4FNTA

Crystal structure of gh36 alpha-galactosidase agaa a355e d548n from geobacillus stearothermophilus in complex with raffinose
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSNNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 225
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fntA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fntA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fntA02
3L5AA 3NQEA 3PAJA 4DF2A 3SGUA 1PJ9A 1TV8A 3DBPA 4JTJA 2ZXBA 1S3HA 3MUXA 2C15A 2ZA2A 5AHFA 5LHFA 1XCWA 1IIGA 3BW2A 3EX3A 4C1KA 2QPSA 5D38A 5KZEA 4NQ1A 4K6AA 4MUZA 1MXGA 2Y70A 2PWEA 3VSTA 4CQAA 1IV8A 3OA3A 1K3UA 4M7TA 4ZMGA 4TU1A 3B0PA 3NM1A 2PWFA 3NL6A 1UUOA 2GQ9A 3LCFA 1KV8A 2VFEA 5AC6A 1KM6A 4E2DA 2P1FA 3W7RA 1QPRA 3TMLA 3WK3A 4PCTA 3IJ8A 1CGYA 2XIBA 1Q6OA 4A2RA 5MHBA 1GVQA 1UASA 1TPC1 4UNIA 1L6YA 1LYXA 4S2CA 2QF7A 3GLCA 3LCXA 3P7YA 5C5YA 1IXOA 3W7LA 1HG3A 3NAVA 3TUUA 3PR2A 3ABOA 3M1ZA 4M6PA 3WDHA 1OX4A 1QR7A 4P61A 3GKAA 1DBTA 4JTTA 3W1AA 1L2UA 1TTJA 2BHZA 2J9XA 1R2SA 1QFEA 3QEZA 4UFKA 3L5LA 3T40A 2O7QA 4N4PA 4Y9AA 2NV2A 3F03K 4I7UA 5KITA 3BVWA 1LZOA 3T44A 3VNDA 2VFGA 4OHQA 1U33A 2VFIA 4LNYA 1VB9A 3M41A 4LY8A 2JKPA 4M6QA 2WSYA 1RD5A 1H7RA 3EJQA 3G24A 1JULA 1SMAA 2GVGA 3VGHA 1KTCA 3RF9A 4YCOA 3G22A 2VT0A 2PWDA 2NSXA 2G3NA 2OX1A 1A5CA 1KFJA 4JYEA 4O50A 1VFOA 4U4MA 4W9TA 4WOQA 3ATZA 4MYXA 5AYYA 1BSIA 1F74A 4O19A 3TE9A 5DCEA 4AHQA 1ODUA 1X8FA 3GXPA 2C16A 4OIFA 2DH3A 3GDTA 4UTTA 3P5YA 4G1KA 2CLMA 4S2BA 3NNTA 1M6JA 1TREA 4Q32A 1HO1A 1PZ3A 4AWUA 4C1LA 1PL9A 1QMLA 4O0ZA 3E49A 1OYCA 1J0HA 4LU0A 1GJPA 2CLFA 3RK8A 2F61A 2VEIA 1J0IA 1SO4A 1MO0A 4OU1A 4UR7A 4O1BA 3O16A 1HX0A 3W7CA 1P1XA 2WANA 3EX2A 5G4WA 4M19A 2WJZA 3L4TA 5CKSA 1NFBA 4ZQMA 4UTTC 3E12A 4GUFA 3DKJA 4PFMA 2G97A 3E0IA 5K3VA 3UY7A 3HB9A 2X2IA 1WZAA 1KM1A 4FIQA 4JTHA 2F7QA 2ZBTA 3OLEA 4LS0A 4HNUA 5AHMA 2E5DA 2FYVA 1OT1A 4FEZA 4DPPA 1K03A 4JN6A 2ZUUA 4O18A 2VFHA 1KFKA 3BAJA 3NL3A 5TQLA 3W7HA 4UOQA 3W2UA 4HNNA 3HPXA 2PRLA 1RP8A 