3MA 3VX0A 2ZZ3A 3NPVA 3B05A 4UTWA 1JGIA 3SECA 4IGHA 2OSYA 1SZEA 3L0NA 3S0CA 3ATZA 3N73A 3L2IA 3WY3A 1Q45A 3VMPA 1TMHA 2FHCA 3W75A 3IVUA 5TQLA 3M47A 1UD4A 5HR6A 2ZA2A 3QZEA 4FIQA 4HNVA 5HUOA 5I0DA 1SO4A 2Y62A 3W1XA 1AQHA 1EIXA 5BMWA 4JTGA 3T55A 4LQ1A 4A2RA 1WZLA 1GEQA 1GJWA 3QPZA 5CSSA 1U33A 4Y90A 1FWNA 3UWQA 1B2YA 3LCXA 2EHHA 1MFVA 4WLCA 2OYKA 2BWGA 1KV8A 5CGTA 1OHLA 2E6FA 3LLFA 2DIJA 1ZALA 3A5VA 4JY8A 3G1FA 1OG0A 3DENA 1UD2A 4FMVA 1LZOA 3L68A 4QAWA 3WK0A 4JIQA 1D7FA 1L2UA 5K9CA 1PJ9A 3R12A 5I3GA 3BLPX 2VFIA 3EWXA 3BLBA 5F7UA 3D52A 2B7QA 4FEZA 4PODA 1C29A 3GK0A 2YCEA 4GI6A 4FB7A 5KSWA 4MZ1A 5K7JA 2ZZ5A 3I6RA 1R75A 4NI3A 4EF8A 5C6MA 3UY7A 3G1HA 1OT2A 1NOFA 3ZOAA 4TIMA 5DCBA 4S2CA 4ZQMA 7CGTA 4U3CA 2NUYA 2GJNA 1UUMA 2QDGA 3NQMA 4N4QA 2C8NA 1JAEA 4H7VA 2YZRA 3BG9A 2Y7EA 1JXKA 6TAAA 3CTTA 4Q32A 1SO3A 3F4NA 3MHGA 1VFMA 4MLJA 2F7PA 5FI8A 1MEWA 1KWGA 5FESA 1EUAA 1OT1A 5L9FA 1ZENA 3L66A 3DKLA 2YPIA 2V30A 1UBSA 2V5BA 3CM4A 5F2IA 4Z1BA 3THAA 1QW9A 4FNSA 1ALDA 4L4LA 1BWKA 3TIMA 2BXVA 4WXZA 5D33A 5ABTA 5LNWA 2XIBA 3BAYA 3THQA 1QFEA 1SSGA 2GVJA 1B9BA 3LCHA 1OFPA 3H53A 3U6WA 2Y61A 1W31A 4UMAA 1MW0A 2TYSA 2C13A 3CU2A 1ICSA 1YYAA 3GKAA 4BWLA 4FX8A 4KWVA 1G94A 1GJPA 4AXKA 3EWZA 3NO5A 3DX0A 1G69A 1G4TA 1TPVA 2JKEA 3CIXA 1VYSX 3W22A 4GO9A 3E02A 1C8QA 4LW7A 4JEQA 3PR2A 4IJBA 4OWGA 2BTMA 3S1UA 2C19A 4O13A 2OMAA 4UC5A 1W5MA 1JUBA 5G1TA 4GUFA 2GVYA 5DXXA 1KBKA 2NX9A 1F76A 1J0HA 4AIOA 2QCHA 6TIMA 5KINA 1V3JA 4JX4A 2EO7A 1SQ7A 4FNPA 2FHBA 1YXCA 4N6FA 1Z41A 1TO3A 2ISWA 4HOWA 3JR2A 1YDNA 4MYXA 2H90A 5K2ZA 4GRSA 4AEEA 1QMLA 3DX1A 3K8LA 3WJXA 3K30A 5AHMA 2WVVA 1R46A 4E0CA 3VNDA 4BI7A 4P61A 1JULA 1GYLA 4LC6A 2ATSA 5J5DA 1ZY9A 2VRKA 3B0UX 1GTEA 1BLIA 1LBFA 2A0NA 2F2HA 3HG2A 3IK2A 3DXIA 3BC9A 1V3KA 1EPXA 2ZIDA 2GQ9A 4FLRA 2AAMA 4A29A 4U31A 3JRKA 3WENA 1GVOA 2QCNA 1LOQA 1JI1A 3CZSA 1GVRA 2QV4A 1TCDA 1GWJA 3K8MA 3F4WA 1ADOA 2EEXA 1I45A 3HGJA 2FJKA 2JGYA 4A2SA 1G4SA 3HIJA 2G96A 2JGQA 3IIPA 3STFA 3VMOA 3ATYA 4XWUA 4N4PA 1O5KA 1W8SA 4LS0A 2PWFA 3TU9A 2ZX7A 3PULA 4ALDA 4GQRA 4O10A 3GYEA 2E6DA 3LV5A 2Y5EA 3C2OA 3W1QA 2OYMA 3M41A 1J0JA 4UQDA 1AMKA 1PZ3A 3UPBA 3UY8A 4JDYA 3M6YA 1L6SA 1U2YA 2ZUWA 1NFBA 2XIIA 1QO5A 5CPLA 1GPWA 4WD0A 2WCGA 1J5TA 1RZMA 1B3OA 3NQ8A 3K1DA 2YJQA 2HMCA 4HPHA 4YCPA 1DJNA 3P67A 5FEXA 3RFAA 4O14A 4BF9A 4NNCA 2CZDA 3T7VA 3IVTA 2NWRA 2ZZ4A 4DELA 3MI3A 1CW2A 1FQ0A 3C8FA 4KKXA 1L9WA 4RK8A 3TW7A 3S5ZA 5BW6A 2XN1A 2ZRVA 3NQGA 5EBUA 1F73A 4HNUA 3LCGA 4MYAA 1UD5A 3A5FA 5KZMA 1N55A 3ZT6A 1O4UA 2R8WA 5G4WA 3TA6A 1ME8A 3GDLA 2OT0A 3W7KA 1TSIA 4OT7A 2Q3RA 5DXYA 1Z32X 2QR6A 5LGXA 1C8VA 1OK4A 2ZCGA 3G1AA 1XSKA 1W5NA 4HNTA 3G8RA 4TO8A 2WV8A 1XBYA 4Y9AA 3VCRA 1JD7A 3LB0A 4X22A 1VR6A 5BMXA 4NJKA 2XN0A 1SO6A 4ZMGA 4ADSA 1VFUA 3MMTA 3VI2A 4EVZA 1NEYA 2XVGA 1Q6QA 2QMJA 5CZTA 3U8GA 4R7JA 3ZT5A 3W7LA 7TAAA 2QLYA 1G7UA 4WY0A 3G24A 4WY0B 3GR7A 1XV8A 2R14A 4G1KA 4PL2A 4X3ZA 3WK1A 1TCMA 3VGFA 3C2RA 1JF6A 2HSAA 3A4AA 1OSEA 4JL2A 1XC4A 3WNLA 1X6UA 2Q8ZA 5F4WA 5HULA 2BHZA 4GI8A 1MW3A 5A2BA 3UWWA 5DFAA 3LM7A 2TPSA 5AHNA 3BUPA 3P5YA 2D3NA 4GUIA 3NVTA 5DCDA 4DBEA 5A8GA 1GVFA 2J9ZA 2F7OA 1M5WA 4FHAA 5AC6A 9CGTA 3CIWA 3ZSSA 2Y2WA 3TJLA 3VO0A 4RCXA 1CI1A 2J9YA 1EHAA 1S46A 1XL9A 4GNJA 4H8VA 3HMJG 3B03A 3ABRA 1XUZA 2QCLA 2V9DA 1MEHA 3W84A 1WX0A 4CVWA 2CLMA 3HO8A 4UXDA 3WJSA 5D2XA 3S6DA 1PHWA 3KRZA 2NXIA 3QQ1A 2PURA 1VS1A 1IXPA 1TTPA 4KWWA 1OFDA 3EDKA 3B0PA 1CLVA 5EPDA 5HR7A 1RV8A 3DFTA 5EY5A 3NOEA 3IJ7A 3BLIA 2X1RA 1KM5A 1G5AA 2AGKA 4ZQPA 2NXHA 1ZS2A 4HSOA 5G1YA 3ZQ9A 3CZKA 3MHFA 3PWAA 4WUIA 3BG5A 1JRBA 4FO4A 1VHNA 4JY9A 5D04C 4J7RA 3BGGA 3G3MA 1OF8A 2F1AA 1DBTA 4PCSA 1DJQA 3OVRA 3BLKA 2E6YA 4JYEA 2BY2A 1OFOA 3NG3A 4AWTA 2OYLA 4I7UA 4ORMA 3A23A 4AMXA 4NJHA 1O94A 2ISSA 3A24A 4MZ8A 1GJUA 1VJIA 2WOQA 5HMSA 1UA3A 1F05A 2TMDA 2O7QA 2QCFA 4OV9A 4XTDA 3KL5A 1NM9A 1ZJAA 1TQTA 3GXDA 4AW7A 3NDOA 4O1BA 1LBLA 3B4UA 3M0ZA 1E40A 1RP8A 1KM4A 3TQ0A 2ZRZA 5E70A 1D3GA 3O05A 1R30A 1MXSA 1PCWA 3BLFA 4KFPA 4QQ3A 4Z0SA 1EO5A 4CCDA 1PV8A 3CWOX 3P5ZA 4NNBA 1YADA 3KXQA 4O15A 2VOMA 2ZX6A 2GQAA 3BMWA 1B4EA 5FEWA 2Y7FA 4MIMA 4M6PA 1VZWA 4AHOA 3P80A 3VSTA 2EKCA 4K8EA 1ODUA 3R5EA 1FDYA 1PCKA 4FNUA 4NX0A 3W7IA 3QSTA 4NZJA 2Z0IA 3S1XA 