4FNTA

Crystal structure of gh36 alpha-galactosidase agaa a355e d548n from geobacillus stearothermophilus in complex with raffinose
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSNNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 225
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fntA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fntA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fntA02
2ZZ6A 1WV2A 3C52A 4CCEA 2YYTA 2V3EA 3DH7A 3MBDA 1TV8A 2BXYA 3W1MA 3ELFA 4WLCA 4AYGA 1A50A 1MXSA 2WNQA 3W7OA 5LGZA 3FFSA 4NJIA 4X22A 1U83A 1JCLA 1U2YA 2J27A 3NGJA 5HJLA 2B7QA 1UOKA 2CHNA 3GXPA 4QM1A 3CLWA 1SZNA 4JFUA 5MHBA 4B9YA 4BWLA 3RNDA 3BG5A 5I3HA 2F84A 4N02A 5F7UA 4PL2A 4KFOA 3PULA 3LPOA 1PIFA 1WZMA 1DHPA 1PVNA 3NO5A 3M5XA 4FLOA 3DX1A 4OU1A 2TAAA 4GXMA 4GWEA 2A1YA 3EKLA 3PUOA 2GQ8A 3F4WA 1XV8A 3UQNA 3LCLA 2A0NA 1X1ZA 1KXVA 2H3BA 1HL8A 2ZA1A 1MW1A 3W83A 1N55A 2RHGA 3UWZA 4FXRA 4I7WA 3K8KA 3QFEA 2H6RA 3NPXA 1PJ9A 2DU2A 4ORIA 3BK0A 4MYAA 3LHTA 5G4EA 3GDMA 4PEKA 3M7WA 3U6WA 5G2HA 2YA2A 3ZR5A 1KTBA 3HGRA 1XGZA 4W93A 2Y5EA 1AG1O 3L5LA 1VB9A 1QWNA 2CZFA 2E8ZA 2QCMA 2OSYA 3Q2DA 4NX0A 4XQ6A 2ZUWA 1CI1A 3T7VA 3W75A 4H2CA 3P80A 3W2UA 4H4IA 1KXQA 1IXOA 4UQAA 5A2AA 3NDOA 4UXDA 4J28A 3HPSA 5D02A 3QJAA 2YCEA 1LWJA 3BUQA 2YX0A 1KFKA 1VCFA 5HINA 3C2EA 5FESA 4AF0B 3UG5A 3I65A 1TQSA 3DENA 1I2OA 4S1FA 4OGZA 4PFMA 3UY8A 4PCTA 1ZY9A 4CCDA 1JGIA 1HG3A 4ALDA 2GJLA 2VR5A 1TTIA 3RMJA 4J3SA 3S2CA 1OX5A 1VRDA 4L4LA 5LKYA 3GBDA 4XB3A 4PSRA 2E77A 1HUVA 1RPXA 1I2RA 2FPTA 1KGWA 4AWSA 4U2YA 1M7XA 4M7SA 3G3DA 3NOEA 5AFDA 1JJKA 4AHQA 1UD8A 2ZWZA 5BNKA 3HGSA 2BLEA 3JR2A 2A85A 1ZFJA 2B0MA 1Q6RA 3IIZA 4KWVA 3W72A 1ZAHA 1OX4B 3R5EA 2WSYA 1XSJA 4GKLA 1KM0A 3NQ2A 4JTSA 5AHIA 2PRHA 3G1VA 4QNEA 5I3IA 4FX6M 1KWGA 3WNMA 4K37A 3NQ6A 1XCWA 3H53A 1GCYA 2Y24A 1PL9A 2FHFA 2EF9A 2CZDA 4MZ1A 4N2YA 4BI6A 2VT0A 1ZCOA 1DQWA 4LW7A 1QHPA 1GTHA 5CSSA 4LC6A 2E68A 2BY3A 4QNWA 5TBOA 4HIBA 2DORA 1AQMA 3VGHA 3ZOAA 3FJ6A 4DBDA 2WSKA 4LV9A 3PUDA 3WDIA 1SZEA 3Q37A 4LNYA 5D2TA 1SO4A 3G22A 3TCEA 5E70A 3P5ZA 2DZVA 3UG4A 3G0SA 3ZR4A 2EGZA 1EEPA 1L2UA 3P60A 4K8HA 1P5BA 4NNCA 5C55A 2CLKA 3WK2A 2EADA 2A7NA 5F2IA 2OT0A 2V5LA 3W71A 3LB0A 1WP6A 3O6YX 1ADOA 3FAXA 5TD4A 3UG3A 4JL1A 3L2MA 1CX9A 4HSNA 1UD6A 1EPXA 1HTYA 4CGTA 1LLZA 1YPIA 1WYIA 1M53A 2OSXA 4GIAA 4JIPA 4J3UA 1B4EA 4K7YA 3SGZA 1DV7A 2BTMA 1CXIA 4AWTA 3WDHA 3N19B 3K1DA 2VFHA 3EXSA 5DLCA 2V2CA 3FJLA 2FB2A 2V3FA 1KFCA 2YOCA 1GJUA 2G95A 3MHGA 3PBVA 2QJHA 3M5ZA 2WVSA 4GO8A 3NM1A 1HO4A 1XI3A 3VGFA 4UTIA 1SW0A 3BGJA 5J5DA 4TU1A 5LNWA 5FEZA 1WBHA 3DX2A 4HOXA 4EIVA 1LRNA 4BA0A 4YMZA 3CQ0A 4U33A 3NQDA 3LX9A 4R7JA 1VC4A 1W5QA 4N6FA 1TQUA 1HO1A 4JTHA 2P10A 4W9TA 5C54A 2ZTJA 3G1HA 3DC0A 4KMQA 3ZSSA 1EX5A 4LU0A 3TV8A 3W7KA 1H50A 1TTPA 1V5XA 3F1QA 4UR8A 3KVLA 3C6CA 2F7PA 1TIMA 2V2HA 3OLGA 2GQ9A 1NM9A 3BG9A 2C7FA 1G4SA 2C16A 4JTTA 3W86A 4OQVA 3GK0A 4IJBA 1LOSA 3OHIA 3ZFHA 3CZSA 1DL3A 1X7FA 1OG0A 3KL0A 3CU2A 3AJ7A 4RXGA 3PG8A 1K7XA 3TFXA 1MEHA 3TSBA 1YYAA 1GPWA 2EAEA 1P1XA 2ZRXA 1LWHA 1LOQA 4XKYB 1CDGA 2QCLA 4ZQOA 3P81A 1T96A 2WVTA 3KHJA 1B0IA 1XH1A 4N4QA 4GFSA 3CZNA 1J0JA 5FF4A 2ZXBA 3W6YA 5K9XA 1E43A 4FNUA 3DFQA 3PR2A 1L6YA 3N2XA 3O15A 5CPNA 1GQNA 1W0MA 3L65A 1GYLA 3ABQA 1RQEA 1BWLA 3PY2A 1X6UA 4HSOA 4ZQMA 3W1PA 3MP5A 3CPRA 1UB3A 3EJSA 2X2IA 4EVZA 1KA9F 2P1FA 3S5NA 3EDKA 1VYPX 5LZLA 2QR6A 3OVQA 3BCFA 2FTPA 3DXIA 4AEFA 4HKPA 3EJPA 1IIGA 1TTJA 2ZTKA 4AB4A 4Z1DA 1FWNA 4ADSA 3EJTA 1KV5A 7TAAA 3BARA 5I3KA 3EKZA 3A47A 2X16A 4PC8A 5DY2A 1B4KA 3BPWA 5CZTA 4UQCA 1TPFA 1XKYA 3UWYA 3L4TA 3LLDA 8TIMA 3VO0A 3VX0A 2QUVA 4DF0A 3BLBA 3UYCA 3UEQA 1T8XA 2YIHA 2QCNA 1YTEA 3KFTA 4PL1A 4ONVA 1ZJIA 3EWYA 4NUWA 5F4WA 3G3MA 1O5XA 4IQLA 5A2CA 1R2TA 2I14A 1W54A 4JY9A 5FEWA 2WJZA 3P82A 3WELA 1F2JA 3SSJA 1DJNA 2CW6A 3HB9A 5KSWA 1Q6LA 1B2YA 1K02A 5D04C 5HDRA 3TAOA 5DELA 1LZOA 4O11A 4PA8A 2JBMA 1VHNA 2RDWA 2Y7FA 5DCBA 3K30A 1JQXA 1OFDA 3IJ8A 4LXFA 3SR7A 3S0CA 3DX0A 3DX3A 1I45A 4GO9A 2ZZ5A 3ZWSA 3C2RA 1KWKA 4M6QA 4HPJA 2A6LA 2XWDA 2E0PA 1M7PA 2ZX9A 2XN2A 3VNZA 1NOFA 3NAVA 3D51A 4UZUA 4FLSA 7CGTA 1P0NA 1LRQA 1NVMA 4YL2A 2VFEA 3SZ8A 3MI3A 1TQTA 2FE0A 4QSHA 3V1PA 1CW2A 2VEMA 4LC8A 4TMBA 1FDZA 3CWNA 4WXYA 2J6XA 3LXCA 4IUOA 1VCVA 5AYXA 2F7QA 5BRBA 1PIIA 4WUIA 3K8MA 1WXJA 1L0PA 5LNUA 2B7OA 2F61A 3K8LA 2F1BA 3W7DA 3LRMA 1QCWA 3L5MA 3Q94A 3L4VA 4E2OA 4YCPA 1WZAA 1Z41A 3BW3A 3NL5A 2PWDA 5CGQA 2GUUA 1VYSX 3QQ1A 5TQLA 1IGSA 3V75A 4JTGA 2JKEA 1QW9A 3P5YA 2NZLA 4O1CA 4Z08A 3F4NA 1OABA 1Y7VA 1Y0EA 3P67A 4CCCA 2BXZA 3A24A 2FFCA 2ALDA 1R47A 1OFBA 3W2JA 2PURA 4O4VA 3B04A 3P8JA 1JDCA 1CGUA 3DFSA 4QAIA 3EXTA 1R34A 2VELA 4JTFA 3WK0A 1UCWA 1G1YA 3DGRA 2BHUA 1TPDA 5KZEA 1WPCA 1A47A 4H6KA 3TQKA 2EEXA 1OF6A 4NZJA 2WCSA 2B7NA 4AHOA 4MY1A 1SSDA 3QMTA 2G5WA 1XUUA 5D32A 4A22A 3PB0A 3BAJA 3NEVA 3LCFA 1G67A 4NU7A 1GJPA 3BAIA 3VMPA 3M5VA 1A5SA 1HWWA 4UQ9A 3BC9A 2ZUTA 2CZ5A 5FF3A 5A6LA 3MHUA 3W7NA 1S3HA 5DBUA 1J2WA 3ABOA 4NZFA 2BXVA 4Q32A 3TW7A 3WJYA 1ICPA 1G4PA 1L6WA 2CLFA 4OT7A 3NQAA 