2XVGA 4GC4A 3A47A 1WP6A 2GJNA 4O17A 4UTLA 3V75A 2AGKA 1AG1O 2CU0A 3PBVA 3L4WA 4NVTA 1JDCA 1TQXA 4ZL1A 5AC7A 1PPIA 1OFBA 2E4TA 4U31A 4GUHA 1QWUA 3CPRA 5A8GA 5AHIA 2QMJA 3PY2A 4Z0JA 4J3SA 3HG4A 1YXYA 3L4XA 2FIQA 4LPCA 4MFDA 5LNVA 4AH7A 1X6UA 1RR2A 1F05A 1E51A 2D73A 3KL3A 2G96A 2C7FA 2W0UA 1FUYA 3I7RA 3OLIA 3BG5A 2X16A 4HPHA 6ALDA 3KVJA 1OX5A 3HF3A 4O16A 2DU2A 4DXVA 1B0IA 1LLWA 2IGTA 2TYSA 2ZUVA 2CLOA 3ZT7A 3MYOA 2WV8A 3E96A 4UR8A 1G9HA 2C14A 1OYAA 3C2OA 1SSGA 1J2WA 2UV8G 1L0PA 1OFAA 4O57A 1JUBA 3VKJA 4O10A 1K7XA 3VE7A 3W1XA 4AHPA 5HR6A 2EADA 1SW7A 2QCMA 2BY0A 4NUWA 3D0CA 4Q4KA 2Y63A 2ZIDA 4GQRA 4CQ9A 1QPKA 4FLSA 5U4NA 3UXDA 3RIKA 3HBLA 1JCMP 1JD9A 3TQKA 1DORA 2BXZA 5KZMA 2ZX7A 3EXSA 4FIRA 2V9DA 4Q33A 1UD2A 3QC3A 3PB0A 1R2TA 4EF8A 1KWGA 3BUPA 4DO6A 4JTEA 1SZFA 1RPXA 3M07A 2D0FA 1H63A 1IZKA 1ZCOA 3O6CA 4NNAA 1IXPA 2BXVA 1EP3A 2EACA 1MVYA 3BUDA 4YXGA 4CLMA 2YOCA 5I23A 1OX4B 3WY2A 2WQPA 2DJLA 3BG9A 3G1VA 5F4WA 3K8MA 1PE1A 1XBZA 2VKZG 5KSWA 5EMUA 3G1DA 1EA9C 1BTMA 1G7VA 1GOXA 1H7PA 3LX9A 3CEUA 3LHVA 2WNZA 3FIGA 2V3EA 1W3IA 1ICQA 3F4NA 4NNBA 4UZSA 4JFWA 1SUXA 3EDFA 1W0MA 4K8EA 1XSKA 2Y24A 4YLWA 3DFSA 1WZLA 2ZUWA 4S1FA 5G5IA 1XL9A 4H8UA 4QITA 2J25A 4GWEA 2YYUA 1ICSA 5I3IA 4OKDA 1I2QA 5F1VA 1GYNA 3TSDA 3KLKA 3WJWA 7TAAA 3VMNA 1XCXA 3H54A 2DH2A 1XI3A 1GVOA 4H4IA 1LP6A 1OVDA 2X1SA 4K36A 3JRKA 1XM3A 5FEXA 3EX4A 1W1ZA 1JXKA 2CFFA 1SSDA 3SSJA 1I2RA 1BWLA 4LVFA 2X2JA 5AB3A 4YL2A 1EH9A 3GTNA 3GYEA 4I9AA 4UNLA 4NJHA 3WN6A 1TQTA 3A6OA 3WEMA 3OVQA 1KBIA 2OW6A 4JL1A 3P84A 2YIHA 3CZSA 2I9EA 5A5WA 1H7XA 1UA3A 2C6QA 3EXRA 4IMGA 4HOXA 3B06A 3OIXA 5H2ZA 5D33A 2DZPA 1R46A 3BAYA 1PIGA 3WY4A 1O5KA 1TIMA 4IQLA 5CG7A 3TW7A 4JR5A 2ZTKA 2WCGA 3N9RA 1N7KA 1P5BA 4O1DA 3WNMA 1EUNA 3OLDA 2WKJA 3PUEA 4LVGA 3G18A 3WJSA 5CLWA 5E9AA 3WMSA 1YYAA 4JNMA 1ONRA 4RX0A 5G1TA 3WJZA 1EHAA 2F1AA 2RH9A 1IIHA 3BLBA 4BF9A 3KOFA 3NQ8A 5D2YA 3M16A 4UIOA 3M0ZA 3MJYA 2VFDA 3P82A 3W7QA 2FGZA 4XB3A 8CGTA 4CKQA 5FEPA 4LVBA 1C8QA 3GKFA 2PE4A 5K9XA 