3AJXA 5E1QA 3CEPA 2V2HA 3GXPA 2GJRA 3MP4A 1CGYA 1UH4A 4QIUA 3TFCA 4XBKA 4UTTC 3D4YA 5FF2A 3BUIA 1H50A 1HO1A 3TXVA 1QWGA 1BVNP 1K7FA 2ZRXA 3MBFA 2PRHA 3MO7A 4GI9A 2Y7DA 4WXYA 1CGUA 1JRCA 2WKGA 1BG9A 3E9AA 5HDRA 3R8RA 3HG3A 1DEDA 4XKYA 4XKYB 1UD6A 3IIVA 2QCGA 2G3MA 3N3MA 4AAJA 4AHPA 4X0NA 2F84A 1BPLB 3FS2A 3O06A 4ZQOA 3PUEA 1JCMP 1OYCA 4J3TA 1LROA 2FHFA 3VGEA 1RR2A 1W56A 4EOUA 3I68A 3QMTA 4N9CA 3ANYA 1QI5A 3ABQA 2ZZ2A 1LWHA 3OBKA 4TU1A 1WA3A 4O0ZA 5U4NA 2IQTA 3UWZA 1J2WA 3LRMA 3SJ3A 1TQXA 1JFHA 2VKZG 2DJLA 3KAOA 1KBJA 1WOBA 4MOZA 4E2OA 3DHDA 3S42A 3WMSA 1H7RA 4J3SA 3LHVA 4GUHA 3AO0A 3EJRA 3LTYA 5IBXC 1M7PA 3ZR4A 1KM1A 1ZNNA 2VFFA 4WX2A 3WDIA 3VMNA 4CCEA 2VR5A 4WSKA 1I8JA 1G1YA 5AFDA 1KXTA 3M43A 3O16A 3BK0A 4UQAA 2HTMA 2B0MA 4K38A 4Q4KA 4PSPA 3C3NA 3EWBX 3FW6A 3AXHA 5D03A 3EWYA 5DY2A 1UD8A 3CV5A 1KW1A 1FY6A 3MJYA 1T8XA 3SR7A 1XH1A 3GXIA 4MPQA 3W1AA 3HGRA 2ZXAA 3TCEA 5G5IA 4HPXA 4JTLA 1TJPA 1ME7A 3M1ZA 3L2LA 1UKSA 2YFNA 5CXPA 5LNUA 4ML9A 1XFBA 3CC1A 2E77A 2BXYA 5DO8A 3NYZA 5KZEA 5CZSA 1UASA 2PRMA 3FYOA 4UNKA 1XH2A 3UG4A 1DHKA 1AQMA 1T96A 1PEZA 4UFJA 4N02A 1E3XA 4O1CA 4Z08A 3C2FA 1HX0A 4J3VA 3OLDA 1UOKA 4Z0JA 1WBJA 3WFZA 5CGMA 2J24A 3QM3A 1JQXA 4GC4A 3G3DA 4JTSA 4AF0A 2BY1A 3HBLA 5EYWA 5A2CA 4J28A 4X2RA 3N2XA 4UTHA 1UCWA 2YA1A 3PS7A 1PZ2A 4HPJA 2QMKA 2QJHA 3CZLA 3GBDA 1DORA 1WYIA 3CHVA 1VCVA 1G9HA 3W7GA 3GBEA 3P74A 5CLTA 1QAPA 2VEIA 3G1YA 3V1PA 2DJXA 3BW2A 2ZXDA 4K6AA 3DFPA 4IOTA 2XN2A 1FWWA 3BH4A 2Y63A 3BV4A 1BF2A 3LCIA 2WQPA 1RPXA 4FNRA 1O60A 3UXAA 3VM5A 1UKQA 3UG5A 3TR2A 4LT9A 4UFHA 3WNNA 1OJXA 1EP2A 5E6YA 2CLKA 2NWSA 2WNWA 3FKKA 3C52A 4JFSA 1BVZA 1HL8A 4Y6GA 5FF4A 2FLIA 1H3GA 4UZSA 3O6DA 4IMDA 3MBDA 2OSWA 3NQAA 2OW7A 2QCMA 3EKLA 3SZ8A 1H7WA 1VJSA 3E49A 1UKTA 4OBTA 3LLDA 1UH2A 3LOTA 3UWVA 1AK5A 4PH6A 4HOXA 1QWNA 1KXVA 2X2GA 4AIEA 2E5DA 2DZTA 3L5AA 3M5XA 4JTUA 2WVTA 4LVBA 1G6CA 2NUXA 2B7OA 1G4EA 1SW0A 4JYFA 2ZX5A 2OT1A 4MJZA 1R2SA 1SPQA 2NV2A 1IZKA 2GUYA 3WNMA 2VFDA 1LWJA 4UNLA 1TMQA 3VX1A 1KB3A 4UTLA 4PC8A 1B4KA 1X1OA 2DORA 1EA9C 1JF5A 1JQVA 2B7NA 4UQEA 1JCNA 3W3OA 3N14A 4H8UA 3P84A 4CNPA 4N2YA 5CZJA 3W9ZA 4HSNA 1WDWA 2WJZA 4DF2A 1UUOA 4UFMA 3KRSA 1LOLA 1LORA 3GDTA 1N7KA 2XVKA 2QAPA 3LPPA 1HXKA 4NXKA 1THFD 4PTNA 3GXTA 3WNOA 3UWUA 2WSKA 3KE0A 3GAKA 4GJ1A 3RK8A 1I2NA 1H1YA 5HWNA 3MW7A 1SFLA 3TXZA 1L0PA 2WVSA 1HVXA 3O6YX 1LOSA 3W1MA 4M6QA 3OLIA 1LYXA 2CLEA 3YPIA 4C1LA 1W1ZA 2IGTA 3GAYA 5HXMA 4R34A 1MXGA 3VU2A 3IIXA 4U28A 4HT3A 3GXFA 1TPUA 3N2MA 3NPXA 3CQ0A 3NQDA 3TSBA 5LNVA 5HPOA 1OABA 4IUOA 4CLMA 3ABSA 6CGTA 4C1KA 2A7NA 5D37A 3W07A 1PS9A 1EH9A 3I7QA 1JCLA 1WZMA 4WOQA 3M5ZA 1H7XA 1SMAA 2C7FA 1FUYA 2WNZA 2ZRWA 1CXEA 3D0CA 5EL1A 5F1VA 1XGZA 3GTNA 3LGEA 4UTTA 5LSMA 1TPB1 3W1PA 4MLRA 2EJ1A 1XD0A 1G4PA 3HGSA 1QDSA 3A22A 3TAKA 1ICPA 2FB3A 2ISVA 1XD1A 1W54A 2YW3A 3LBMA 4LS1A 3NL5A 4WQ6A 2A4AA 1EEPA 4RKAA 2E5CA 3W88A 1VQTA 4GBUA 1GT8A 4DF1A 4K39A 1CIUA 2PC4A 5CLWA 4R53A 2H6RA 3WY2A 3LERA 1PIIA 4TMBA 4IXHA 1AG1O 3UD6A 5E0KA 2E1DA 2QDHA 2E9BA 1WZKA 3QMRA 4UR8A 2CZFA 3NGJA 5U7SA 2A6LA 1NSJA 5CPOA 3TFXA 1F2JA 2W6RA 3WK2A 1XXXA 3IRDA 2OW6A 4LRTA 3W83A 2V3EA 2ZUSA 2WSRA 4WOZA 5IBXA 1ME9A 5KZDA 3RLVA 2WVVB 1BTMA 1DQXA 2XVLA 3GDMA 1VCFA 1XDMA 4UIOA 3R89A 3W7MA 1JDDA 1K7XA 2FPVA 4XUGA 2E68A 3TMQA 4JXCA 3GB6A 2DZVA 3B06A 3S5NA 1IZJA 2H3DA 1U83A 3VFLA 5D38A 1H7PA 3FA5A 4AVFA 3ZO9A 2WPBA 1TPFA 3BAIA 3FAWA 4IX2A 3ECQA 3ZT7A 1JVNA 2D0HA 1SSDA 3BUQA 1CDGA 4HIBA 3EEGA 1JD9A 3GDRA 4EWND 3IIZA 3W7DA 2WSYA 3W1TA 2PWHA 3NQVA 2D3LA 2XFWA 1F5ZA 2QKFA 1DL3A 1PHQA 5KITA 3UEQA 4UNIA 4OU1A 1IXNA 4UCGA 3SW6A 5I3FA 1MZHA 1TRIA 3W74A 2CXGA 1EUNA 4W9TA 5I3IA 1JXJA 3P61A 1YTEA 4PEEA 3TUUA 1KWKA 5EMUA 1W3IA 3PG9A 2NT1A 1I2QA 2WKJA 2YXGA 1D3CA 1ZAHA 5D05A 2UV8G 1G67A 1YTKA 2E8ZA 2NV1A 4R33A 4CGTA 4MJMA 4UOQA 2OJPA 3CT7A 5E9AA 4X9SA 4CNOA 3CZNA 4O1AA 2A2IA 5LKYA 3BSHA 4IQLA 3EJQA 4KMQA 1VLIA 3GNDA 2FPTA 5K9XA 5AC8A 3W1NA 3PUOA 4MVAA 3BCFA 3EDJA 4H4IA 1IXOA 1P4CA 1O95A 3KX6A 2ZUTA 1V7YA 1KXQA 2CHNA 1KBBA 3NXFA 4FX6M 4RJEA 4YMZA 3M7WA 4OQVA 3STEA 5H2ZA 4PSRA 2NUWA 3ZR6A 2J27A 3S2CA 5G2HA 4M8UA 3ZSTA 1FWTA 1P0NA 4N6EA 3SGUA 3BAWA 1TQWA 1NAL1 4N9EA 1ZHAA 1CXLA 3O1NA 3KVJA 2GOUA 1MW2A 2A1YA 1TB3A 1I2PA 