2XN1A 4LOCA 1SFJA 5BMWA 3W1XA 1GVOA 3W22A 4Z0SA 3NR0A 2NWRA 3L5AA 1XC4A 3PAJA 4O57A 3W88A 4NI3A 4HPHA 1CLVA 2Q3OA 3MUXA 2C14A 3G1FA 4RLIA 2ALWA 1KFBA 1K8XA 2HS6A 3N2MA 3N3MA 1C8QA 1JDDA 1QPKA 5HPOA 3AO0A 3ZQ9A 3WN6A 3TMLA 2FLIA 3BG3A 3ZSTA 1O7DC 1OT1A 3C3NA 1OHLA 3LBMA 1FXPA 1Q3NA 1CYGA 3LPPA 1GEQA 1H7WA 2Y85A 5AN7A 5FI8A 1KGXA 1FDYA 4CQAA 5BOOA 2FIQA 4Y9AA 1FX6A 5H91A 3TUUA 5I0DA 1BLIA 3A23A 1MEWA 5DCDA 7TIMA 2BHZA 3FKKA 2ZZ7A 4R33A 3TAKA 4ORMA 4GE8A 4K39A 2AQWA 2RFGA 1CXKA 4IMEA 4IX0A 1RQHA 1TPH1 1TPEA 2C18A 2PWHA 3ZT7A 1WA3A 2Y62A 4AHPA 1SW3A 2Q3RA 3PWAA 3AXHA 4TVUA 1NF0A 3B4UA 2PRLA 3GTNA 1TCDA 4WXZA 4QISA 1QPRA 2P0OA 5GVJA 2OJPA 3M44A 4N9DA 2XIIA 3NZ1A 4IMFA 1W5PA 4J3TA 4L4MA 3MI2A 1VH7A 3GYEA 5DO8A 1W8SA 3TIMA 5BMXA 3AMKA 1W5NA 4FNRA 1UJPA 4OIFA 5H2ZA 2E6FA 1H1YA 5HUPA 3MYOA 1LBFA 3QMSA 1VQTA 1YTDA 4BZYA 3NYZA 4OV4A 5F2LA 1CXFA 3LCWA 3NM3A 4HNVA 4JR5A 3C2OA 4LV4A 3TQVA 4POCA 3EX3A 3FOKA 2XVLA 2WNZA 1GWJA 4O0KA 4ZVJA 5KZMA 4AVFA 4WOQA 1UH3A 4BK9A 3CWOX 2WPGA 2ZRZA 4UTJA 2ZWYA 2E6AA 1UASA 2V0TA 3L4XA 1TRIA 2CWNA 1XBVA 4GI8A 3P62A 2FGZA 2XIBA 4CLMA 1LRTA 2ZRWA 3CEPA 4UTWC 4O17A 4IXHA 2TPSA 3O07A 2XWEA 1XDMA 2OCZA 1BPLB 1UD3A 4CN1A 1O5KA 4E38A 3GIYA 5KMYA 4Y6GA 1UKQA 3DKLA 4WY0F 3NQCA 3FIGA 4S2BA 1UUMA 2LLEA 2GJPA 3ATZA 3C61A 4J3XA 3W1QA 2O7QA 3PS7A 4LS1A 3TXZA 3LHYA 5G4WA 1CGTA 3LGEA 1AW5A 3MMTA 1SMDA 4O15A 3CZKA 2QCEA 4LUJA 1LM1A 4LT9A 1VFOA 4UOQA 4HP5A 3HO8A 3L4ZA 1NF7A 3HGOA 3PSVA 4RZ6A 5DY3A 3QPYA 3DFTA 5BW6A 1RP8A 4GINA 1KW1A 2YW4A 1FCQA 3KRUA 2J24A 1KFLA 2EACA 3GX9A 3MJYA 3ATYA 1SSGA 3NPWA 5D30A 2A2IA 2I1OA 4IGHA 3STFA 3TJLA 2TYSA 1W3TA 3T40A 3OVRA 3IGUA 3LOTA 5E0KA 5I24A 2XFWA 3ABRA 3UZJA 2F18A 1WAUA 4Z1AA 5AOUA 2X2HA 3DDGA 2HS8A 4D2JA 4YLWA 2WPBA 1TB3A 2QCDA 2QDGA 2BWGA 2Z1BA 2CU0A 1HNYA 2Y4SA 1ONRA 1G5AA 3O1NA 3DKJA 1JAEA 4ADUA 5AC6A 4Y96A 1MVYA 1PV8A 3UXDA 1FCBA 2QUUA 1W9XA 3W38A 2D2OA 3LCIA 3EWZA 1E51A 5EMUA 2AMGA 4JYFA 3B0PA 4HNUA 3LCGA 1F73A 3WJWA 2BY0A 4GI9A 3FYOA 4JIQA 4AH7A 4HNTA 3EX1A 1D9EA 2B7PA 4TMCA 3ZT5A 3KLKA 3M47A 1DORA 3WJZA 3EDEA 3W84A 3DDFA 1GZGA 3M43A 5AC8A 1DOSA 1S46A 2QPUA 1QDSA 1EO7A 4RCXA 3GDTA 3PB2A 1P4CA 4NNBA 5DBTA 4H8UA 4LVDA 4O0ZA 1ODUA 1KLZA 4AEEA 2A6NA 3CZEA 2F2HA 3ZO9A 1H5YA 1XH0A 3BUDA 5HMSA 5CG7A 5D33A 1BVNP 1SUXA 3D52A 3CIXA 4GI6A 4RK8A 4TIMA 4FLRA 5K3VA 4UNLA 3NA8A 4UTKA 1RPKA 1X8FA 1S5WA 1JCJA 4RJEA 5C5YA 1EH9A 1LLWA 5EA9A 2BY2A 2CLOA 2YYUA 4O54A 2JGQA 1JL8A 4UFLA 4LY8A 3TC7A 3DFPA 1OFQA 5LSMA 3DHPA 4UMBA 1SZFA 2E6YA 3SY5A 3WJXA 4NJKA 1JXJA 1PEZA 2NV1A 1QI3A 3M6YA 3BW2A 4JDBA 3LERA 4LVFA 4O1DA 3BUPA 1HTIA 4LUIA 1H3GA 1W56A 1BVZA 1I2NA 1E3ZA 2V5BA 3DFNA 4UTTC 4CN4A 1U30A 3WK1A 4M6VA 4ADTA 1KCLA 1ME7A 1DHKA 4RR4A 3UZ5A 2NT0A 3OG3A 3W1NA 2E4TA 3GVGA 4IMGA 1BSIA 4PODA 2YZRA 1OF8A 3L4WA 2QPSA 3UWUA 3TXVA 3BAYA 1RQBA 4O52A 3I7SA 4OJYA 3WFZA 3HPZA 1H62A 4B5NA 1JQVA 2ZA3A 2GJNA 2DIEA 1AMYA 4ZMGA 3M9YA 3CC1A 4XTDA 4Z0JA 3VSVA 3STGA 1RVGA 1F7BA 1IXPA 1G6CA 4CQ8A 4DF2A 3B0UX 4UTWA 1WBJA 2OSWA 1FWTA 1D3GA 1XFBA 3WK3A 5HXMA 3QM3A 1EP1A 3VGBA 2FB3A 3SECA 4TR9A 5EL1A 4GC4A 3S9YA 3HMJG 1XCFA 5G1YA 3CLMA 3W7GA 5E9AA 4U28A 3D4YA 1ICSA 3KEHA 1PHQA 2X1TA 3BVWA 3W1RA 4JFVA 1UA3A 2C0AA 1NAL1 1OGSA 1K7EA 3EJUA 2Y6ZA 5U4NA 1Z32X 1JCNA 1Z48A 3IJ7A 3GXNA 1KM2A 5I3GA 2BHYA 3TC6A 5A8GA 3QSTA 3LHWA 3PG9A 1OYBA 4UFJA 1QPNA 4WQ6A 4UTHA 3E0IA 3HBLA 1DJQA 3C2FA 3KLLA 5K9DA 1PCKA 3RILA 4A3UA 3BMVA 1J0HA 2C6QA 4JYDA 1SQ7A 3W76A 1VJSA 2Z6IA 1H7PA 3L2IA 3L21A 4IWWA 1PCWA 1CGXA 1R2SA 1MO0A 5F2GA 1GVSA 3SW6A 2FPVA 2VEPA 3EJQA 1XSKA 1LBMA 2E1DA 4A29A 1QO5A 1KXTA 5DFAA 5FEXA 1Q6QA 4LS2A 2DJLA 4IX2A 2ZBTA 4WJEA 2CLEA 2G97A 4MOZA 3UCQA 4FIQA 4FXSA 4PCFA 3W85A 1G69A 4JTUA 1KB3A 2VRKA 3ZT6A 2VEIA 2ZYFA 3OIXA 3LTPA 3E02A 5FF7A 1JUKA 2FDSA 4M6PA 3THAA 2AAMA 1TJRA 3VX1A 2ZZ2A 1KLYA 3QRHA 3UWWA 1ZENA 4YWIA 2WSQA 2A7PA 1H1ZA 4I9AA 1VGAA 3KWXA 3W7MA 2WQPA 2X30A 3W2KA 2ATMA 3PBWA 2JGYA 3A21A 1CPUA 1QI5A 5K2ZA 2YJQA 3VMOA 2ZUUA 1UBSA 1JULA 2A4AA 2C13A 2X1RA 3H54A 3QQ0A 3T4CA 1TPUA 4WX2A 3N14A 1WO2A 2A21A 2C1HA 1YTKA 5F1UA 3QZEA 1QX1A 1F6KA 4LPCA 3HIJA 1FXQA 1WDWA 1KBBA 2OX1A 4GUGA 1DQXA 1MXGA 1PHWA 1WZLA 2E5DA 2F7RA 2FJKA 5I23A 1TMQA 3L0KA 3IVUA 5AHEA 4AMAA 3LRLA 4O4WA 2VENA 3GNDA 3KL3A 1E3XA 1TRDA 2V30A 4H8VA 3TTSA 1KBKA 5D2VA 2NSXA 2QMKA 3W9ZA 5L9FA 5D37A 1AW2A 1XBYA 3EDJA 1QOPA 3W2LA 1QI4A 1ZAJA 4PEEA 3QYQA 3S5OA 1JI2A 2VEKA 2G3NA 3FW6A 3T55A 1C29A 3UXAA 2VC6A 4ZQCA 4UTTA 1SO5A 1SO3A 3NL6A 5HWJA 3BV4A 3W1AA 2B4GA 2DJXA 2YGYA 4ZQPA 1TREA 1XSIA 2Y7GA 4DXVA 3LV6A 4PSPA 5K7JA 4NXKA 2CLHA 3GXDA 1AMKA 2NWSA 3EWXA 3W1UA 1LP6A 3NPVA 4C1LA 2X2JA 1IZKA 4JCLA 3BLFA 3G0XA 2XN0A 1FQ0A 4JTKA 3R8RA 5HQEA 1TO3A 1JUEA 2GQAA 1FCVA 1LDCA 1PS3A 1NFBA 1F76A 1DBTA 1QNVA 1J0IA 3A4AA 4PTNA 3VGGA 3RIKA 1V3JA 1ZHAA 3W7LA 4O14A 1H7OA 4UTMA 1XL9A 3TDFA 1XXXA 3LXAA 2A5HA 1XH2A 3L66A 3E9AA 4CNOA 2H8ZA 1VR6A 4DPQA 4UTUA 3IEBA 3TSMA 3P84A 5KITA 1QW8A 1KFEA 2FQIA 1DTUA 2D0GA 4G1KA 3JS3A 1PIGA 1MSSA 3BLPX 3IVSA 3SJ3A 2Z6JA 2NXHA 3GR7A 2WC7A 3WY1A 