1W0MA 3OG3A 3T40A 2CZEA 5HNRA 1ML1A 3CPRA 3QSRA 3GDKA 3KWXA 2VRQA 3CLWA 2R94A 2WSPA 1AMYA 3DDGA 1CXHA 4TVUA 4JTKA 3OLGA 1P6WA 2I1OA 3GXMA 2VEKA 1KTCA 1XUUA 4RV8A 1WQ5A 3SGZA 5BRBA 1CXFA 2VEPA 3EXRA 2NX3A 5DBUA 3R13A 3L0GA 1ZAIA 2C15A 1EX5A 3GXNA 5C2XA 4RR4A 4JCLA 1AVAA 3PG8A 5I3HA 3HPSA 4UMCA 3DGRA 1QCWA 3BAXA 4RLIA 4AEOA 5AYZA 3NPUA 3Q2DA 2EABA 2GVGA 1W3TA 2Y88A 3AJ7A 4JFWA 1IIHA 2RDUA 4UFLA 5IM51 3VGHA 4AWSA 3QFEA 3PBVA 1QOQA 2X2JA 3AXIA 4HA1A 4AB4A 3FEMA 4JX5A 2AMGA 5AOUA 2ZRUA 3NL2A 4IMFA 4H8HA 1W5PA 4MAZA 3QEZA 4UFKA 2E4TA 1LM1A 2X1TA 2F1BA 5F2MA 2VXNA 4H3DA 3USBA 4PFMA 3VGBA 4IPJA 5A6MA 1JDCA 4FNQA 2QPSA 3L2MA 1JJKA 2FYVA 1DOSA 1R34A 5F4SA 1A5AA 5FF3A 2CLLA 1KFKA 1VYRA 1VRDA 3PSVA 4LXFA 1YXDA 3PB0A 3DBPA 1R2TA 3DAQA 3A47A 1QO2A 1QPNA 2QUTA 1EO7A 4NQ1A 3EJUA 3NQ2A 5LHFA 1JDAA 1ONRA 4B9ZA 1VGAA 4NJJA 4O28A 3LCWA 3P7YA 1PIFA 2RDWA 1NVMA 1EP3A 2DP3A 1QR7A 2C14A 1M6JA 3STGA 2JBMA 4XQ6A 4O54A 1Z44A 1WBHA 4ADTA 3G0SA 4JTEA 1JI2A 3UERA 3VGGA 1HT6A 2QF7A 2E8YA 5HQEA 2RHGA 1VIWA 1QW8A 1KM2A 1XSJA 4HNNA 4O11A 3UQNA 3LHUA 3IJ8A 1LCOA 2BZNA 4ZQRA 1TPDA 1ZJBA 3EX1A 4HHPA 2F7FA 5K9DA 1T99A 5J5RA 3MP5A 4I9AA 2RKXA 2ZZ1A 2FTPA 1OX5A 3W73A 5D2TA 3WJYA 3LI1A 1KCKA 1CGVA 3PUDA 2FGZA 3VSVA 3WFAA 5FF0A 1AW1A 4NZFA 1WXJA 2VC6A 4S2BA 4LU0A 1TV8A 3NR0A 2WVUA 3CZGA 1PL9A 1CXIA 1JR1A 1VYPX 2FPYA 1H62A 2ALWA 2ZX8A 3BLEA 4O16A 3W2MA 3ABOA 3KLKA 1EP1A 3KRUA 3ZWSA 2ABAA 1Y7VA 1KTBA 3WN6A 3S1WA 4OE7A 4HOZA 4RX0A 3LHTA 3TSMA 3GNNA 2WKLA 3CPUA 4NUWA 3W2UA 3DU0A 1NF7A 3A21A 1ICQA 3WNKA 2VFEA 3SY5A 4ADUA 1EB3A 1FDJA 3MHUA 1KM6A 1GCYA 4S1FA 3DKJA 4O0KA 2YGYA 1JCYA 4LV9A 4AYSA 3CLMA 4O4WA 2E5BA 4H6KA 3NM3A 2H8XA 3C61A 3BVVA 2ZFAA 5SWUA 3M07A 4BR1A 1J4EA 2Y7GA 3LXBA 2BX7A 3NPWA 4WJEA 1TRDA 2DZSA 3O07A 3II1A 2PWDA 1K3UA 4U2YA 4BI6A 3G18A 2EAEA 2D0FA 3Q94A 1QPKA 4QM1A 1FWSA 1S5TA 1WP6A 3AMKA 1JUEA 3WNPA 1RQEA 1GVSA 4JD4A 3B04A 1JG9A 1W5OA 1TIMA 1S5WA 4XB3A 3BPWA 4CQ8A 3L5MA 3IGUA 4PA8A 1J0KA 3OHIA 3TOPA 2O7SA 3TMLA 1A47A 5HWJA 1GTHA 3CTLA 3L5LA 4LOCA 4OV4A 1BEUA 1SW3A 2XWEA 3VM7A 4DPPA 3L65A 1T0OA 5DY3A 3U2OA 4B5NA 5C55A 2CLHA 4UCFA 3C6CA 3M16A 1XCWA 5EKYA 3KFTA 5TIMA 2X1UA 2X2HA 1SUXA 1ZAJA 2Y6ZA 4UUIA 4P2VA 3DFOA 4DPQA 3L4WA 1TREA 4MY1A 1YTDA 3NA8A 2E09A 5D2WA 3HJZA 3W7QA 1JL8A 1BSIA 1XM3A 3F03K 2BSLA 1V3LA 3S9YA 3GIYA 4LVAA 4JTTA 2TRSA 1O5XA 4HN4A 5LZLA 2V81A 1BKSA 3RLUA 5I3KA 1GYNA 3W6YA 3VGDA 1P1XA 3LHYA 5AHEA 5D30A 1EWEA 1WO2A 2ZICA 2ZE0A 3BVJA 4FXSA 2DH2A 3KLLA 5AB3A 4AWUA 3L4VA 3DX4A 3WEMA 4J9JA 1WE5A 3T78A 4M7TA 2CZ5A 1FCBA 3W2JA 4XZ9A 3EKZA 3E96A 1VPXA 4IX0A 3P60A 2J9XA 4K37A 3W7EA 1HL9A 5BNKA 1DVJA 3PBWA 3WJZA 2CU0A 1XCXA 1CYGA 4O18A 1Q4NX 1FCVA 1UJPA 2P1FA 3LHZA 3QJAA 3QQ0A 1PAMA 3TAOA 5AC7A 4Q33A 2ZBTA 3R2GA 2A5HA 2J25A 1OX6A 3TKFA 5D32A 3FAXA 1I2RA 1R47A 4RZ4A 3H55A 2H8ZA 1X7FA 5CZ0A 1UD3A 1DHPA 3C0JA 1DQWA 3TONA 2X16A 3E12A 3G1DA 3NL6A 1M7OA 1B57A 2X2IA 3QF0A 3MI6A 3VNZA 2YFOA 1KGXA 4AF0B 2Y70A 1SO5A 3OIXA 1FCUA 4WY0F 2DU2A 3TW6A 3O6CA 1LDCA 2B7PA 2Z2UA 1W5QA 1KXHA 4M6VA 5G2IA 3MWAA 3LXCA 3WY4A 2OX1A 1FX6A 1VH7A 1MWOA 3I7SA 1W3NA 3FKRA 5BOOA 3QYQA 3SFKA 4PL1A 2PRLA 2YYUA 3LTPA 3T4CA 2WNNA 1M53A 4KFOA 4WSJA 2EACA 5HJLA 1IV8A 3D4ZA 3MUXA 3TSDA 3TNOA
chains in the Genus database with same CATH superfamily
4GXUM 1UR4A 5F1UA 3CUIA 3K46A 2EDXA 1OM3H 3X1FA 1OEPA 3UDWA 3QULA 4OSUH 2XA3A 2DD8H 4HMEA 4UBDC 1S7QA 3PM6A 2PCPB 4NWTH 5KVEE 1ZMYA 4F40A 1HHGB 4K2UL 1KKRA 3DIVA 5EMYA 3SE3A 4ODHL 4D7BA 4XNQA 3ZDXE 4YO0A 5KANI 3D50A 5J1SC 3C2SA 5DVKA 4A68A 3GJFB 1RV6X 5D2LE 4C6CA 1OCCB 1H3PH 3LNEA 1WCQA 4OAWA 4UQBA 1J1PL 4IJTA 5DJZA 1SJAA 1HQ4B 1F45A 4JFUA 4WF7A 4UIKH 4M48H 4L5FH 1YE6A 1M65A 4R7VA 3DZ1A 3BVWA 2BRRL 1XKYA 3BSGA 4RVBA 2L04A 3TN3A 3VKCA 3DDMA 1LQ2A 4GKZA 4KWUA 3KWWA 1S6NA 4Z7IA 1V08A 3PVFA 2HT4D 1NIFA 3UPAA 2V5KA 3QDMA 1F2XK 4IXXA 1A7OL 5E99H 2DT2A 3CC5A 2DQHL 3MACH 2OMZA 3WSUA 1EPFA 3TCSA 3WQDA 4HBKA 5I19H 3LNPA 2DQEL 3P11H 1T2QL 4O2EA 1ZANL 1R2RA 3WS3B 3VNMA 3DYPA 4N22A 2FZMA 4R90L 1OB0A 4X4XA 2VXUL 2PZ0A 4Q9CA 2I7SA 5D1XD 4CD8A 4IIZA 3TXAA 4Z7VA 1S3HA 3XISA 4BZ2L 4XVSH 2VVSA 1J8SA 1FYTD 5JO5A 5DD5L 2VW6A 3Q8FA 2ICCA 4UU9A 1OX4A 3KPSD 1GHFL 2UY6B 3EJSA 5J13C 3S2AA 3LEXA 4QYOA 