2OT1A 4H3DA 3BO9A 2DIJA 3EX6A 4XBSA 1JD7A 3B03A 2V9DA 4JX5A 2ZXAA 3G8EA 1K8YA 3W70A 2CLLA 3TMQA 3I6RA 2WVVA 4AYSA 1THFD 1Q4NX 4DO6A 2OW6A 1T0OA 3M07A 4LRTA 3VSTA 2ZZ1A 3WY4A 3BAKA 3TQ0A 2DZTA 4UR7A 1F5ZA 2EPHA 5D2WA 3BVVA 3STCA 4DELA 4N9CA 4X3ZA 5DN1A 4HPXA 1CGYA 4JYEA 1J0KA 3EEGA 1GVRA 5E0FA 1EWEA 3B06A 4R53A 1KXHA 2ISWA 4QQ3A 3BSGA 2ZX5A 4UUIA 1H61A 3IV3A 2RH9A 2WO5A 1DEDA 3JRKA 3G18A 4JFWA 1LYXA 4RZ5A 4FLQA 2ZA2A 3BUBA 1WE5A 3L0NA 3R2GA 2OYKA 1WQ5A 4DF1A 1FWSA 1ML1A 3W3OA 3E49A 4NXSA 1TV7A 3AXIA 2WCGA 2V3DA 1FUYA 3LDVA 5K9CA 2PRMA 3LCXA 2C15A 1PAMA 1AQHA 3CHVA 4MFDA 1L6SA 4FHAA 2ZDRA 1BEUA 3HG4A 1H60A 1J4EA 3KE0A 2C8NA 3F03K 1JCXA 1UD2A 3DX4A 3U2OA 5EKYA 1W3IA 2VRQA 3VSUA 3TA6A 2ZIDA 3GXIA 1V7YA 3OLEA 1FWRA 4H8HA 2EHHA 3DBPA 1CGWA 3P74A 1LROA 4N9EA 2WSPA 1OFAA 2J9XA 4OHQA 3KOFA 1CIUA 2FH8A 5L6UA 1O94A 1TPVA 1TV5A 3LTSA 1SZGA 4KWWA 1VPXA 1W3NA 3PUEA 2NT1A 2D3NA 4AMWA 1QHOA 1EWDA 2ZRUA 1BWKA 4FNSA 3HOJA 3FA5A 3IIVA 2EAWA 3GDRA 2PWEA 4IMDA 5K4ZA 4CVWA 1AL7A 1FBAA 1IF2A 1CXHA 1C8VA 2QCDB 3G1YA 2FH6A 1MFVA 1GVQA 3B05A 5K4XA 2Y88A 2PC4A 2WNNA 3HF3A 4MIMA 3FEMA 2NXGA 4Q4KA 3TOPA 2IQTA 3LHVA 1F6PA 4IXXA 3GXFA 3U8GA 2VFIA 1FY6A 3ECQA 2EABA 5TIMA 2NX1A 2NXIA 3QMRA 3EWBX 4A21A 4O19A 3TU9A 3LLFA 1ZALA 2JK2A 2EJ1A 3BLEA 1Q6OA 4N6EA 1UA7A 1YADA 3GAKA 3FAWA 2ZUSA 4U3CA 4K8EA 4O28A 2HTMA 2R91A 2E09A 3LI1A 4M7TA 1WX0A 3G24A 2E8YA 4HA1A 1N7KA 1YPFA 5LNSA 4O13A 1K8ZA 2J88A 4BI7A 1YXDA 3OLIA 1I8JA 4RKAA 3L4YA 3W7QA 4WY0A 2VKZG 3EDDA 4IMCA 1JRCA 2RKXA 4UQBA 4JTIA 2NX9A 1OFPA 2WKJA 1WOBA 3PSWA 5F4XA 2QAFA 8CGTA 3C0JA 5AHFA 4JX6A 2AGKA 2D0HA 1HXKA 1JCMP 1PZ2A 1UD4A 1R30A 4AIOA 3UNDA 1IIHA 4DO4A 2GVYA 1X1OA 2ABBA 4YXGA 2V82A 3W1LA 2OMAA 3A5VA 2Y63A 1ME9A 2ZX8A 4DEFA 3CEUA 5KINA 4JD4A 3TR2A 4WD0A 1JI1A 4HHPA 4U4MA 2PWGA 3RF9A 4UQEA 2PWFA 1DVJA 4DPPA 1EB3A 4FNQA 3N34A 3VI2A 4LQ1A 4JTEA 4WF7A 4KWUA 2F7FA 3T78A 4JCMA 1YLVA 1QPOA 2GJRA 4UNIA 3CT7A 1SU5A 3O6CA 3UWVA 5EPDA 1JG9A 4UQDA 3H55A 1H63A 2XVGA 1H7XA 3QPZA 3IJ9A 3SGUA 4CNPA 4O53A 4WZHA 5D03A 4C1KA 3MP4A 3IIOA 4RX0A 3CIWA 3GNNA 3P8IA 3I7RA 1RP9A 3NQVA 1I2QA 3MYPA 3A6OA 4QAWA 1M6JA 4MZ8A 5F1VA 5E6ZA 3E96A 3NQ8A 1ZAIA 3S1XA 2ZICA 1EHAA 2RDUA 2YSWA 3CZLA 2ZX6A 3KAOA 4U31A 2ATSA 4LVAA 4P2VA 3VMNA 5BRQA 2KZHA 3KXQA 4XTIA 5G1TA 3LCHA 5SWUA 1H7RA 1AK5A 3S6DA 2WVUA 2TRSA 3S5ZA 4GJ1A 4MVAA 1ZJAA 4UC5A 3STEA 5LNVA 3NQFA 3EX2A 4QJ1A 1MW0A 5HULA 2Z1KA 2YXGA 3UY7A 3NL3A 1L9WA 4UMAA 1K3UA 1A5BA 3I68A 4FF7A 3AMLA 2C19A 4X9SA 1UH4A 4MJZA 1G4TA 2CZEA 2D3LA 2DH2A 5AHNA 5FF0A 1C9DA 4MLRA 1G7UA 4NT0A 1XBXA 4X9YA 3MP3A 1LTDA 1RR2A 3VFLA 2X2GA 4FEZA 5CPOA 4O18A 5A2BA 1OT2A 3W2MA 3TX9A 1JXKA 3S1VA 1SO6A 5CPLA 1XM3A 3LTYA 4FB7A 1V3LA 1V3MA 1Z42A 2ZZ3A 2QV4A 4HT3A 5DXYA 4UZSA 3W1TA 4E2DA 2QUTA 1TQVA 1HL9A 4LWWA 4MZYA 3MI6A 2BX7A 4FIRA 1V3KA 3QF0A 5J5RA 1MW2A 2Y61A 2NUWA 2FHCA 2F1AA 3HZ3A 1VFUA 6TAAA 1UH2A 5I5RA 3L0GA 4XZ9A 1M7OA 5E1QA 5G2IA 2Y7EA 2UV8G 4JTLA 3O6DA 4JY8A 1ZS2A 1VHCA 1HX0A 3II1A 3M0ZA 4HOZA 4CQ9A 4JX4A 1KCKA 3WNPA 2E5CA 3N73A 1OK6A 1LORA 2V2DA 3BSHA 2JKAA 3HG2A 2OYLA 3EB2A 1KFJA 1M5WA 4IPIA 2NX3A 1GTEA 5LGXA 3AJXA 5G2WA 5CSRA 3O06A 4TO8A 1F05A 3RU6A 3ZR6A 3OBKA 3VGEA 4JFSA 2X1SA 1FWWA 2QF7A 3OA3A 4JFTA 3BCDA 1IV8A 1BF2A 1D7FA 2ZRYA 3GDKA 4EF9A 1TPC1 5C2XA 3QGVA 3MW7A 4UCFA 4OBTA 4O1BA 3S8HA 3M16A 4I7UA 2Y2WA 9CGTA 4OWGA 4UMCA 2GVLA 3NPUA 3VNYA 4JS3A 1GVFA 1CXLA 3WEMA 4LRSA 1PE1A 3WY2A 4EWND 1QMLA 3TFCA 1EA0A 2YW3A 4DBEA 1B3OA 1TQXA 3SI9A 3SIZA 4N9BA 3FS2A 4GRSA 4XWUA 4BI5A 1JDAA 3UD6A 4AWUA 5D09A 1CXEA 1J5TA 3GKAA 3NNTA 1Z44A 5E93A 1QR7A 2W0UA 2V81A 4CN6A 1D3CA 2ZRVA 3HPXA 5CGTA 1DKWA 1ME8A 2ZXDA 3TKFA 4MAZA 3L2LA 4GQRA 3QW4B 3A5FA 4OV9A 3VGDA 4X0NA 1JF6A 3WY3A 4HN4A 4I7VA 3DZ1A 4JGDA 5EY5A 3HJEA 2R14A 1LBLA 1W1ZA 3W7JA 5KTLA 3R12A 2OZ0A 2BZNA 1R75A 4MJMA 3GXMA 4UCGA 4MYXA 4ATWA 1PPIA 4AMXA 2EKCA 3P7YA 4OKDA 3CB8A 3GZ3A 5D2XA 1TQWA 4U2ZA 3O8AA 2ZFAA 1VS1A 3C8FA 2Q8ZA 3KVMA 1SFLA 4GQQA 1N8FA 3FKRA 3NZRA 3C2VA 3UPWA 4MKNA 4FX7A 3G8RA 5I3FA 3BLKA 4M5PA 4WOZA 3GR8A 4AAJA 1OJXA 2YFOA 2FYVA 2YA0A 1T99A 5HUOA 1VJIA 4UTLA 4LS0A 4YCOA 2J9YA 4M8UA 2VFFA 3UERA 2FPYA 3O16A 5F4SA 1KBIA 4DQWA 1S5TA 5D38A 3T44A 1RV8A 3MO7A 2NLIA 2C3ZA 1JD9A 1IZJA 1TYGA 3QW3A 4BF9A 3VNDA 3WEOA 2E6DA 3WNKA 1W5OA 2ZXQA 3IIPA 4ZL1A 5HR6A 2WNWA 2WVVB 1D3HA 3BGGA 1QOQA 1TPWA 3INPA 1GOXA 4OE7A 4WSKA 1R33A 4NVTA 5AC7A 3C56A 3PM6A 1TQJA 3PF3A 2CPUA 2EQDA 4J3VA 1TSIA 3KRSA 1PZ3A 1KGUA 3VCRA 5DXXA 3NG3A 4CKQA 2I9EA 2ABAA 3EJRA 4J9JA 4M56A 2OYMA 3DHUA 3OLDA 1XDLA 3BW4A 3N9SA 1MZHA 3VM7A 1OFRA 1YXCA 4MFEA 5CGMA 3RLVA 4AW7A 5DCEA 1OFEA 1R2RA 2FHBA 1OFOA 5AHLA 2QEZA 2QMJA 3MHFA 4MY9A 4GUFA 4LVBA 1EO5A 1UD5A 1ALDA 3EWWA 3ZWTA 3IRDA 2WV8A 1G94A 2WSRA 3KVJA 1JVNA 3M1ZA 2G3MA 2Z2UA 1KM3A 1W31A 1MFUA 3UWQA 3LXBA 3CTLA 2X1UA 4GUIA 4LVGA 2W79A 2RDTA 1XBZA 3S1WA 2F7OA 3NQEA 2R8WA 3B8DA 1GYNA 3BH4A 2D73A 1U5JA 3RK8A 5HNRA 3EXRA 1K7FA 3TK7A 3W7EA 4CNNA 1RZMA 3EX4A 3TROA 5D05A 5KEZA 4P61A 3TTYA 3W73A 4FO4A 1XD1A 4ZQRA 1VZWA 1FCUA 3GB6A 4DO5A 4RZ4A 3CTTA 5LNRA 1OSEA 4E2BA 5D2YA 4K38A 3L68A 4ZZ9A 3DAQA 1JF5A 1JIBA 4UNKA 2G96A 1B57A 1W37A 1BAGA 2WKLA 2BY1A 4AF0A 4MB1A 4JEQA 4UOZA 3W7IA 3S5YA 4MPQA 3G1XA 5AHMA 3TNOA 1SW7A 4JXCA 4X2RA 3W07A 1U33A 1VFMA 1WOAA 4JL2A 2BSLA 3OVPA 1BKSA 1JRBA 4QIUA 3VE9A 1OX6A 4K7VA 4J7RA 4MLJA 2J25A 1BG9A 2AAAA 2IGTA 1A5AA 3E12A 3S42A 4S2CA 3ZS4A 2DZPA 3USBA 5IBXC 4M19A 4AEOA 4O8RA 1I4NA 3VU2A 3BVXA 3NQ7A 3YPIA 1EUNA 1MEIA 1OX4A 1HVXA 6TIMA 1EUAA 3LM7A 3LV5A 4UIOA 1FDJA 3KL5A 3R13A 3RLUA 3LBCA 2DZUA 3I7QA 4FNPA 2CLMA 5T26A 2QCCA 2H90A 2H3DA 3PBUA 1JCYA 2Y89A 3R89A 3M41A 3WFAA 1NSJA 3C4UA 2YR1A 1QWGA 5KZDA 5A6MA 1A53A 5AB3A 2WKGA 2HSAA 3VE7A 4WY0B 2EO7A 1P0KA 5HWNA 4UFMA 2QAPA 5AYZA 4GUJA 1SPQA 3SFKA 3GXTA 4FNTA 1VIWA 5I3JA 3IK2A 3WNOA 5CZ0A 3QH2A 4JN6A 1VAHA 1TJPA 1SMAA 2VOMA 4GNJA 1OVDA 1EA9C 3PC0A 1XUZA 1NEYA 3BVJA 1F74A 4B9ZA 5CZSA 3WMSA 3M5YA 3EDFA 2Q8LA 4JICA 4PCSA 4MY8A 1E40A 1AVAA 2QDHA 2TSYA 3GKFA 3KX6A 3W7RA 2DZWA 2ZQ0A 1XCXA 5C6MA 2PCQA 3D50A 1A5CA 2ZCGA 4BFAA 1G4EA 1VLWA 3D4ZA 4Y8FA 2GUYA 3MBFA 4KFNA 3FLUA 3TE9A 4NJJA 3WENA 5BRPA 1MW3A 1KM4A 2JKPA 5CLTA 1KTNA 3DHDA 2ISSA 5CXPA 1JR1A 2D0FA 1W5MA 1WZKA 4AIEA 4IOTA 3HGJA 4JDYA 2HMCA 2WANA 4O50A 5IM51 3CV5A 4J27A 2YPIA 4JTJA 5U7SA 1O95A 2GVJA 3W87A 4ICNA 2J9ZA 1YDOA 1AW1A 4K6AA 3THQA 2GVGA 2VFGA 5EYWA 4UFKA 3CPUA 3NVTA 3BVTA 3TONA 2ZZ4A 3KRZA 2GOUA 3LHZA 3O05A 1ZJBA 3VKJA 1KV8A 2ISVA 3W74A 3LRKA 3W7PA 3TJXA 4Z1BA 1G9HA 3A22A 2E9BA 2CLIA 3EWUA 2DZXA 3Q58A 4TX9A 4NQ1A 2Y70A 1QWUA 1EIXA 1R46A 3TSDA 3NQMA 4EOUA 3OEXA 2NUYA 1YDVA 3HG3A 3D0CA 4XKYA 2QCHA 3G1AA 2PE4A 5F2MA 1KM1A 3PVFA 1MXDA 3LHUA 1LOLA 4HOWA 2QJIA 2ZX7A 1I75A 2DH3A 4BWLC 3WDJA 1ZNNA 4Q33A 3PBYA 1OYAA 1EP2A 2TMDA 5CPMA 4MUZA 3TW6A 2E5BA 3DI1A 2DP3A 3BAWA 3NQGA 2OW7A 3ANYA 1GJWA 4ZQNA 2H8XA 3W37A 1TTQA 1JUBA 3BVUA 3DHFA 2VXNA 4NX5A 1GG0A 3QSRA 3L9CA 4ML9A 5IBXA 2W6RA 3IGXA 4A2SA 3W7CA 1QPQA 4N4PA 1QFEA 4NJGA 2XVKA 2QCFA 1UKTA 4NNAA 3G1DA 3N9RA 4NJHA 4XBKA 3RFAA 1TCMA 1TPB1 3BUIA 3HJZA 1CGVA 1BTMA 3G1SA 5AYYA 5FF2A 2Y7DA 3VM5A 1I2PA 3DU0A 3B0VC 4E0CA 2Z0IA 5EBUA 3BAXA 3IVTA 4K36A 5CKSA 4UFHA 4J3WA 3ABSA 1TMHA 3UPBA 1YDNA 3QEZA 2NUXA 4O10A 4H7VA 3S1UA 1KBJA 1IXNA 1RD5A 1H51A 1B9BA 3A9IA 1PS9A 1MWOA 3P61A 1XD0A 1VCGA 4RXFA 3FYPA 4RV8A 5CZJA 5ABTA 2O7SA 4LTSA 1UUOA 1OYCA 5LHEA 3CZGA 3L67A 3TH6A 4FX8A 1UKSA 1HFBA 3LI0A 1HL2A 4BR1A 2ZUVA 1ICQA 4R34A 5HWMA 3DFOA 3QC3A 1SR9A 1KTCA 5A5WA 1EP3A 4QITA 5CLWA 3GDLA 3CGTA 2DZSA 1VLIA 1QO2A 2V8ZA 3GAYA 1OB0A 3WJSA 5HR7A 3W2NA 1IXQA 1GT8A 5FEPA 3HG5A 4EF8A 3WNNA 2YDAA 4JNMA 5E6YA 1YXYA 1JFHA 1S5VA 2YFNA 2ZE0A 3MWAA 2QJGA 4WSJA 2YA1A 1KM5A 1LCOA 3W23A 2QLYA 3L4UA 1G7VA 3GBEA 2R94A 2CFFA 3CM4A 3BMWA 2VNCA 3BLIA 6CGTA 1VYRA 3WNLA 5LHFA 2VFDA 3KVKA 2VUYA 4PH6A 4UFIA 3NL2A 3IIXA 3O63A 1K03A 4O16A 4KKXA 1KM6A 1O4UA 1QAPA 5G5IA 2CXGA 4AXKA 2YKKA 1HT6A 4O1AA 4HNNA 1OK4A 4GBUA 4Y90A 4XUGA 3G0UA 2A7RA 3IGSA 1O60A 1GG1A 3NXFA 4IPJA 1P6WA 1H7NA 2WOQA 4KFPA 3GLCA 4A2RA 3HQ1A 2QCGA 6ALDA 1AL8A 1Q45A 4O12A 2QKFA 5EMYA 1GVIA 4FMVA 3W7HA 4Z1CA 2GPTA 3DI0A 2NV2A 4GUHA
chains in the Genus database with same CATH superfamily
2ZZ6A 1K4CB 4ONOA 3N44F 1EERB 3MGTA 2X0SA 1RA0A 1Q1JL 1MXSA 5L9DL 4EQ2A 3NGFA 1MF2H 2AEWA 1FZOB 3IRZA 4UIKL 2QVNA 1CFSB 3VSQA 5FYJU 1P0BA 4HUXA 4FXKA 1WZMA 1PVNA 1PJWA 5JYLA 2R39A 4XNUH 4IMLB 3FBQA 3GKWL 4OCYH 4IH3A 3UWZA 1PZ5A 4KKBD 5LGHH 3BK0A 3QI9A 3QEQA 3M7WA 5ID1B 3S9ZA 4BKLB 2JCWA 3SB3A 2EPNA 2HT4C 4W9JC 3VQMA 4M6ML 3PWPD 1KXQA 4OVVA 1V03A 1RZIA 3F5WA 3T3PF 4KQNA 5EUOE 1JVOA 4Y8EA 1JHKL 5ITFB 3KWWA 5FESA 3UTZA 2CJUL 3QJRB 5SX4H 2WINB 1EO8L 3FMGL 3DV4B 1NAMH 1RJYA 2HVMA 1KELH 1DQML 1T5KA 3V7AE 3C5ZA 1HH6A 2AJ3B 4P9HC 4E8GA 2WC3A 3W72A 1ZAHA 2WIIB 1XW8A 4UQIM 4WNQB 1EXUA 3LDBB 1XYBA 1NCTA 3EA2A 4C83A 4LHUD 1TVBB 1ZXKA 4DVOA 4XVDA 1LM8V 4J2XA 4BI6A 1NCWL 3MGOA 2CA4A 3AZUA 2DZVA 3HI6L 2J7FA 3K6FA 3MTRA 4D1IA 3RWHB 3OG2A 4GY4A 1SJCA 4G3YL 5EDSA 4IUGA 1CFMA 1EPXA 2BP1A 1WYIA 3GLEA 2KLTA 3WDHA 2OMYB 1A21A 1GGOA 1U3YA 4N8PA 4BIKA 1KFCA 2G95A 4XC3H 3RA7L 1F02I 2N7BA 3DX2A 3WXVH 4P5UA 2DVTA 3MBEC 1ET7A 2LR4A 3S83A 1TQUA 2NTSP 2OQEC 2KPWA 1U8LB 4R7VA 3O6ML 1AP2B 3WF0A 1VSCA 1BFNA 3ZFHA 3BURA 5IMLA 1OG0A 4L1GA 5IQNA 2CISA 4UYPA 5T3XE 2B15A 4ZQOA 1SBBA 1XH1A 3TURA 1YQVH 3KGUA 1C5DB 4PIBA 1CBVL 1NINA 3TYFB 1GAFH 4K94C 1BWLA 4F40A 1AS7A 5E6IC 2ZOOA 5DRWB 5LZLA 5CJBA 3SUUA 2JE8A 4Q8QA 4U6TA 5M7QA 4JFED 4JANB 3EJTA 5EEZA 1JGLL 3ULVE 1UENA 4FTVA 5INDB 1EGVA 3CVIL 3ITOA 4BWUA 5FK9A 5EA0L 5KJRL 4JEJA 4HCDA 3VOHA 3U4KA 5HDRA 2JBMA 4N6RA 4K3EL 3RDKA 4PJFA 4Y89A 4KCUA 4MJ2A 4MGXA 2ATKB 2VKWA 3VNZA 1KUMA 1AUSL 4X99B 4Y2LA 1CW2A 1UZ6F 1FDZA 2I17A 3NSDA 3SJVD 4PJHA 2WNKA 4XD6A 2QGYA 1LLOA 4NPKA 3QDGD 5LNUA 2Z4QB 2F61A 4A7GA 2AI0H 4MNGB 4I3RL 5KYYA 4S3DA 5ITBH 2O5YL 1NGXA 3B8IA 3V0VB 3GTTA 2REQA 3GNOA 1AVKA 3IEAA 1ADWA 2CLRB 3UMTA 1F3DH 3S8GB 2JQXA 1JYWA 1IT9L 4IBWA 3B04A 4QDWA 5KN5A 4JTFA 1TE1A 2EUVA 2QLVB 2JIEA 1NSNL 2HZGA 2DQMA 4H6KA 1OB1B 2EEXA 3SYPA 4RMVA 3TPKA 1FRGL 4UTFA 3BSZL 4A22A 5HBFA 1U8MB 