2OZNA 3DC0A 5BW7A 3GBNL 2HDJA 3GSVB 5CC6A 4DXVA 4WKHA 1FPTH 3DJTA 5IMMA 4L4MA 2G75B 2V2WB 1KGWA 5D7HA 4YK4C 2ATPB 3EOYG 1X1ZA 3LX9A 3EW3B 3SRFA 2WIIA 3STCA 1DVTA 2EEAA 1QACA 3ZHDA 3EDDA 1CWVA 1PFCA 2AAAA 4D2JA 3RVWD 3ILQD 3SB0A 1CO1A 2LE9A 3FUDA 4EBQH 3KEHA 1NGYB 2C6QA 1RQHA 2NW3B 3ARFD 1ZBKA 5D7IA 4NO0D 3BW4A 2ZCLH 1EX0A 4N2MA 1KJMB 2GJ6B 4J5NA 1J1XL 4YVPA 4XZLX 1GSKA 3QEHA 1OM0A 3S37H 4NQDD 5IB4B 5T8GA 4LUJA 2X3AA 3HNTL 4C54A 3PWPD 5LLIC 1KACB 1BOYA 3BICA 3WF1A 5A2JH 1Q13A 2PXYD 1P7BA 1GQNA 1KIRA 4CSSA 3MV8D 1I3RB 3AWFA 1TWZA 1LF9A 4NXSA 2GK0B 4Z0XA 4C6BA 2JKPA 4M9PA 4ZUVB 2NCEA 1O6SB 3MRBA 1WPCA 1TPEA 3MS8A 3ZX1A 1W3YA 4GHRA 3NO1A 5ISZA 5E08L 1B3VA 4N90D 2BHUA 2YLHA 3E5BA 1A7RH 4AQZA 1MJ8L 5HUPA 2RR3A 3SE6A 2GJXB 1AQ0A 3GFXA 5KJRH 3RWCA 4Q2ZA 3IJSB 4TR9A 1IUZA 1X5FA 4P4RB 3BVUA 1JSYA 2XKUA 5ICYA 2W9MA 3WX7A 4BZ1L 3MRNA 5I18H 1NDVA 4RUBA 1WS8A 5DBTA 3NYDA 3O6LL 3IDNA 3OKEB 1HINL 1A5BA 1HJWA 3KOFA 1QLEB 3PV6A 3CVDA 2WMIB 1A6WH 3BGFB 4EUPB 3CWNA 3MV11 1K8IB 1BYPA 4UM9A 4BFJA 5KEZA 3I2CL 1NCAL 3QWRD 4KQ3L 3UP6A 1C8XA 3VDGA 2ODHA 3LY0A 2H9GB 2WY3B 4DTGL 1ZJIA 3FRUB 2WD0A 4F9PC 3VRIA 5T3XH 1LF1A 1SLUA 3MUCA 4LEEA 1CBJA 4L1XA 3OJDA 2B3IA 1PSKL 2AVGA 5ANHA 4KHTL 3QQ3B 2A79A 3H9HB 2QCDB 3WJJC 2IIJA 1U8NB 3MRIB 3L1OH 2FMOA 4JDTL 1O7DC 3LZ3A 5H37A 4NZ3A 5FX3A 3QC3A 2E9GA 1GKEA 3VC5A 3ZKSD 6A3HA 1A1MA 3UZ5A 4XN2A 2R15A 3A6CH 1BJMA 5B22A 1CGXA 1OE3A 1FXPA 1QFPA 3TU6A 3CQJA 1P5VA 3GWJA 1FO0L 1IT9H 4IPLA 4KETA 2QQNL 2BK8A 3WGUB 4QCFA 1ZLDA 1CLKA 1VHPA 4MMYB 5T3XE 5GRVK 1X7IA 3VIPA 4G59C 3LV6A 2WN2A 3VRJA 4JTIA 2BIQA 3F2CA 1Q9OB 3ZTJH 5JHAA 2E6PA 1AS8A 2J72A 4YLCA 1PYWA 4MJIE 1XX1A 4CQAA 1QLRA 5GJTL 1B9KA 1QEWB 4AVNA 1GYVA 5KN5A 3L0NA 4PQXA 1TV4A 4AYEC 3EJYC 3W75A 3BZFB 1AGFA 4D0CA 1FAIH 4YXHH 4BK5C 3I6KB 3EFDH 1GOQA 2MQGA 3LB6D 1NQKA 4O00A 4Y19B 1NANH 3PP7A 2R0LH 4JY8A 3DENA 1T66D 3ID7A 4PWGA 3AIWA 2RCSH 2GSGB 1MFCH 3V5KA 2YD0A 3ZDWA 1IAII 2VMFA 2NUPA 1MUJA 3V9EA 3VCNA 2YMTA 2ZZ5A 5GSVA 4LQFL 5KJ4A 5BOJA 3RM4A 1J0ZA 4WVRA 4QHKJ 1J5DA 2PGWA 2PNCA 3IDMA 1N4XH 1RXOB 3UZVA 5CU5A 4FSAA 4HSAC 2CO6B 5AC5A 2QVTA 3R8GA 1GC1L 4MS8C 4U5IA 1AYRA 1VBRA 2BXVA 2YCLA 3BAYA 4F57L 4X60A 4IG2B 5DD3L 1A5LC 1NDWA 3OV6A 4KDWA 1GQKA 4JN1H 4OT1L 3FQ2A 5EU3B 5G4OA 1S7XA 4HCGA 2QVKA 4LSSH 4LW7A 4MA8L 3RL1A 3VDCA 1SLVA 4G5AA 4AW4A 2X1WL 3WH9A 3HKFA 1QFUL 2P28B 1YDNA 3K8LA 3CFMA 5I1LB 3MRQA 4U1JB 1DDHA 5E0QA 3IBEA 2EYSB 3B0UX 2A0NA 1IVUA 4P2OA 4DWSA 2BVWA 3SKJL 1ZP3A 2W0LA 3F7YA 4LBUA 2J3SA 1GWJA 4AQ1A 1G4SA 2FD6L 3STFA 3MROB 2X6BA 1JGUH 2ZX7A 3PULA 5D7JD 3AABA 3R94A 3C2OA 4PJIA 3SDCD 5GSRA 4KGJA 3QVQA 4JDYA 1IEAB 1TVHA 1J5TA 2ZYIA 2YPLB 3KPPA 4YCPA 1SJVA 3LEVL 4F37K 4DELA 3MX0A 3C8FA 3Q06A 1SJEB 3NQGA 3BEVB 2GK1B 3LKRA 1MJ7H 4JZOB 1WDRA 1YAIA 3Q65A 2OT0A 3VIGA 4FA8A 2QR6A 4OZGB 3I3DA 1C8VA 2P45B 2EG7A 3ZK0A 3AM8A 4DPCX 2A4CA 2X6AA 4R7JA 3G5ZA 3B9NA 5LNEA 4XBGA 2NNRA 4S23A 5AUMB 5A94A 1NCOA 3OAUL 3RNKB 3FQ4A 3K5RA 4NAFB 2ACSA 2CBTA 4KJYB 1JVOA 5JPNB 5GNXA 5CPTA 4RESB 1OSZB 4HKJA 3P5YA 2ZYHA 1F5WA 3BZ5A 3C8KB 4ABUA 4BJLA 5FECA 4WFFD 1OWQA 2G5RA 4CVWA 5LNDA 1OD8A 2E40A 4GGBA 4HG4K 2NXIA 4N9GB 3L9BA 2R4SL 3W53A 4JRYD 3O3DB 3F62A 5IBTH 1ZS8B 3RXZA 2RGSA 3TN0A 5I1IL 2X1RA 3BP4B 4E42A 5JR1H 5TDNA 4GUCA 1JRBA 4U49A 1VHNA 4FI8A 3BGGA 3BLDA 3G3MA 3ARXA 2LTQB 4ZO7A 1OQFA 3A23A 1FVCA 3IJIA 3VJ6B 1KYOJ 2ZG2A 3U1SH 1R5YA 4GIRA 3AIEA 1D3GA 4W9KC 1A1OB 1CIDA 4PB9L 5EO9B 4M6PA 2HUEA 2R8SH 4FNUA 1W2KT 1SJHB 3WMCA 5HGHA 3W57A 5F89B 2OWCA 2NYYD 4ODWA 1K7FA 1ZT1A 4DPAX 2XWBB 4CW1B 3MTXA 2FB4L 5LQBH 4AYDC 1UD6A 2WYSA 4L4TA 3FS2A 2XV3A 3CV6A 4J3TA 4P9HC 1IM9A 5K9OA 1XYFA 1KFGA 3AS0A 4ZFOA 1HHHA 3R43A 1RMFH 3L4CA 1EAOA 2VKZG 2A9AA 4PCYA 5JOPE 3DHDA 3ATAA 3SFWA 4GUHA 3UBXB 3LTYA 4H4NA 2VFFA 2QQLH 1OCNA 2VR5A 3M43A 5LN4A 2CKBA 1WBYA 3FW6A 4K5MA 3AXHA 1X97A 2OK0H 1J8HB 4DJMA 3HI1A 4JG0L 4XZNX 3OZ9H 4JTLA 5F0LB 4JUSA 2D69A 1SJXA 1IO4C 3UZYA 2E77A 1BQLH 1Q0EA 3LQAH 3Q8BA 5B39G 4KJQD 4A3QA 3FYOA 1XH2A 3DGDA 4G80B 2YRLA 3FO9B 4CU8A 1AG0A 4Z08A 3P3YA 5GRJL 5I1HL 3NT0A 1JQXA 2B81A 5BS0E 4UMGA 4JO4H 1A4BA 3UL4A 3BQ5A 4KK9C 2BNQA 3KBWA 7ODCA 4V1DB 3QUYC 4G1MA 2Q3AA 4UT9A 2P80D 3LSCA 2ZXDA 3V4VA 3T0WA 3GBLA 1RPXA 1J5HA 