4PUNA 1LE9A 4OF6A 4OLZH 2F6UA 4LSPH 4IRZA 3B8SA 3TFKD 3N3EA 4HIHB 1E7UA 3ABOA 5G5DB 1LLAA 2OZ4H 2RIKA 2XN1A 3Q3GB 3GRIA 2R0LH 2Z7GA 2FJFB 2C9PA 4OSUL 4WIQA 2EG8A 3WG6A 3U46A 3PGFL 2ALWA 1UACH 1KFBA 2HLAA 2YWZA 3B9EA 3ZQ9A 2WLLB 3BG3A 5SWQA 4DN4L 1OHLA 5E9DE 3CQIA 5EUOA 2G30A 3EF7A 5HJDA 3GXUB 5H91A 4F79A 3DI2B 1E71M 1NS4A 2BNRE 2YUVA 2QF8A 2P44B 2VIRA 1KCVH 1JPTL 3SUTA 5LXXA 2KH2B 3W7XA 2VN7A 3ALXA 5KSBF 5AY7A 4IOIB 4YIQA 3Q5OA 5H2ZA 1RLBA 1H1YA 5AC4A 4LDCA 1H0IA 3U0PB 4HUCA 3C2OA 2VXVL 1M1XB 4ABVA 2EZ0C 2ERJC 5AALA 4L5FH 2QFPA 5CJXA 2V0TA 2ACQA 4UTBL 4WEVX 1M6UA 5AAWC 5B3JE 2PDFA 3MU3A 4Y2DB 3PIQA 4Y5VB 3MRNB 3QUXB 3DKLA 3MUGB 3QDMA 3TEWA 3W11D 3H2AA 1BZ8A 2PZNA 3BN9D 1PZAA 3C87A 4NM8H 4FAAB 3ZRCC 4K71C 2ZKWA 4UOQA 5ETUB 1T2QH 4H9TA 1AV4A 4F37F 3LOTA 1E2VA 4B27A 1O5PA 3ABRA 2F18A 2X2HA 5JMUA 2QDGA 3MA7A 4IGBD 4GOAA 2IQ9L 4Y96A 1ET8A 4U1GC 1Z6KA 3M0MA 1D5BB 4ODSL 2AS5M 3RCMA 2YEVB 2B16A 1TVHA 4AISA 3WJWA 2YAHA 5H94B 4P5TD 1CBGA 3OPZH 4S23A 3T08A 3ZT5A 4C6CA 3DDFA 4JIIX 5T1MA 3VGAB 4A38A 3SRFA 4NNBA 5DBTA 4JMNA 4PUJA 1CB7B 1ODUA 1H5YA 2EC9T 4XX5A 4XWOC 1O9VA 3CIXA 3NIGB 3WEBA 4HGWA 1RPKA 4RJEA 3OBEA 1RURH 4WV1A 5LSMA 3SY5A 2NY2B 4LVFA 4US5D 5GZNC 4EDXA 3UZ5A 3JWNH 2KLSA 2UUDH 5KVEL 4N9GB 2V33A 3Q65A 1AMYA 3QEHB 1REQA 2H6UA 2JTDA 3VSVA 1RVGA 1HYSD 3PJSB 2RAGA 4WW2B 1XR9A 2DIKA 4DKTA 5D93B 4Z7UB 1JRHI 4JHMA 1UWYA 1CE1H 2X44D 1UA3A 4YO0B 3RX3A 2Y6ZA 5DR5H 4XC1L 1EXBA 1KIPB 1FV1B 4GPVA 2YUXA 1EAJA 2KX9A 3MJ7B 4JDEB 1OAQH 2LU5A 2V7NB 5IFHH 3WO4B 4JYDA 2BVPA 4P57A 4TV6A 2YLLA 4LEXL 1R2SA 3ME0A 9XIMA 1LMIA 3M1BA 1R24B 4IX2A 5I7GA 2QVTA 2VE6A 4NCC2 5FPIA 3OIHA 3QQXA 2ZP0T 1XR8A 3IM1A 2J6EA 4DUWA 4XOEA 3TBVA 1NFDB 4G7RB 1JGEA 1IBDA 4Q74A 1MHHB 3ZBMA 1MFNA 2ICEB 4YDVA 2DFAA 4YGVB 4PRBB 4JN1L 1KKOA 1NC4A 1WO2A 3V0UA 1QNPA 1YTKA 5F1UA 4IIZA 1WDWA 4J2QA 1B54A 4G7YH 1SHXA 1RSYA 1IYXA 3KPRD 3W9ZA 1L7IL 2WXPA 1KT2B 3KCPA 4FXGB 4XBGA 1GORA 2WW3A 3KAAA 4BZ2A 4XD5A 3WLLA 3W39A 2DJXA 3AQUA 4I90A 3BP5A 4ZAKB 4ABWA 1VBRA 4DP5X 3FQRA 3LSOB 3NPVA 1W8EA 2C1OB 1AH1A 4GIOA 4JTKA 2AQOA 3RX4A 1DBTA 1QNVA 1ZHAA 2GEEA 4Z42C 2BNRA 3QZMA 4D3CL 1UOZA 1SM3H 4NRYA 4UTUA 4HYVA 1WUFA 4R85A 2VL4A 4G1KA 4JJOA 2XPZA 3IVSA 2NY6D 4L3EA 3GR7A 3BKMH 4WENB 2GHZA 1JD7A 5B39A 4F33A 3NIFE 4J3OF 5JW3H 5GGUA 4LBAA 4AYSA 4ZTYA 3AQDA 1CGYA 4GJTB 5LGHL 3EEGA 1TYJA 3RGVD 3B06A 5ICXA 3BAEH 1SN0A 4ZPVB 1H61A 1HSBA 1PKMA 3QHZH 4FCAA 1YN7B 5D6CA 3L0NA 3TC3A 3FT2B 4WJ5B 1R87A 3EADA 3GC3A 1JE6A 4DP6X 3LPGA 3LAFA 4ICMA 1KTLA 5K1JA 1P7TA 4QLLA 3OLEA 1V7YA 3P74A 1BFOA 3AQZA 2Q76A 3VD3A 4LRNL 1NAML 2I16A 2VQUA 4KWWA 3QLLA 3QG0A 4HHAB 4DHLA 1G0DA 2D3NA 2ZRUA 4Y9EA 3GDRA 4HEPG 3QZ6A 3G1YA 3E6EA 4P3WA 1UCBH 5F7DA 5HY9B 1AGEB 1MAMH 4DZIA 5H37A 4PUWA 3QMRA 3HMWH 3AY4C 5D4YA 4N6EA 1I9RH 4GKTA 4HG4J 4U3CA 4K8EA 3VFWB 3MV8D 4GKNB 4HA1A 4QOKA 3SDXE 3QCVL 1F3JA 3SUWA 4OLUL 4RKAA 3PTKA 1YNTA 3VD1A 1YUHA 2QAFA 1KB9K 1KEMH 1IAKB 2WYTA 5LGYA 1MG2C 2UXGA 4KMTH 4PTTA 1ILSA 4L8BA 43CAB 4PI0A 4RMUA 5FCUL 4GG9A 1VHPA 2PWFA 4QKTA 2JI2A 3REWB 3UPRB 3WXVL 3QFJE 4QXVA 2GIMA 1RUQH 1Z5LB 3IIOA 4NYLB 5E6ZA 2WW8A 3SQSA 3V4PA 1U42A 3U2SA 1RPUA 2PFHA 3L3DA 3U9WA 4HUWB 1IIKA 4ZUVB 5MHSE 1E9YB 2O61A 1YQVL 3R94A 1VEPA 4YHZH 3DXAA 5CPOA 1OT2A 3WKQA 2YN5A 1CB8A 3LY6A 2A77H 1SO6A 3LTYA 4L9XA 1Z42A 3A12A 4XB7A 3BOFA 2YBUA 4OY9A 1RY8A 4BZGA 1V3KA 2IPTL 4Y7OC 1VFUA 1UH2A 4BA8A 5I5RA 1J0ZA 3WUFA 2WZHA 4LCIL 2WTRB 3JWOH 1ZS2A 1FGVH 1A3HA 4OM1L 4LJ3A 2R27A 4DVBB 2WGXA 1N59B 5G2WA 1E90A 3MUIA 2EIDA 3QNZB 3RPMA 3U1QA 3HUJB 4JFTA 3GDKA 5D70L 1DWAM 4AQ1A 4V15A 4UMCA 4G6ML 4W81A 1B88A 4I9WE 4OFQA 1EA0A 3KM1A 4AD0A 5IVXA 2D8KA 3DTXB 3UDWA 1MCWM 4XWUA 4DN1A 1X6LA 1I1XA 4BQBA 5EGRA 4H1LB 1CDJA 4L6DA 3TA3A 5I1AA 1DBMH 4X6BA 3TY1A 3F6IA 4LHUB 4P46D 5KVEE 4JGDA 4ACYA 2R14A 5ITBL 4M82A 5LJYH 4XD3A 3I6GA 5CJOL 3O0RH 1N7RA 4U1MB 2IKIA 3LDBC 5IJKC 1BXXA 3DTUB 1EBHA 2GITB 4IW4C 5F1NB 5J1TC 5JUVA 4OTXL 3B2XA 1CFQB 3RWCB 4Q6IA 3I6TA 1JXGA 1KPRA 3U6XS 1HC1A 5C2GA 5I6MA 3X17A 3GR8A 4AAJA 4LAKA 4IJ3C 4YCOA 1MWAH 3RWJA 3VIKA 4AXWA 3R11A 4A05A 4F7KA 3OR6B 1H3UA 4LSPL 3WEOA 2OBGA 4EQ3A 5FLUA 2VM4A 4MMIA 2WVVB 1WV7T 2FZMA 4H26A 2EQDA 4C5ZA 3B9KA 2R0LL 3LENA 4AMKH 4DKEH 4FQIH 3RLVA 5C3IA 5EIIG 3IDGB 2WSRA 1GS6X 3FQWA 4WY7H 3T6WA 3QUZD 1BFSA 5I5MA 2QULA 1UCTA 3FONB 3BH4A 1TZHB 2VW7A 3RK8A 1ZSDB 1IUZA 4V2XA 5HNRA 3EO9L 4FFZH 5DD5L 2B31A 3KH3A 1HDMB 5KZ6A 1S7QB 1KCVL 2OXHA 1W0WB 1U8NB 4JFEB 5DZOA 2W4XA 3GH4A 4NZTL 1U33A 1XX9C 2BDNL 3ZS4A 1EQWA 1K8DB 2HQAA 1IT0A 1FA2A 5LA1A 4L5FL 3KL5A 4F3FB 4K2UL 1R3SA 1OHQA 3I7QA 3SDXA 3HNSH 1KJ2H 4F2MB 1T3FA 2WHVA 3EBAA 5KYUB 3SFKA 1H3PH 4Z7VE 5I3JA 3WBEA 4HV8B 2H1PL 1HS6A 5IHBA 3QDGB 1T2QL 1LL7A 4X5WA 4P3DA 2EDTA 1IQYA 1KD0A 3PXHA 3L1FA 2D03L 3GKFA 3SO5A 4OZHB 3BESR 2QIIA 4UTBA 1FYTA 1J5IA 1FN4A 3R1GH 2QSVA 1MW3A 1OD9A 4OGAD 4LB3A 2F19L 3ZE0E 2PDKA 5J11B 1EBAA 1S7UA 3ZJAA 4KROB 2NY1B 4J27A 4Z7OE 1W8NA 4PJ6A 1NDYA 1CUOA 3E6HB 2NDGA 2ARJA 1FP9A 1URLA 3R7QA 1DWFM 4BWTA 2PPEA 3A22A 3OEXA 4KI5C 3J7HA 1RURL 1TKKA 4L61A 2DP3A 1EJUC 2DPEA 4QRBA 4Y16A 5C0DB 4F9PC 4ML9A 3MB9A 5FW8A 3STLA 5FUCC 4NF7A 2XVKA 2UZYB 1FO0B 4NNAA 4AH2B 1JNLH 4ELMF 1CGVA 3D2UD 1BA9A 5AYYA 5FF2A 2Y7DA 5GRVL 4PR5A 4LH8A 5DDHA 1H8OA 1S39A 3LSCA 1XLBA 1OP5K 4MMHA 1UB6B 4WVRA 5FO2A 1G43A 1YNYA 1IC4L 3FU0A 4CMMA 3WGVB 3KBJA 1UWTA 1CE1L 2R4SH 2ACSA 1AZZC 2CNZA 1IBFA 1OYCA 3QTPA 5DR5L 5HJ3B 3L67A 3TH6A 2QTVA 4R34A 1SR9A 3GDLA 1VLIA 2I9UA 2B8OT 3WJSA 1KJMB 5IB1A 1W2KT 5C8JB 4PW3A 3WNNA 1MCWW 2YFNA 3H2FA 1J1XH 4HUUA 5C0ND 2VDMB 4QY8B 2ZUQB 1AQKH 5KVMC 3KVKA 3IDUA 4WUKL 4NWUH 1E5UI 4BFNA 3BQ6A 5JW5A 2VWTA 3G0UA 1OAUH 2YARA 1BBJA 2R83A 3NG5A 5FV2A 4IPJA 2G3ZA 3DI3B 5JZ7C 1Q45A 3TF4A 1F6AB 2HVOA 4N2KA 4OD3H 4R83A 1D5XA 3W7HA 5GJTH 4YFLI 4ODTH 2H9AB 5K1NA 5DD1L 1OGGA 1WV2A 2ARJQ 3QULA 3M0LA 4AQ8C 2H45A 1TX2A 4NJIA 1WIUA 3QUXC 3BP7B 4X7TB 1SZNA 1RAMA 4C65A 4U7MA 4IGBB 5K69A 3I9GH 3H2QA 2XQYK 3MRJB 1A6ZB 3FFDA 4TOYH 4IJRA 3BD5A 3GTXA 4KF1A 4PY7B 5D1XC 2JTYA 3QG6B 2FK9A 1U8OB 5DJ8B 4AYBA 3NPXA 3CVHH 1IKFL 2BP8A 3WHXB 5G2HA 1VP5A 2DYPD 4FG2A 4P2OA 3GGWB 4P59H 3HGRA 4FQPA 3TBCA 2Y5EA 2AQNA 3GPSA 2QCMA 3ZLFA 4XQ6A 3O3EB 5ISZB 1ZS8B 3IETA 4H4IA 4GXUN 4XOBA 1O9ZA 2X7VA 4UQAA 1PL3A 1UR4A 4FQXA 4LKCA 3H3PH 4NRXA 2OK0L 2P5WD 5K5YA 1AOHA 3GZKA 3BKML 3SUSA 3DWTA 2Z00A 5DWUH 3J8F7 1FIEA 2UZXA 2OGYA 1FCGA 1IC7L 5DZJA 3FA3A 1JYXA 4JPIA 3II2A 4RFOH 1JPGB 2AJZB 4KKCD 1OP4A 3RPKA 1RKRA 2NY2C 4P8XA 5DRXB 5GRXG 1OX4B 3R5EA 4OLYL 3HPJB 3QHZL 1A7RH 1Z5YD 5I3IA 2RB8A 3EUDA 1OWRM 2C11A 3HI1B 4QROA 3QZWB 3ZDXB 3O6KH 5A6KA 1DQWA 4LC6A 3SCUA 4Z7VA 1AQMA 3C8DA 3LKNA 4IIGA 2LGNA 5IB4A 1TVDA 3DO3A 5IEHB 4WW2C 1OY0A 3FYEB 1J0MA 2CLKA 4JGJA 5D93C 2OT0A 3MO1A 3Q8FA 1WKFA 5D9MA 2FZ3A 2OPJA 2OSXA 4F8TA 4YSUA 5J9PB 1B4EA 3AYVA 4KDTC 1M9WA 5DLCA 2V2CA 1LO5A 4NUJA 4LLVA 1WBXA 1UCBL 2QJHA 5CM1A 3GNML 3WO4C 3GBML 1HO4A 1AXSB 4IMKC 2X7WA 4E9TA 4ETQA 4BA0A 2BVOA 2F8OA 1U6AH 3VILA 3AUJA 1UWGH 4PU2A 3K80A 1R1CA 3FUEA 4UR8A 1NAMA 2NW3A 4OF3A 1KEML 1LOSA 3KPRB 4KMTL 3APTA 4JHOA 4U6YB 1P1XA 2ICEC 2UY7B 5L2JB 1FG9C 2D4DA 3P4OB 3P81A 1O5DT 3K6SB 1GUVA 4DETA 4FNUA 3L65A 3MV7A 3OQRA 5T3ZL 5ID0A 2EPOA 3T2LA 5B7EA 3LNMA 2WXHA 1BYAA 2XINA 2XA8H 2HFEB 1VYPX 4L5FE 4FXGC 5C86A 5I73C 3GMMB 4PLKD 4JQAA 1MHCA 3HS0B 5FOBB 4ADSA 3BARA 2V2WB 3ECWA 8RUCA 5C9WA 1UYQA 3H7BB 1RXLA 3H9SA 4PC8A 3QUGA 4Q7NA 5DY2A 3ARZA 2XTJE 1XB3A 5TE6H 4ZAKC 3L4TA 4O2CA 2O4EA 4DWSA 1SJXA 5H2BB 1OPOA 2YIHA 3ZYZA 1KF9B 2NY6B 4NZRH 3MNDA 5IR1A 3F6JA 2QL1A 3AROA 3P82A 1QSZA 1A6AB 3FQXA 1LZOA 3M1OA 5DEGB 4EK7A 5A2IH 5BO0D 4P06A 2C4FU 1WKEA 5AKRA 2AJVL 2UVFA 1VA9A 3RGVB 2BO0A 1HXYA 5AKQA 3QIWD 2BRPA 1KN4L 2AERT 3QO1B 3CU7A 3A4JA 5M94B 1BRLA 1XDTT 4GH1A 3SIMA 4PJEB 2CEQA 3PDGA 3WQ4A 4OZIE 3K8MA 3B8TA 1FGVL 4Z7QF 4V1DE 5BOZG 1Z41A 4AGLA 2GUUA 3G7TA 1WZ1H 4K3AA 5FB8A 1R47A 1VKFA 1R85A 2AQPA 3VD4A 3GMRB 3O9WA 1M6OA 3DX6A 2PW2A 3I50H 2AK1L 3R43A 3TQKA 2ITFA 4ONFH 1ISXA 1I3UA 1E0VA 5HGHA 3MRDB 3MJ8A 5I6NA 2FEEI 4HJGA 1DQIA 5E1IA 1DBML 3ZE1E 4S10A 1EZVX 1XGQA 1LGVA 2NZ1A 1S3HA 2P5PA 4JN2A 5KJ7E 5D71L 1NICA 4FS0A 3VFCA 1QAWA 3MV8B 1T4WA 3TNMB 1NANH 4QDMA 4DIAA 4ONHB 4L8DB 3PABB 1GW1A 3OKOB 1DQQB 3AXKA 1K8XA 1JWSB 4MX7A 5I8OL 5ANMB 1MNZA 2H2SD 5AYUH 4WTXA 4ELKB 3WGUB 1CLKA 5AVZB 1EBPA 1MNUL 1GEQA 1A02N 1KPVA 4MDJB 4HCLA 1NLDH 1GZPB 1MWAL 3VYPA 2OMXB 3W81A 1NBZA 3BRFA 4L5ZA 2F0CA 4A8LA 2IG2H 2VM9A 2X53A 4DKEL 3NZ1A 4GRLD 4IMFA 1WDQA 1UXWB 2J73A 1RCQA 3TESA 2IVFC 1LBFA 1YMMA 4UQ2A 4PJ9A 5FA4B 2WNZA 2AV1B 5G4HC 3VINA 1P5VB 1RWAA 3L7EB 4L4VD 4FFZL 4B0MM 1LRTA 3CEPA 4UTWC 3BZEB 1MFAH 2W88A 2OZ4A 1QO3A 3FHEA 3FOMB 4LBRA 4XP9L 5D1ZA 3CUIA 1UR1A 4X98B 4R84A 4GZEA 5F9OH 3GW3A 3B40A 4PTDA 1QEWA 2X42A 4Z3TA 5D7JB 5DSCA 4B2DA 2W91A 4GINA 4ZMLA 2YW4A 4IEFB 4QEGA 1ACCA 4WTZA 3H2EA 4KKBC 2Z92A 4JRXA 5HTSA 3MRRA 3C8KB 5FKAA 3BW9A 4JY5H 3HNSL 3KDMA 1KJ2L 4KC3B 3MBXH 1YECL 3TEVA 4OAWA 2A6JB 3K1KC 4KOCA 1MUMA 5DUMH 4XSMA 4ERIA 2P24A 5TPWH 3HE7A 1GCFA 4HZ7A 3WLTA 4H8UA 5EU4B 1BF5A 4H13C 4LLYA 4P46B 2WMIB 5HMSA 2BCMA 4FSAA 4A2FA 4JZJB 3J27A 3MCLH 1AC6A 2ADJA 4NAFB 4OCWH 4UFLA 5EUKB 3D4GA 3WJXA 2C9RA 3R1GL 2ZSWB 4Y7EA 1TTUA 3SE4A 3ROLA 5IDIA 1H3GA 4YAQA 1EEYB 4LKXB 4HK3J 1ME7A 3V4LA 4GQPH 4YVNA 3W7UA 4YR6A 3CSBA 1ZLEA 4ZMGA 5FUOL 2GSIA 2AZUA 4CQ8A 1C1EH 2WZAA 4HS3B 2PDMA 2OWWA 1YBQB 3KWUA 2DAVA 1AQ8A 4R96A 5MERA 2GDQA 3UTSE 1ECZA 3D4YA 3WJMA 3BVWA 4NFCA 1S7VB 1OGSA 3MRMA 2ZG2A 1BQSA 2Y5JA 1OYBA 3LD5A 12E8L 3HBLA 1DJQA 2A3BA 4C1NB 5K9DA 3HC0A 4C4KO 3QUZB 3U36A 4OZIA 2V5RA 1B0RA 2XH2A 3O0KA 4XZUB 3ARFD 4IWWA 3SCRA 1CGXA 1FFOA 1A25A 4LASL 3B2VL 4H83A 4K4KA 4WKZA 3WTSA 3D69A 1N5AA 3TWBA 4FIQA 3ZT6A 4MXVF 2Z1PA 1YRRA 1BQUA 3I4EA 5HHXL 1W16A 1N2VA 3AWNA 3ULSA 2R4SL 3V5FA 3CFBA 2CR3A 4YNGA 4E36A 2AKRA 2XWTB 3NA4A 5ICZA 3Q1SH 5T3ZE 1F42A 3QZEA 1QX1A 4K0OA 1FE8H 4XCNA 2OZNA 5FAJA 3BP6A 4DNMA 1KXQE 4GW4A 1QACA 1IU7A 2V30A 4PGDA 3ML9A 3NQBA 3EDJA 1AQKL 3IB4A 5I07A 3S5OA 1A3QA 3T55A 7FABH 5SX5K 3W9EB 4NWUL 3DROB 2XV0A 4ZODA 1W9UA 3V5HB 4PSPA 3TL5A 2H0EA 5IK3A 1QSFD 2J7LA 1M42A 1LQ0A 2NWSA 4OD3L 