3UG5A 2C3VB 1HI6A 5C8JA 4PJ8C 3F58L 4Y5VC 4Y6GA 4HH9A 4PH8A 2VISA 2IUZA 4GIOA 4A66A 5TDOB 3OHXB 2XTKA 4PH6A 3MBWB 3SDXE 4R90H 1FFOA 4N1CA 1V7ML 3N91A 1DXFA 4Y5YB 2ZX5A 2YQGA 4C6PA 3GTFA 1IM3B 3MJMA 1PSCA 2GUYA 2BDNL 4OTXL 3FTSA 4HK3N 1XX9C 4OH2A 4PC8A 5DJDA 1P4IL 2B7NA 1JCNA 1IC1A 4CNPA 5A8QA 2B0SL 3B2UD 1E70M 3P4MA 4DF2A 3MLZL 4PMDA 4PGDB 2QFRA 4AMKH 2QAPA 3P3BA 4PTNA 1FVDA 3U4EB 5HWNA 2DQGH 1ZLVH 1L0PA 3FTZA 1KIUA 4NN5B 3MFFA 3UJRA 4W6YB 3SE8L 4NZRH 4DHGA 4YHLL 2BVPA 4XAKD 3BLCA 3JUGA 2XKSA 1KBGH 5DRWB 5D37A 4X99B 3UTSB 4BRJA 2ZRWA 5I30H 3LGEA 1NFKA 2DGAA 5AOZA 1NEZB 3A22A 1JZIA 3NG5A 3APFA 3MRGB 1JHLL 1I7TB 4HSHA 1LQAA 2FRGP 3UD6A 5FKYA 1P1ZA 4NAMA 5KVFL 3B3IA 3U57A 5JXQA 1XXXA 1RZKH 4LSTH 1NIUA 4F8PA 2C9UA 4Y5XC 3TMQA 4GBXC 4RPQA 3HNTH 4IRSA 3DIFA 2GJ6D 2IPUG 1UR2A 1U83A 1KD0A 4I7ZC 1H7PA 2EDBA 4W4OA 2O5XH 5A40E 1JD9A 2N0MA 3GMPA 3IXTB 3PGDB 3RVVD 4UNIA 4OU1A 4PJ7A 4GLRI 1EUNA 4W5ZA 4PEEA 4KXDA 5F9JA 4JHZA 4LP8A 2Y06H 2OQYA 3IDGB 2YX9A 3ZVVA 4L9LA 4OV5A 5E9AA 3RWJA 4GGHA 3RY6C 3DOHA 3DEQA 2B59A 1O6TA 2QFPA 4YR6B 4YMZA 1J1OL 2VLJB 2A9NH 3ZR6A 5I6MA 1D5XA 1HIML 1S5MA 1S7WA 5DD0L 3O1NA 3U7AA 4WUUB 4O1FA 2FYMA 2H26A 4RX4D 3U36A 1CE1L 3DDGA 4PJHB 1S2TA 2NZIA 1QNIA 3QUML 3F5JA 4XWGH 3HMWH 2H3NA 2NV9A 4PCNA 1KPVA 2P3ZA 4NNXB 4ZW6A 3BAXA 5FGBA 4RLIA 3D6NA 4UQ3B 5IJDC 5IM51 4Q58C 2BNJA 5ABFB 1LM1A 3MUIA 2Q86B 2FO1A 1FHLA 4G2AA 4ZXBB 3BPLB 1T2XA 1H9DA 5F3FA 2OJ1A 1XT5A 3TYFB 1NCAH 3L16A 3SE3C 2GBTA 1JDAA 4NSKA 2PTZA 4DK6A 3BOFA 2CJTA 4MNJA 1CNVA 1TSRA 1J8KA 4D9QD 4JTEA 5KSVB 3CN0A 4ODXA 2EXSA 1GOOA 2X1PA 1EJRC 2O4EA 4YH6A 4YX2L 3WFAA 5M2FX 2IOMA 3NR0A 4GO6B 1AD0B 4JRXE 2NY4C 1NCTA 1UC4A 4KRLB 1V7XA 3MUAA 4JDTH 3AI0A 4P5TB 4HOZA 3NTYA 2N01B 4CDHA 3EYOB 4FABL 3WQ5A 1IWPA 3SY5A 4F8OA 1RUSA 3KXFB 2ZKXA 3KWVA 5DJ8A 4GP8B 2I16A 1T5WB 3UJ2A 2KDGA 2ZFAA 1JP5A 4FG2A 2PTYA 1PLBA 4PIRF 4U2YA 1ONEA 3TVMA 3NOYA 1S5IL 1S5TA 4NN7C 1FHDA 1JG9A 2OMYB 3JZUA 4XNMA 1ZPLA 1JZ2A 4GYPA 1KGCE 1VFAA 2VQTA 3B8UA 4LUTB 3FT4B 3LKNA 2DOCA 3MJ9L 1A6TA 1PL3A 2FQEA 3TWCH 4HIPA 3VI3E 4MNHB 4F7TB 4BCZA 2QHRH 3NA8A 5D2WA 1FBIL 3T77B 1BSIA 3G2GA 5E8NB 3SQBB 1UT9A 1S5HB 1THAA 4OUEA 1GJIA 2Q6WA 3L48A 1MHHA 2WJ5A 2F74A 1K2DA 2RACA 4BFNA 3UVIA 5C09A 4K37A 5BW7C 3PBWA 3WJZA 3V6BR 1CYGA 4LLQA 4O18A 1Q4NX 1FCVA 2QL1A 1KNWA 4OZGF 3KP1A 1WG3A 5T3ZE 4HAKA 1HJUA 4LSPL 1IGYA 3UGRA 4NZCA 4PULA 4Y19D 4DP1X 2J1XA 2W27A 4ZD3L 3WBWA 4M6VA 1T03L 3G5WA 3WE1A 4UNTA 1PZ5A 3HG1B 3K4DA 3FKRA 5BOOA 3QXUA 2ISFA 3QNYA 4BDVB 2CG0A 3R0KA 2CLZB 3CUFA 2XICA 2V8MA 5CP3H 3ZWTA 4WZHA 3LPGA 4BFIA 1Z8AA 3KBSA 5T5FL 2WLMA 4NL1A 2EQDA 3W87A 5HJGA 2BFVH 3D3VA 2J8FA 1HYSD 1BFOA 1NGWA 3FFSA 2XYCA 4YUEH 4EDWH 4JTHA 5IB2B 2BP0B 1O6VA 3EGDB 1HG3A 2C3ZA 2BXZA 2XNAA 3TK7A 4AMAA 3OJ2C 4HUUB 3BPNB 2J8UB 2GK2A 3WQOA 1VFFA 1MNNA 5ENLA 1MJJA 5IF0B 4JTCA 1E27B 1L3NA 4M7LL 3AG2B 2A5UA 1KYFA 3RDKA 3VXSB 4ICCX 2YO3A 1AO7B 3D69B 1DVFA 2GPTA 3F7VB 4RNHA 2A3TA 3W76A 3WKNA 2GUUA 4C1NA 4OCXL 5AB2A 3NJVA 3W24A 3FXYA 1MEXH 4ZUSA 4GQQA 2RFXB 3B37A 4XCYA 3W70A 2CR6A 1KTNA 3ZLQC 4HUKB 1WBZA 3CL8A 5D2NA 1RY7B 4C4KO 4PBFA 2XWDA 1QNZH 4R2GC 1TFHA 2D2OA 1MMUA 5K4ZA 1OM3L 5G2WA 5L4MA 2BLEA 3EYQD 4WKFA 4I13B 5GRYA 3NWRA 4OSUL 2DD8L 4IMGA 3GMLB 2FZBA 4MSSA 4NWTL 3DUSB 3VAEA 3CQHA 1B0RA 2V9UA 3BPCB 4PGEB 3ZHNA 1THCA 3KWTA 2YPLD 5DTFA 3L3KB 4QHNB 5JW5A 4LK4A 1JWUA 3L4UA 3E38A 3WEOA 3PL6A 2VLLB 1LP9E 1H3PL 2DPEA 3CL7A 4HK0B 2O26U 5IW1A 4F0LA 3HHSB 3PIQA 3O3AB 1ESWA 4EI0A 4UIKL 3H3PH 4M48L 5BZZA 4Z7UB 1KXQE 3MYPA 4K71C 3OA3A 1XVSA 2YX0A 3WQFA 3O2WH 4DP9X 2GGEA 1U92B 3M17A 1JFQH 3H54A 2NZLA 4X6DE 4I5BB 1CK0H 3W0KA 1VC4A 5DVNA 3UBXI 2I17A 4OHQA 2OMXB 4IWWA 4AQAA 3GH7A 4TXEA 4CSZA 1NPNA 1KRMA 5E99L 3O6MH 3H2CA 3V4PB 3MACL 1HWWA 3VAVA 3OAYK 4ZSTA 1KTJA 3ME0B 4DN3H 5E6UB 5I19L 3VOJA 3P11L 3A9IA 5F44A 1IL1A 1MWAB 3MRCA 3QDJA 4IMEA 1WAAA 2CIKA 1A02N 3K2IA 2VDOH 3ARGB 1HFUA 1P6CA 3TIDB 5FGRA 1TZ7A 4U1NB 4XVSL 3B6SA 2X1IA 3CH9A 1X44A 4ZT1A 4TSCH 1JCJA 4I9TA 3KBHE 2GTZB 4RNLA 1K8CA 5A95A 1WISA 4N8VG 1U8QB 4YDVB 3T44A 2C71A 4J8RB 3CN2A 1FPTL 4LH8A 1ZSDB 4PBGA 2ZC1A 5ANME 1PKMA 1IR2A 3G5VA 1RUKH 3V18A 3SO3B 2KZ1B 3P9MB 4FQJL 3FQRA 4ZTXA 4P0DA 5HNNA 2N4IA 4KNTA 1M7DA 2VP8A 2D7PA 3Q2CA 1GS6X 4PUJA 4J5VA 4MFEA 5SV3A 2LV4A 3MLPA 3LNHA 5CBIA 5F1IB 4EBQL 2DRUA 4A2GA 4NJGA 3A6OA 1DKWA 5T1MB 3ICJA 3RFRA 2ZCLL 5HBBA 2BS9A 4X9GA 3O6KH 4N0RA 3LRLA 3XINA 3IRZA 3L6FB 1JVKA 5F88B 3GMRB 3S37L 1A9BA 1KB5L 4WZ9A 1C7SA 4GQPH 3PFRA 1J8HD 1REIA 2ZQ0A 1MUMA 5I1HH 3KPRA 1VBHA 4WV1B 3DFQA 1IIIA 1N5AA 4IIQA 4J3XA 2ODOA 4E3VA 1R24B 4Y9PA 2HS6A 1ZBCA 3LV3A 4A21A 4CN6A 3QWOA 5SWSA 3W1UA 1BKHA 2P0IA 2REQB 4XP6L 4DVRH 3BZJA 1QA9A 5IDIA 3PY2A 4NBYB 4JRWA 4V1DD 3M45A 4A2MA 2Y2TA 3SDYH 5BRQA 1UURA 1DN2A 4XZUA 3K6SB 4BXVA 2VABB 1MO0A 1OC6A 1ZVSB 5TTRA 2DWTA 1Q94A 1UC6A 4ISVB 2ZOTA 2PU1A 3MCG1 3QQXA 1A7RL 1K6AA 5CS7A 3SBPA 1HCVA 3GF8A 5HMDA 3L3IA 3G6AA 3LCFA 4P2OC 4DWSC 2I57A 3R8HA 4IBQA 3PWUA 2V2DA 1JYWA 1QZNA 5KJRL 4ELDA 1S5VA 2PI6A 3HKZA 4PMUA 4AFYA 4PJHF 1P4IH 4AQ1C 2Y85A 2EILB 2EUZA 1PU4A 3W23A 5DDHA 3NIDE 4DY1A 4QXGH 1A3RL 1ZLPA 2X53A 1IM3D 5I18L 1DZBA 3BUBA 1NWUA 3EX3A 4QSHA 1F6AA 5I0VA 1OYAA 2EPNA 2E0PA 2ITEA 3KTCA 4LNYA 3PPEA 1A6WL 1BYOA 4S39A 5FO9A 4B9FA 4J1UA 3HF3A 1V8HA 2WMGA 3DFNA 1R3TA 2ZXBA 4NDMB 3XIMA 4NERA 3K3QA 1ITXA 3HOJA 4E9TA 4JICA 1OIMA 4NNAA 3TA3A 2FYYA 4PLKD 1I8LA 1XRSA 3G3LA 1EBPA 1PZSA 2F5AH 3KNBB 2EDTA 1V3MA 4IGHA 5T3XL 3QV6A 3AM8C 3UTSD 3WY3A 3MRHB 3CSFA 1N3NA 3AZSA 3AGWA 4D9RE 4M61B 1LOHA 1N2RA 4JHOA 3OX8B 4LOVA 2UZYA 2ACUA 5E9NA 3S2MA 2YRZA 1OAYH 3OOQA 4U7KA 4D8PA 1AQFA 5B7EA 3L1OL 4HWEH 2DIJA 3WFDH 4OZFG 1UD2A 4M1GH 5CIPB 1D7FA 1H8SA 1CECA 2B7QA 4GI6A 3RUGA 3A6CL 1NOFA 4AYBA 4A2FA 1XLLA 4AIZB 1BBJA 1IT9L 3TN0C 5JNYA 1VFMA 1KWGA 4Z7QE 4O8AA 2GYSA 1DWJM 3THAA 2WMHA 1D7CA 3GZQA 1FNHA 4WJG3 1XXFC 4L37A 3OYZA 2VI0A 4BKNA 4OFYD 3IJHA 5SWQA 2YSSA 5JLZA 1W31A 1QSEA 1B1YA 3QWQB 3VD3A 1GJPA 3DVIA 1OAQH 4M43H 4LLUB 1JRHI 3CU7A 2ITDA 3RHWF 1KKOA 1A7PH 5M94B 1I82A 3UOAB 4F7PA 3PHAA 4AUJA 1FAIL 4HTYA 1CI5A 2VLJD 4P5RA 4YXHL 1W0WA 3LZ5A 3EFDL 2EVGA 1AGDB 4LYRA 3W81A 1A5OC 4HJFA 1PAZA 4WUUD 2R0LL 3GKZA 4JZNA 4E0CA 2RCSL 3CUGA 1MFCL 5MENE 1QO3A 1ZLEA 3HN8A 3BC9A 3W9EB 4R4ND 4D6HA 2OPJA 4XMTA 3S9IA 1GVOA 2ZXCA 2JTDA 2WLKA 3GDCA 1N4XL 4GQRA 4X5WB 2QGHA 3T4YA 4ZXBD 1M71A 4KZ0A 3WXVH 2HVBA 4LB3A 2VLKB 3K1DA 2HRLA 3MRJA 2OMWB 3L23A 3RFAA 1D9KA 4O14A 4U1HB 1T7ZA 1GRWA 1A6ZA 4NNCA 4R7OA 2AJYH 2P26A 3IKCA 2AZAA 4JN1L 3TW7A 3QXBA 2ATKA 1UD5A 5KZMA 2K1MA 1KNOB 1NWOA 4LSSL 4OT7A 1MFMA 2J8UF 2C3WA 1TTFA 4JIIX 4FABH 3HUJE 2Y2YA 3QNXA 1KV7A 4XN4A 3GR7A 1ZBWA 3HVNA 4DYJA 3MV01 2AEOA 1X7QA 4P5TD 1E5BA 1X6UA 2PDXA 2E3VA 3DX6A 2DZBA 1KYDA 5MKGB 4JN2B 4CKVX 5EUOE 3K2UH 4J2XA 1F97A 2D3NA 2NX5A 2A3CA 5A8GA 1MFNA 3HPFA 1EKOA 1BD0A 3KXFD 5AKVA 4RCXA 5FYJU 3DOSA 5IVOA 3HMJG 2O56A 1GK8A 1JGUL 1RJOA 2XRAH 4J6RH 3H4XA 3I6TA 3ASOB 5E9XA 4AK1A 2Q0ZX 1JYNA 1X5GA 1OFDA 1OPGH 2YC1A 1RJYB 3C86A 3OKOA 4CC0A 1UTDA 1FBIH 4PB0H 4AY1A 1EDHA 1UATA 3F7JA 4JPQA 4E9LA 5D4IA 4HFUH 3V36A 4LEFA 3ZO0A 4WJ5A 2A74A 1OF8A 2QDDA 5EU5A 3NG3A 3LBOA 1MJ7L 4BF5A 2NXYC 1OY0A 3S6OA 4OZHE 4HJ0C 4XO5A 2VOMA 5DJ2B 4BTXA 4EP8C 1XIDA 1MH5B 4MIMA 3S5SA 2PP3A 3VSTA 3QZWG 2BIPA 4NX0A 4AXWB 4NZJA 3WUWA 3K81A 3GXPA 5DD6B 3R1GH 1XRVA 4M5SA 1CDUA 1ZV9A 2JKSA 5BOEA 2HT3D 4KJWC 3MBFA 4YL9A 4M93B 5CKAA 3RX9A 3PXJA 5J06A 4GYKA 4LNVA 5DC9B 3P40A 4K7PX 2QCGA 2QJJA 2VM9A 1LROA 5E1IA 4N9CA 3HG1D 5JA8B 1SJMA 1YEGH 3PNRB 3SJ3A 5I16B 5IBTL 5ESVB 2V2XA 4E2OA 4IIGA 5HDBE 1F4WH 5JR1L 4K38A 3AB0C 3K71A 3ABLB 1Y1UA 4IRSC 1SBSH 4BFFA 1UPPA 4W4OC 3GFYA 5KVEH 1FL3A 3GXIA 5AW3B 3U1SL 5E7BA 3S46A 5LNUA 1CFMA 4WENB 4V2BA 4UNKA 3LH8A 3Q45A 2ALRA 3NXLA 1B31A 1I0BA 3N6JA 3C2FA 4JHBA 1UOKA 3CYJA 2P8MB 2R8SL 1JPDX 3G3DA 4L9LC 5IJBC 3AGVA 4AWEA 3VXSD 4QLLA 1AO7D 5CLTA 4HDIB 1QAPA 1T22A 1R9ZA 1EYEA 5AZ1A 2DQXA 5LQBL 1SGJA 3W0WE 2XN2A 1OZTG 5HJ3B 2CDFB 5KYUA 5FA4B 4OLVH 3TR2A 3PWJA 4AYFB 2NWSA 3EAKA 1QSVA 1WQVT 1A4LA 3U6RB 3H70A 4MJJA 2ZVIA 5G5DB 1RMFL 2HZGA 5BO0D 4APQB 2OX5B 1LEGA 1TNMA 1CT8A 2QQLL 5FGBC 3BD4A 4AENB 2WVTA 2YB1A 2OK0L 5HHXH 2JB6A 2SFPA 1XGRA 1PZ0A 3OZ9L 1X1OA 3W02A 1EA9C 1R1CA 4QOKE 1PWMA 1BQLL 1JV2B 5AAPA 3LQAL 4ML4A 4GABA 3REWA 1WVZA 4E4UA 5HPMA 3T09A 2AQ3A 1FWCC 5HDQH 4R97B 4ZOBA 1SFLA 4JO4L 5B80A 4WHTB 3LZFH 3N9HA 2WAQA 4PJAB 4OOZA 1P1MA 1TPUA 5CEYB 3W07A 1EH9A 4ZZFA 4WOQA 4RMWA 4P4KB 2Z7WA 4QG8A 3GTNA 2KPWA 2ADIA 4YXLH 