3VFTA 3VCLB 2DY3A 3KCWA 4ZMXA 3MKCA 4KJQD 3P4NA 1Q8MA 1FG2B 1BBDL 4ODTL 4W9DC 4JB9H 3RIKA 1XXXA 4PS4H 1UKOA 1ZRUA 1QABA 2X1IA 5E94A 5EZLB 2HVJA 5AYTA 2YEQA 4LSTH 3ILDA 1Y5VA 2EC9U 3UAAA 3P02A 2IXQA 2O5NA 1K8YA 4GYBA 3O81A 1U3HB 2J88H 2B2XL 3SDOA 4BD4A 4E9WA 2DZTA 4X3ZA 5D7SH 2NYZA 1J0KA 5I6PA 4ZK8A 2IPUK 2Q2LA 1PQZB 5J11C 1FWSA 4Z1PA 2CWXA 3E49A 3QAQA 3LDVA 3H7LA 4MMYA 43C9B 3CYVA 3FULA 3H3PL 2GABA 5DGRA 2VABB 4YHLH 4FRWA 2VRQA 3B5GA 5DWUL 1FWRA 4LUYA 3LMJH 1SJDA 3JW7A 2J9XA 2VYOA 3WJJA 3TFKC 1CIUA 5I00A 4J4PD 3DKHA 4BQ8A 1GGTA 1TT6A 1TV5A 3DGGA 1R3TA 4O9HL 4U7SA 2HBVA 5CGYD 1U58A 4CVWA 2FWUA 1KYDA 5EZIH 3EMQA 2QCDB 1JXFA 5LA2A 2PC4A 4ZUWB 3HF3A 2GSMB 3O0LA 5LNGA 3TOPA 3DGBA 1QLRB 4C90A 3WJLC 3EWBX 1YN6B 2CZVA 1ZT7B 4PMFA 1HM2A 1DEEA 1WH0A 4M7TA 1T6WA 1WX0A 4FQJH 1J5CA 4J1UB 4NSKA 3LZLA 1RPQA 3L4YA 3W7QA 2WOFA 3PSWA 3VXQA 5KVGH 5C0IA 3SX1A 2AITA 2PP8A 3UNDA 2Q09A 4PJ5D 3QEGH 2VLME 2PLJA 4LIQL 2GJXA 3W1LA 4L23A 4DEFA 3EF4A 4O2EB 1TQCB 1JI1A 4YMPA 1ZTVA 4U4MA 4MAVA 3KR3L 1RUAH 4A3RA 2PYEA 4LVNB 5E2WL 3I02B 2AQ1A 3WFEH 4B7LA 2ZUQC 4AV5A 1YG9A 2OZ3A 5E03A 4PJDB 2XIOA 4C56B 3A6OA 1U1JA 4PJHE 1IGYB 1VPOH 3F4DA 3N41F 4N0YH 2ZX6A 2XWJB 2NW2B 1THAA 3CCHA 4MAYA 2WVUA 2V7HB 3W11C 5C6TH 3UTSA 3ME3A 3BN9C 1YGAA 5D9NA 5HULA 2KKQA 1L9WA 3BHBA 2CIIA 1DSFH 1UH4A 4BFGA 5ABAA 2CO2A 3PS6A 3QHTC 3L3JB 5C0JA 1I6NA 5EU7C 1R3YA 1XM3A 4YFDB 5L4JA 2FD6H 2XA8L 4W7VA 4W6WB 3W1TA 3NP4A 2EE6A 4IGBC 2NQHA 4GSXA 3UO1L 2CA3A 3CFQA 2VH5L 5D7KD 3DSFH 1R6VA 5IHSA 1FZJB 3JTSB 1YYCA 3US9A 1R3QA 1WHOA 3CX5K 4P5TC 1JN6B 3FF7A 4F93B 3NCCB 2NX3A 2P5WB 4NZRL 1EXHA 4BSWB 4XXWA 4JFSA 3LIZH 1UKPA 3SADA 5M5DA 4FZEH 1GTFA 4FG6D 4ODWA 2QZRA 4E3TA 2K6WA 3NFNB 5CZRA 2H3NB 4ENZA 2HX7A 1PG7L 3E0VA 2CNCA 1KJVA 3VFMB 2AL2A 3OKMA 2INFA 2FWOA 5LXVA 3IFLL 5IESH 1C90A 1IILE 4IFRA 3KLQA 1JF6A 2VGBA 3WSQH 4MJHA 3OVGA 5T1KB 1XHHA 5BXTA 3R12A 3S3SA 3ZX1A 1XGTB 1HYSC 5A7BA 5HPMB 3B0XA 3R7RA 4W88A 3IDNA 3GZ3A 5IB5A 4QG9A 5DHEA 1XGUA 1CZ8H 1T0MA 4FX7A 3A3YB 3BLKA 4ONFL 3QFYA 4IJ3B 4H6QA 1D5MB 3WS3B 3UERA 1TEGA 2WZ5A 1ESOA 2Q6WB 2NLIA 3P4LA 3V4PL 3QDME 2VDHA 1GOXA 3QCTH 3ITYA 4LF3A 1E8XA 3MRQB 3S8WA 2BVQB 3DHUA 1SLUA 1Z3GH 1W72H 4TX6A 2BV9A 3GHSA 1OFEA 3EWWA 3ZWTA 3GTFA 1ESWA 4L1LA 2HLFD 1U8IB 1PTDA 2FR4B 4S3CA 3OM3B 4OK2A 3MRBB 1NIUA 5AYUL 3PL6A 1YNLH 1M4KA 1R3LB 3VWKD 1X4XA 3VE0A 4WTWA 1V79A 3LK6A 3S1WA 5BPPA 1NLDL 1QBBA 4PMJA 1T21B 3QIBD 4ZENA 5F7FA 3TTYA 4AJVA 4R3SB 4PN2A 4JQVA 1N0LA 1W8OA 4R2GD 2XSKA 2KI6A 4HTYA 4MZRA 4QTGA 4K9EC 4PRNA 4PV9B 4QYOB 1BAGA 1MEXH 4MB1A 4TNVK 4NERA 2NX5D 1WOAA 5T1DH 4J7RA 2CIKB 2FFIA 4V2CB 4N3TA 2G4JA 2IGTA 2ZCLH 1WAWA 3NQ7A 5TAOA 3EPMA 3H56A 2VVSA 1M7DB 1MWAA 2FVKA 3HS0C 5JQIB 1N8ZB 3IUDA 3QJOA 4BUGA 1KIUA 4RX4D 3CFKA 2H90A 3WD2A 1MFAL 1XLEA 4OFIA 2HJKA 1IEIA 4OTKA 4HVXA 5JIHA 2NY6C 3QQ4B 3F4VA 3C6SA 3UAJA 4K8GA 4NBZB 3UTTE 1YVLA 1P4LB 1SMAA 4TNFA 3WF2A 4RQQA 4DPRA 3DRQB 2PWUA 4H6EA 1J5OH 4B15A 3RGVC 2DZWA 4OCSH 1SGJA 1FZMB 4AL8H 1E4KA 4FFZA 2ZCGA 3FRPA 1OLLA 1VDGA 1HF6A 3UTPE 5GISH 5F6HI 2HN7A 1BVLA 1ZT1B 3SKOB 4UV7H 5DTFB 4XNBA 4PG9B 1B90A 2V17H 4XPBH 2VFGA 1F4YH 3LCYA 5GHWH 1BWWA 4JFOB 3MCLL 2WYZA 3MOQA 1R4XA 2JKWA 3PWVB 2MHAB 3ES6A 2VDGA 3Q2CA 4FQ2H 4XX1E 3WIRA 1SJAA 5D7LA 1OYAA 1NUDA 5JOFB 5AKSA 3E3QC 1KJ2A 4HWUA 3E8UH 2AABL 3QSRA 4RWHA 2C1PB 4K1WA 4JFHD 4Z9KB 3WLKX 4C6KA 4NKOB 2OELA 1I2PA 3RPTA 3IJLA 2DSWA 4MCYA 4Z95L 1DSWA 4Y7MA 4WI6A 3MR9B 3ZK0A 5FFOA 2YXMA 4LIQE 4G5AA 3A9IA 2GBAA 4QRFA 3PJWA 5LHEA 2JI3A 4GRLB 1UKSA 1HL2A 3QC3A 5CLWA 5FM4A 2PLTA 3C0LA 1QOKA 3I3BA 3WIHH 5CAHA 2VXUL 2LW3A 2FTYA 5EBWA 1I9CB 4AUJA 1WAAF 2HPMA 5DURB 2PCFA 2CFFA 1HIMH 1K6WA 5LHFA 4L3EE 4L4VB 1RXOB 1ITQA 2Z9TA 2DT3A 4RNRB 4YBQC 1KCRH 4QTFA 4D0DB 4DVRL 1FH5H 1D6EA 1O6SB 4F1SA 2ZYRA 2HH0L 3E0WA 5TE7L 4F24A 5MENE 2QKFA 5AECA 2DW5A 4Y8AA 1JZ7A 4OIIH 1P69B 4CNIB 3Q1SL 4PRAA 2BZDA 1XYLA 3UT0A 3LNHA 1HQ4B 2XV3A 4B9GA 2GK1B 2ICCA 2I60H 3LKQB 4XV0A 4C4KT 2G3JA 3HTWA 5MP6H 3PP4L 2GIYA 3OAZK 3NSCA 5D7JC 4LOEA 4WR3A 1FL3B 4ZFMA 4PVMA 3GUWA 3VG0H 2BS9A 4NC1E 5D1XB 3O41B 5J7CC 2V38A 1HOCA 1XV8A 1PD1A 3G5ZB 1I8MB 1KXVA 2R0ZH 1HHKB 3L9BA 5I8KL 3KW8A 3NIDB 2LV4A 3OZKA 3IGKA 3BT0A 4JB9L 4M4RB 1QWNA 4AQEB 1FNSH 4KRUA 3DPBA 2BOFX 4I8DA 1F58H 1BAFH 3EXJA 1XF5A 5HHPA 1EJ6A 4LSTL 1X8CA 4QOKE 2BH0A 4MD0B 1TE6A 1BFVH 2Y25A 4P46C 2J88L 4F2EA 4H04A 4JZJC 2O26U 3DO4A 3GBDA 2E9WA 4AYMC 5D7SL 4U2YA 5AFDA 2JKLA 5CBAB 3WG7B 4NWTH 1S9YA 3R8HA 2I24N 1RJZA 2XDFA 1FRBA 5A8NA 4DT2A 1CD8A 4GEJA 2ENJA 3ZOAA 4M7LT 1U8KA 3QGKC 3UTTA 3TCEA 4C60A 3U25A 1P5BA 2YGOA 7REQB 4UM8A 1ADOA 1FHUA 2R7EB 4FERA 3CVHA 4PMVA 4YJ5A 3ORWA 1ZK9A 1ZLUK 4AVNA 3SGZA 4AWTA 2BTMA 3S4SA 4PCKA 3RYMA 3Q43A 3DXAE 5F88B 2N0MA 3QUZC 2UZIL 2CLZA 4PB5A 5DFVD 4XR8C 2XM2A 1LRNA 4K8RH 4U33A 3TYUA 4N2AA 5I0WA 5C54A 2HB0A 2JCCA 2VC5A 3LZPA 4B4HA 3C6CA 5L7XH 3Q6GH 3RIAF 4QCFA 4GSDH 5KVGL 1DVUA 5DHVB 4DGIH 1O7DE 3OHIA 1EDYA 4CAGA 2V37A 1TCRB 4OU3A 4BCZA 2FYYB 1GPWA 2ADIB 4MPKA 3KHJA 4N4QA 1FFNA 3O45B 4FFVD 5FECA 2YQBA 5FF4A 3JUGA 5ANHA 