4PJFE 3W1PA 3IRCA 2EJ1A 4GSXA 4OD2B 3HA0A 4OGAD 2W3ZA 3M1BB 5CHNB 2PS2A 5I75B 3D3IA 2Z8RA 4KO7A 2LLNA 3SKMA 5ECJE 3CNYA 4V2XA 1X96A 1PBGA 2UVFA 1F2JA 2OZ4A 2XFGB 3TVMC 5D9SB 3RVUC 3V0HA 2DBLH 3W7MA 4UIOA 4GYPC 1B0GB 1NGZB 1WGOA 1IZJA 1DQDH 3ARGD 1MAKA 7REQB 1TPFA 3BAIA 3OWRA 1NM4A 1X5JA 4AMKL 2DY3A 4EWND 1FHGA 25C8H 2DQGL 3LIZA 1U8KA 1PHQA 4Q8VA 4Q6IA 1MCPH 4NZRL 2FGLA 5E6RB 3ILEA 2X4SA 4IS6A 3R7QA 4UYPA 1UM4H 1KBGL 3IETA 4FQJH 3QEUB 3EJQA 5AC8A 1G1KA 5I30L 5ADOH 1O95A 4UT6A 3NXFA 1NU5A 4OQVA 3U5UA 3MVTA 3MREB 4A35A 2ZF8A 3BN9C 4WI8A 4A63A 3ZSTA 3RWFB 5L8JB 1W1B1 1Z2KA 3N9KA 3NIFB 1RPUA 1P6WA 2Z8VC 1IC0A 5D55A 1WIPA 1KTCA 1I1WA 1B3JA 4IHCA 2JNZA 4N28A 1UMYA 2RD0A 1F3TA 1RZKL 4LSTL 2XQBH 4XUYA 4IRJB 1RJQA 3ZGIA 1KB5H 1QCWA 5C0ND 4ZMAT 1NFDE 3VXRB 4UFLA 4NRZA 2AMGA 2QBWA 2Z92A 3V7AE 3DI2B 2ADAA 2QVNA 2O5XL 4PBXA 5D1ZB 1KRBC 3CZFB 3PUCA 5F4SA 1FWXA 3CVIH 3NCBB 1MI5E 3DBPA 4XP6H 4WHYG 1QPNA 3UXLA 3SKUD 3LCWA 3BEWA 4BHYA 2Y06L 2WBWB 3ARVA 5C08A 3SKOB 3AREB 2IWEA 4Q3MA 3QTGA 2WP3O 5AB0A 1KM2A 4APXB 5EBGA 1ZJBA 4POYA 5J5RA 2A9NL 3GIQA 3VSVA 1DIDA 1DVFC 4BSWA 1ZE3C 4KNSA 2FPYA 3VE0B 4UDTB 4Z7NB 3S1WA 4OE7A 2OCJA 1IX2A 3T6XA 4RX0A 3QUHA 5E1AA 1G7JB 1JZGA 3D30A 1QPPA 4XWGL 3HMWL 2XIMA 2YGYA 1A3RH 5D2NC 2X41A 2UUDK 1HHKB 2DLEA 3C61A 4EI5A 3M07A 1Y0LB 2BX7A 4IKIA 1TKWA 2PP0A 4QM1A 4C57C 3ATBA 4XB3A 1J0KA 5DURB 3OHIA 4HA4A 4YAQB 1BWWA 1X5LA 3IFPB 5A6IA 4C6JA 4PRIA 3CQIA 5EKYA 2X2HA 1ED3B 3MXWH 2DVUA 4N25A 3ISWA 3GMQB 2XZ9A 5FM5M 3P9WB 1DVYA 1GMIA 3LJ3A 3ATEA 4JTTA 2HT2C 3PL6C 8FABB 2Y22A 1UXSB 2WZAA 4B3KA 5GISH 4MNMA 3EKZA 1E6OH 5FAJA 4PJXB 3CFEA 3N55A 3CN1A 2P1FA 2VMCA 4FXGB 4PV1C 1LUCA 2J25A 1ITBB 1QVOB 3H55A 3SJVA 1DQWA 2WMJA 1XLMA 3T9PA 2OMBA 2NY5H 4AF0B 4HEMA 1FCUA 1QABA 2YBVA 4C6QA 5CWSB 1U8OB 4XCNA 1OCZB 2FWLB 4TQEH 4OECA 2IH3B 2OX1A 4GQZA 4WGHA 4BFOA 4L1SA 4H2HA 4V28A 2PRLA 2BVQB 5F7KC 4S3JA 1ONXA 5DZPA 3WFHB 3MUXA 4AZ8B 4UBPC 3ZE0E 3NM1A 2C9QA 4FAAB 4JFVA 4U7MA 2JCCA 1X4YA 3TWCL 1FXQA 3TTOA 1TV5A 2YXOA 2QHRL 4Z3TA 3FOLB 1TWIA 1UUSA 4N1HB 1YBQB 1U8PA 3MYOA 1JCXA 4WWKA 3G1SA 2J56A 1H6UA 4IOFD 1JWSA 1SHMA 1J8VA 4Y2OA 4DQOH 1J5IA 1Z5YD 3W25A 3ZFHA 4ZZKA 3W7TA 3CO4A 5A6KA 4J3ZA 4FHBD 2GDVA 5BCAA 4XP1L 4P7QA 4BZEA 1TTJA 1NMAH 1DCEA 3TJXA 2A3LA 2P8BA 3E0VA 1PCXA 2AK4B 2AXWA 4MX7A 4HC1H 2R24A 1AGCA 4E5XA 4JFOB 4E8DA 1RXLA 1RCXB 4LY8A 1GKPA 1PD0A 2VDPH 1T4WA 3LY6A 3ISIX 1HTYA 1BM7A 4RGNB 2C16A 4GI4A 2AXFA 4XMWA 4IZGA 4AU0A 1GYUA 2XISA 5I8OH 3H2WA 4I7WA 2V5RA 1RLWA 4JKLA 1SZNA 3QZNA 3N6QA 1WOAA 2MOGA 4XGZA 1S5NA 1CEOA 1EF2A 2XGBA 1PYMA 1Y0EA 4LCCB 5B21A 1BD2A 2BFVL 3D12B 4KI5E 2K8QA 4N0UE 3TESA 1N6QH 2D2JA 4YUEL 4PGZA 5DK2B 4EDWL 3EDEA 4K94H 4NX5A 4L0ZA 1V10A 2VLKD 4LC8A 2R2BB 4HYVA 3IS0X 2HUHA 4D0BB 3UJJL 3ZIMA 4HUVA 4HUWA 2BVEA 5T9BG 3TWBA 4CQ9A 4OKDA 5EIQA 4IIQC 5ETUA 3IS1X 4EI6B 1LM8V 1KSRA 1CE6A 4B9IA 3R06A 3AXKA 4E2DA 2P47B 2ZKYA 1TJXA 3BT2H 4QLJA 3HURA 4BZ2A 5FUZH 3Q2VA 3S48A 1VBGA 3QOKA 3LPOA 5GGQL 2HNHA 3SPCA 2AV1A 2NZ9D 1GGUA 2CG9X 1BAGA 4A3UA 1MEXL 3MLXH 1RVKA 3FOMB 5CH9A 1VENA 1NWRA 1M57B 3L7EA 4PJGB 1WAUA 2X0WA 4LEOA 1K4DA 3VFUA 3NFSH 4L6HA 2M1KA 4LUSB 1PTAA 1QNZL 3EYVB 4MQ7A 1ZJHA 4NYYA 3CUZA 4S3FA 3RL2A 1NEUA 3BX7C 3B4NA 3F5WA 5F7MC 5K9QG 1H7OA 1N19A 4DBDA 5E5MA 1AXTH 3DG6A 3B83A 3OMZA 1AZ1A 3MGTB 1TA3B 3DUHA 2NY0B 5DJ0B 2NOYA 4PJDB 1FZMB 3TDFA 4PLOB 3D0VB 3RKDD 2B4GA 3BHBB 4PMOA 5FEPA 3SGDH 4B5EA 1OADA 1VFSA 3CWHA 1NC4B 4JIPA 3WE6B 2DDQH 3WNJA 4LESA 5JW4N 4WK9A 4W9JC 1DBJH 3WA3A 2EIMB 3VIKA 4K35A 4X42A 4HIHA 5DLLA 3VSMA 4GKSA 3FXGA 4ES4A 3DI1A 5C54A 2HLFC 2OZ0A 2K6ZA 3NIGE 4Y1TA 3H3PL 3UJEA 2YA2A 3QJSB 3TA3C 1I8LC 1G7PB 4ZDHA 4DP6X 4AQEA 3MJ7A 1WV2A 1NSVA 1MCWW 3O2WL 3RZCA 1I9EA 4U4MA 5CR1A 2NUTA 1HC1A 4QRUA 1JFQL 5FR3A 4WI5A 1G9EA 1CK0L 1LNUB 4IIHA 3QV9A 1QUMA 4HZLB 1F8IA 3N2TA 1OKEA 1V3IA 3U2ZA 2YN3A 3SCRA 3O6ML 2YRBA 3QDGE 1YPZA 5D7KD 2QZQA 4DN3L 2H45A 4TMPA 1U8HB 9XIAA 3EX6A 5K33A 1INQA 1LE5A 1GOXA 1E43A 2IPUK 2VUYA 4LP4A 4MQTB 2EDMA 2DFAA 1UI8A 3C56A 2LFGA 4YLBA 1UWUA 5HGBB 2VDOL 3V6FA 5GGSB 1AXSB 1CTOA 4XNXL 5DMGD 2GGJA 2XA8H 2CC0A 2VELA 2EIKB 4BZ1A 5ID1A 5ITFB 4FLHA 1DPMA 3KJ4C 2APVA 5F6HJ 4TSCL 1OHZA 3RFZB 3TOYA 3NJKA 3ISRA 2YD1A 4MA1C 3U9PH 1Z89A 4G7QB 2EE9A 4MKTA 2NY6B 3IVSA 1URLA 1A53A 4HH8A 5KTEH 1RUKL 5E2VH 5CP7A 4JDBA 4B2DD 4WFGD 1AD9B 5ENWA 3HZKB 2Y8KA 2X30A 1R3LA 5CC7A 3P4LA 1O1HA 3S8GB 3HRZA 3QQNA 1JZJA 1J05A 4JFFE 2RDTA 1FN4A 4FL4C 3UGEA 3NABH 4HIEB 3NIFF 1QI4A 1T3FA 3ARDB 3S4AA 1RJLB 3OGSA 4ZL1A 2J20A 3WK3A 1B4LA 3VOIA 3DBNA 4URIA 3O6KL 3GJEA 3L9CA 3U30C 2FR4B 3DHUA 1FVEA 5EBWB 3CFDB 1R9XA 2A9CA 2HFGH 4WFHE 1FNEB 1IEIA 4YDJB 4M6AA 2QF8A 1CX9A 3TE9A 1GOGA 1NJ9B 4JKPL 4HETA 3VVWA 1AD4A 2D3VA 2VITA 4RZ6A 3VOHA 1DO6A 4JY6B 1FO0A 1C7TA 4PTUA 2FGWH 3FU7B 1D9KC 5JIIA 3RNQB 4PJ5E 3MLYH 1N9PA 2WGXA 3MNZB 1E5JA 1R5WA 1XHHA 4DVRL 1TT6A 1BXNA 5C07E 2V2TB 1HM2A 1VP5A 3NURA 1LLZA 3SDYL 4FQ2H 3K5SA 2X4TB 1Z9MA 2NQ9A 3AISA 3G9VA 5SX5K 5A2KH 4ZUTB 4P4KD 1S3RA 5TQLA 3T0CA 2AJZA 3DECA 2ZA2A 4PRDB 4S3AA 3QZEA 4FIQA 3VH8G 3HPJB 4C4BA 4ZB5A 3K2MC 1ET8A 3D47A 1P4LA 3K6FA 2DLTA 4RQQB 1K9FA 2FX8H 1RK1A 2H41A 2R0WH 5FYKH 5KBMA 3FDWA 3NEHA 4OVVA 4FMVA 4G6AC 1LZOA 3L68A 4Z7NF 5D1ZI 2J1WA 4R96A 3KDNA 1XCTB 1TZ9A 4AKOA 4QXGL 5HI3C 1M9WA 3AG1B 3N2JA 5TAOA 3UPRB 2WZ5A 3PWLA 1SXAA 4MMZB 1KGIA 3MQTA 1WGVA 2YZRA 2WLYA 1JXKA 4AKPA 5F2FA 1OT1A 1DANT 2A74C 1H5BB 4F15B 3JWNC 3O4LB 2YJLA 3TIMA 4HKXB 2HRWA 1JZ7A 4XBPA 4E9WA 4KKAC 4PPTA 3GKAA 3UJTH 2F5AL 1KJ3H 4YTRA 5A16A 1ZLSH 3PG2A 5GRUL 3TX4A 2JKEA 5FYKE 5IVZA 3BWAB 2EP6A 2X0UA 4JS7A 4UF7C 4YS1A 2HVKB 4PG2A 4AGOA 4Y4KA 4J4PD 4K4KA 2V8LA 3IU3B 1OAYL 3V0UA 3O3EA 1YDPA 3NPSC 1NOUA 2EE2A 1AQ8A 4XO3A 4X6CE 4HWEL 3R6IA 4PJXF 1M2VA 3WFDL 3GIPA 3WJXA 3DVGA 1F00I 4M1GL 1BRLA 3P54A 3QIWB 1KRCC 2W62A 1GTEA 3MO1A 4KTEH 1TWSA 1EPXA 5HVGB 3X1BA 4ZMNA 1EJTC 4AKQA 1I8IA 2HCZX 4IRJD 4EANA 3MYJA 1AHWB 2EXWC 5JZ7C 4NJ9H 2FJKA 2J47A 1T7XA 3VXRD 3FU8A 1PX8A 3O45A 3UZQB 4F2EA 2IPKB 4UQDA 5F8QC 5D1ZD 1XIFA 3TJEH 4G3YH 2XSKA 4YHEA 4MMHA 3F2BA 3T4AB 5IR1A 5EHFA 4RIRA 4NKMA 5EBUA 1OAQL 4M43L 2V7NB 1A7PL 3ARED 3DO4A 3GS0A 3W27A 1HF6A 1OCJA 3FFDB 3ZDYE 3JV5A 4KT2A 3CVHH 3GG8A 2QS8A 3E6HA 3T0EE 3SSGA 3AYSA 4NJKA 1EFXB 2G2NA 3D09A 3DO3A 4MNQA 2R14A 3JT2A 4ERAA 1K5NA 1P0BA 2VL5B 2JQMA 5EEUA 2DPKA 3WKZA 4N6RB 5DT5A 3H3KA 5DFAA 1YMHA 1I1YB 1UJ3B 3BUPA 3UDWC 3NVTA 3E3HA 2VDQB 1M2OA 1NCNA 1NWSA 1RHCA 3VXMB 2FNBA 4P2AA 4G8GE 3TEZA 1KCVH 4TL4A 4PRAA 2CLMA 5CEZH 2H1LM 1OIOA 3M0LA 3LN9A 4TSAH 2Y6SC 1DP0A 1E8YA 2P8LB 4JFYB 1UM5H 3DX9A 3IPFA 4MM1A 3WXVL 5DURD 3ZKXC 3V6OE 5EZJB 1ZS2A 3D25B 3ZTJG 3INOA 1GHSA 5G1YA 3PWAA 3SGEH 4JQIH 2HE5A 2AJYL 1CVSC 2D1ZA 4JFDB 4I7UA 4WRLA 5FJTA 4HUXB 1O94A 3N1MC 4X7SH 5SV4A 4NENA 4ZQKB 2LW3A 2Y7MA 3WLQA 2GSHA 5IMOB 1KIPA 1Z1WA 1NAMH 5CNHA 4XT1C 1SXSA 5E70A 1W8NA 4JG5A 1EZVY 1ES0B 1AIFB 2HXAA 4DIXA 1JZ4A 1ETZA 3SCWA 5F1NA 2WWDA 2XN9E 4IBSA 3QSTA 2Z0IA 3S1XA 4ZX6A 3AJXA 5D8JH 4N9OB 4XWOD 4PUWA 2QELA 3EYUH 3N4FA 2IH1A 2BNUA 5T3ZH 5CEZE 3TXVA 1JXFA 2ZRXA 2Y7DA 5INDA 3K2UL 4I85A 4I1RA 4XKYB 4AX7A 4ZQOA 2FKPA 3POHA 5HAOA 2OR9H 4XH2B 1PKNA 4PJGF 1NBYB 2F6AA 2XRAL 1XF2A 4JQVA 4PMRA 4J6RL 5DS1A 2OXHB 4FS9A 4YK4B 1J2WA 3TBYA 2Z1SA 1OPGL 4JZJB 5T1LA 4J3SA 5FYJE 3N29A 2D8KA 4KKLC 5JH1A 4PB0L 3MRDB 4HFUL 4WX2A 3I75B 4KH9A 3WDIA 2QW5A 1X3DA 1E28B 3WLBB 4YXKH 5D03A 3RQ3A 3VB8A 5E00B 2YAHA 2VDMB 9RUBA 2K3HA 3LPFA 2Q01A 4XP1H 5CXPA 3IKKA 4PVMA 3QHTC 5CZSA 4W8LA 4WCYH 2HVNA 4Q6IC 3ERPA 1MQRA 4KKRA 5TQ0H 4Q6KA 4JTSA 5BPPA 1T4KA 4X2RA 3VUSA 4MA3B 3R1GL 3NP3A 2AK4D 3ARBA 2QJNA 1T5XA 1UOWA 4QRRB 1DQIA 3JTTB 4GSDH 3LVTA 3ILPA 4M81A 5CR8A 2F54B 4OIAA 1JNHA 1TITA 3BV4A 2Y1YA 4FNRA 1O60A 5GZOA 1VEOA 1POJA 1TENA 4RGND 2HRHA 5IQ9A 2IJ0C 2CLKA 4HWZB 3S2JA 3GUWA 2R1YB 4Z7OE 1YEGL 4P5KA 2L0DA 4IMDA 2DMKA 1B4TA 1YQVH 5HD8C 4NZ5A 5MERA 2PD5A 2CEQA 2PLKA 2IKIA 4N7QA 1ZT7B 5CJNA 1F4WL 3TLRA 4FQPA 3TN4A 2FSEA 4F7EA 2BP1A 3UJJH 3ES6A 1X7TA 1AJ2A 4J35A 1SBSL 5DK0A 2XSXA 4DP7X 4FZEH 5KVEL 1E2ZA 2YPVA 4LAOA 3ITGA 4XZWA 3RGBA 4JFQB 5H94A 4PRPA 4O02L 3BH8A 4FZ8H 1N7KA 5DMKB 4GG6E 3UWUA 2PYEB 4DSYA 4GJ1A 3VWKA 1I2NA 2AMUA 1U93B 1QQDA 2WB5A 4BY3A 3TXZA 5GGQH 3EUDA 1BSLA 2OQLA 2IANB 1XGQB 5E94B 4B53A 4DIAA 4WI4A 3FH8A 1SOSA 4LCWE 4OCSH 4TNWF 6CGTA 1JCLA 2INFA 1FUYA 3ESUF 4W9GC 4KKPA 3CFNA 4OLVL 1BAWA 3DV6B 3WCZA 3CZUB 1ICPA 2BMKB 5C8BB 4OFIA 4NS0A 5E5CA 2OTDA 4QF1A 1F42A 1JTOA 2DDXA 3LQZA 2JIXB 4K39A 1B3ZA 4CQCA 4KKNA