3O15A 5CPNA 4EN2A 3DO7B 3RWDA 2IAND 3HM7A 1YKWA 3W1PA 5FGCE 4NCDA 5IVXE 2EDOA 4F7CB 2P1FA 5I73B 2JQZA 2R56L 3CWHA 4W8LA 3L9RA 3W28A 2X1PA 3S7GA 4EPKA 5M3WA 2RHEA 2HVKB 3A47A 3PGDA 3CV7A 4PGEB 1QNQA 1O7SA 2SODB 3NN8B 4JFYB 1FAIH 5IB3A 3UBFA 3TF7C 1XLIA 4R4BA 3P3BA 2YAEA 1W54A 4RPPA 1F2JA 4GIYA 2X0YA 1KMGA 1B2YA 1JHTB 5DELA 1VGKA 3NVDA 1MF2L 4KZCA 4JKMA 4B3KA 2XFGB 1T41A 4KKLD 2F53E 3DUSB 2FLBT 3NIGF 1IL1A 5D9OA 3QJUB 2B4CC 2AW2A 2PP1A 2L3BA 2DQDH 4GKZA 2K8QA 1LRQA 3DSFL 4OGAC 1U3HC 1RK6A 4XNUL 3BL3A 4ZMAT 3N40F 1XH3A 3TO4D 4OCYL 4ZFGH 3TNBA 3SCTA 3VXNB 3W7DA 1NBQA 2Z7YA 5MENA 1T4KA 1XCQA 5M2FX 5HGDA 5I26A 3LIZL 1TZ8A 3K3QA 4Z08A 2PD5A 1KENH 3MJWA 2BXZA 3VFVB 4FZEL 1N5YH 1ZGLP 1UCWA 3FUDA 3DGRA 4Z7UF 3QMTA 4G6AC 4H9ZA 4EI6A 3FB6A 2YLAA 3M5VA 2V9UA 1PYMA 1VD6A 3DIVA 5IESL 3C5JB 1KELL 1S3KH 3N0PB 1IGMH 1BJ8A 4JFPA 1C5BH 4OT7A 3NQAA 1V51A 2H32B 2R2HB 4UDUA 4O57A 2ZONA 2J7DA 2DM2A 3TT1H 2GJZB 4OFVA 2VL5A 1F3XA 1CZ8L 1C8QA 4PJ5B 3WN6A 1KSRA 3C3NA 5FI8A 1NFDF 3LPPA 4ZNCD 4ETYA 1S5IH 3FYYA 4WKHA 2DTMH 3RL1A 3TAKA 5KG9B 4QJ3B 2C18A 3AVEA 2PRLA 4H7ZA 4EACA 2XIIA 1TQCC 3S3GA 4XC3L 1W8SA 3TIMA 4I9XA 4LVNC 5AAMA 2PN5A 5JXEA 2H6PA 1LURA 1N12A 2CDEB 1P0SE 4ZUUB 4HYRA 5E8EB 4G1MB 2DSVA 1FYTE 4QRTB 1TJHH 4GMTH 1I7UA 2EKGA 4BK9A 2WW1A 5E1GA 4CVXA 3L4XA 2CWNA 3KGRA 3CNKA 4CLMA 4I0PD 1TZ7A 4O17A 2UY4A 4HDIB 3PP7A 1I8IB 2QQKH 1U8QA 4KKZA 1ORQB 1PDZA 2CIRA 3VXOA 1T40A 3NSYA 4MSSA 3U2ZA 1MEXL 5MEOB 5TK4A 1OM3H 5T1DL 4E8CA 1RJPA 1GAFL 2HRPH 1OCZB 1E6JH 1FCQA 2J24A 5LXEA 4W86A 3W25A 2YD0A 3TJLA 3EZ4A 5GJMA 3SN6N 1RJCA 1M03A 4KU1A 2NYKA 1UWAA 1JAEA 4QRPE 3R4IA 4HNUA 3PWPB 1KIQB 4HZLA 1RMFH 1H0DA 4DYJA 2MNUA 1O75A 2J2ZB 2XZAH 1RK0A 3EX1A 4Z78A 3EDEA 4ENLA 1MHPH 4J6RH 1P4CA 3G6JE 2KZWA 1XBDA 2FBJH 1XF1A 2P46B 2JXMB 1JNEA 4A2LA 5JOEA 1PY4A 1W6CA 2ZP8A 1J5OL 3N6QA 4OCSL 1E9LA 2E25A 3RHWF 3RCYA 5J1SC 3BV7A 5DQ9B 3UROR 1ONQB 1PEZA 5GISL 1UZ4A 1RU9H 3HFTA 4XBMA 3W24A 3MVIA 1L9PA 1BSIA 2YZRA 2AI0L 4M4PA 2V17L 4Z5RB 2IQAB 1RAKA 5BZDB 4HD9A 2XNAB 1A4KA 4LNCA 3MQTA 3PPCA 1V3IA 4HCRH 1QRND 1TZOA 1DJHA 4PRTA 1XGDA 3FJ4A 1KFGA 2VM3A 3P14A 2F53A 5CD5D 4NZCA 4FQ2L 3EJUA 1BVNT 3GXNA 3QPEA 1EWHA 4OLZL 5I8EB 4QUOA 3VKCA 4P2YA 1XP3A 2L7JA 1PEWA 2OZ4L 4XMKH 2ITDB 3VWKB 2OP4H 4U1LB 2KPNA 1MQKH 2FPVA 3OW1A 4ZFFA 4ODUB 1U8HB 4LBSA 1DPMA 3NJIA 3UCQA 1DO6A 4I9MA 4BFEA 1L7KA 5KVGE 1UACL 4TNWK 4M5SA 1H1ZA 1ASPA 2XGBA 3W7MA 1JMZA 1T2JA 2A3TA 2JF6A 1FNFA 3MSYA 4W4OA 1DWHM 4ZFOB 1TA3B 5FF6B 1QWHA 2C13A 3OF6A 3EJYD 4X6CB 3CK0H 2NX5B 2VC2H 2C1HA 3WIHL 1DQXA 1OSZB 5RUBA 3NSXA 1F3EA 3KXFD 3GU2A 4GXWA 4H8VA 2QMKA 4ZDHB 2A9DA 1HIML 4LAMA 1BJMA 2NPLX 4BINA 1BQ5A 4P2RD 1MI5E 4ZQPA 1EHKB 4NXKA 4KNSA 2B5IC 4IBVA 1A2VA 3GTIA 2ZAIA 3OS7A 5I76B 1T1YA 5DUBA 2F5AH 4ADJA 3SY0B 1YEIH 3RGBA 1BQHB 4BF5A 4AUUA 5JHDA 3LXAA 3D46A 2H8ZA 3PXJA 4DPQA 3QH3A 2RA1A 4Y1SA 4AGNA 3S5LA 1AA1B 5EU9A 3GG8A 3QRBA 2DYRB 3RUGF 3QIWC 4NM8L 1KLUA 1TWZA 4FABH 5MP6L 5CSYA 4IHOA 1UA6H 1NQKA 3V7AG 3HZVA 4NRZB 3SJVB 2OTDA 2R2BA 5LVEA 3TMQA 1EV2E 3VG0L 5C9ZA 2EIJB 3D0AA 3ECVA 4PMRA 1E27B 1BZ9B 1F5ZA 3STCA 4AX3A 3RSYA 5FSEC 1ZA3B 2BSBA 3I75A 1DZ0A 4HK0B 2XWXA 2DJ4A 1JDFA 3OPZL 5AAPA 3RGTA 1V5JA 3HLAA 3SOBH 1F58L 1BAFL 3LCXA 4UM9A 4FALA 3DK0A 1OW0A 3GXIA 1FWGC 3OKKB 2ZOKB 1LROA 3WO3B 2VUNA 1FVEA 3P93A 2ATPB 4XNQB 1JZ6A 4P23A 3HG0A 2COQA 4WVXA 5EFIA 5IWLA 5K4ZA 4I5XA 1OCCB 2DLGA 1F13A 4QRPA 3MV7E 3HPLB 5KBNC 1WYJA 1KO0A 2H2SC 3DARA 4XBPB 3B43A 2VDNB 1ZHKB 4NZ8A 5F3HA 2EJ1A 3BPCB 4ZUSB 1ISZA 2R91A 2NY5C 4KJYA 4MYPA 4RIRB 2O0TA 2J88A 3G6JA 3H9SE 1S38A 3QPQD 3EDDA 1JRCA 4KBXA 2WSDA 3WIAA 4DFIA 1PZ2A 3CWGA 1OIOA 1ZBWA 4GRLC 3RXZA 4HHPA 3QIUA 5PTDA 1OAQL 2XDHA 2JKSA 1OWWA 5IFHL 3PNRB 2QR0B 3RDTD 1S5HB 2EE9A 4K8RL 3HFYA 1IVXA 4F58H 4WZHA 3EFFA 1SXCA 3NQVA 2NY4D 3DVGB 5L7XL 3Q6GL 5C3LD 7XIMA 3S6DA 4DGIL 3STEA 3NQFA 1MW0A 3I68A 5BVJB 3ARBD 3D33A 5ILTH 1WISA 4CUCA 4G7YL 1LTDA 3B34A 3WLRA 1Y18A 3BVDB 4XX6A 4WI7A 5CG0A 4JAMA 1IQWH 3HN8A 2ZKXA 5CAKA 2NOYA 5TGBB 5ABGA 2NUWA 2FHCA 4JZOA 4EVNA 3L0GA 4AEHH 4P5TB 4CEUC 1HJQA 1FAIL 3TBTA 1VHCA 1CL7I 1DWJM 3HG2A 1U4FA 5L4FA 1PU4A 4OFDA 4NO0D 2JMRA 4G1EB 1HI6B 1SM3L 4UCFA 3AMOA 3S8HA 5C0GB 3KBWA 3PPGA 1XTLA 4LCCB 2WGNB 3WEMA 4G8TA 2YW3A 2HUHA 1NCNA 1B3OA 1OT4A 4E0RB 2VMJA 2BVYA 3TLQA 3L2NA 3MNZB 3F2CA 3GC5A 5JW3L 3GSVB 2Q02A 3VXUA 2E7MA 1DKWA 1MI5A 4OM0H 1XISA 2BSEA 4TUUA 1PZBA 1K8CA 2Z35A 1BVKA 1RZQA 4X0NA 5DO2D 3ROOA 3RY6C 2R9RA 3VRLE 2DGAA 3W7JA 4GFIA 5KSUB 3AM8C 3BAEL 1W3JA 4NQDA 5JPMB 1NSXA 3U5YA 4JAWA 4L1HA 3RX5A 4PGBA 2XXCB 3T05A 1YMME 4GPNA 1SFLA 4PB9H 1S3TC 4GVGA 5I3FA 3QVAA 2BRWA 3OJ2C 2CDFB 2FYVA 4XGZA 4YLQT 3QUMH 3SGJA 1TTBA 1T99A 4L0PB 4JHAH 2MCMA 4GGHA 2FPYA 4G9FD 3K13A 1LXKA 4NKDB 1IZJA 5B39G 4U10A 1UFGA 3RU8X 1W5OA 3IIPA 1S3KL 3ARFC 4RV3A 5A6IA 1V0MA 2UV3A 3KRSA 3TA9A 2YC1B 3LIZA 4UIMB 2NNFA 2KC0A 3GQFA 4LCUB 4AW7A 3UZQB 3QORA 3EH4B 1MAML 1UD5A 2NR6D 2VOTA 3TT1L 3HMWL 3FO9A 1OALA 1I9RL 4KDVA 4JRXE 2AMXA 2J6WA 1IEVA 5BZZA 3ULUH 1JPHA 4LOFA 4Y5YA 3TYAA 4MMZB 2D73A 3WMCA