4AEFA 3EWZA 1I8JA 4U28A 1F7BA 2G3MA 3CTLA 5HWNA 4LVDA 3W22A 4UTKA 5H91A 1R34A 1CGUA 2VELA 2ZRZA 4J3VA 1DQWA 3BLIA 2BWGA 2V81A 1BWKA 5K2ZA 3EXTA 3SECA 2OYMA 3AMLA 2RDWA 4EF9A 5AC8A 1KGWA 5LNSA 1MEHA 2V5LA 4JTSA 4N9DA 3IRDA 3QM3A 1LDCA 2PRMA 1ML1A 3FKKA 4FXSA 3L0GA 4I7VA 4N9EA 1JG9A 3KVLA 1LROA 3UG3A 1FQ0A 3W88A 3QJAA 1ZHAA 1FDJA 4MOZA 3ZO9A 3TONA 3USBA 2X1UA 3PUOA 1VQTA 4K8HA 2ZCGA 3W86A 1JDAA 3C4UA 2P10A 3TMQA 4JCMA 3DHFA 4GO9A 3M5VA 4YCPA 2QJHA 4GINA 3CWOX 1YDNA 1DJQA 3CGTA 1OJXA 2CLKA 5HUPA 1WO2A 2NX9A 1BEUA 1Z44A 3N34A 3I65A 1JCYA 4NI3A 1LBFA 4DBEA 2Z1KA 1XD1A 1M5WA 5K7JA 5DCBA 1NVMA 1TTIA 3KRZA 4UQBA 2D2OA 1NF7A 1QPQA 3UERA 2DZXA 1HT6A 2VEKA 3W1PA 3MWAA 3W7PA 2HMCA 1R30A 3TOPA 2WNNA 3W85A 2F2HA 3A21A 3PC0A 1XDLA 2Q3RA 4ORIA 1RQBA 4N9CA 1WDWA 1CIUA 1AL7A 3LRMA 5HWMA 1QOPA 3GBEA 1XKYA 1DHPA 2YFNA 3UZ5A 3NL5A 5KMYA 3TKFA 2GUYA 2J9ZA 3HQ1A 3V1PA 2HS6A 1SZGA 5HULA 5KZDA 3UWVA 1GVFA 5EA9A 1MSSA 4ZZ9A 4N02A 1QI5A 3DGRA 4DQWA 3M44A 2VOMA 3W1MA 1FY6A 2J88A 4CNOA 4LUJA 3GVGA 5HWJA 3NZ1A 1FBAA 3TJXA 4QNEA 1V3KA 4XZ9A 3A5FA 3OEXA 3PWAA 2EKCA 3IJ9A 3O6DA 1EPXA 3INPA 2E8ZA 1KW1A 3WY1A 1PCKA 4W93A 1EEPA 1TSIA 4LT9A 2PRHA 4TMCA 1QI4A 4E2OA 3PBUA 5CGTA 4GI6A 4JFTA 2V2CA 5AHLA 2F18A 2WPBA 4JX5A 4AYGA 5HMSA 1VCFA 3BO9A 2FFCA 4ADSA 3LPOA 1K7FA 4ALDA 1JR1A 1OT2A 3MI6A 5HDRA 1F2JA 4XWUA 4ADUA 2Y5EA 4RXGA 1JRCA 1SMDA 1B57A 3DHDA 2AQWA 4BA0A 3IVSA 4Y96A 3PVFA 1D3GA 1RQHA 4IWWA 3FAWA 1FCQA 1O94A 2ZDRA 1A5AA 4MLJA 1N55A 3GNNA 3W7KA 4L4MA 2R91A 3WFZA 5K4XA 5F2LA 1QW8A 3O8AA 6CGTA 1LTDA 1ICPA 4O1CA 4HOWA 2I14A 3LTSA 1C8VA 1SPQA 3O07A 5TBOA 2A1YA 2ZRVA 2EQDA 3VNZA 3PULA 2QCHA 1CXLA 3WK2A 2XN1A 1PAMA 4DELA 3B0UX 4N9BA 4JYFA 2YX0A 3UWUA 5BMXA 1E40A 1GVSA 1A5SA 4U33A 2BLEA 1JDDA 5EL1A 1JF5A 1TMQA 2ZRUA 4AEOA 1JF6A 2GJRA 2FB3A 2ZRYA 1AQHA 3NOEA 2Z2UA 4AVFA 1W5PA 2WC7A 3OLGA 1K02A 3G1SA 1O4UA 2YZRA 2H90A 2O7SA 2ZYFA 3TAOA 3EWYA 4O0KA 5F4XA 2ZRXA 3G1HA 3C0JA 1PIIA 3TX9A 4CVWA 1A5BA 3CU2A 5L6UA 3TC6A 2QV4A 3BPWA 1N8FA 1V3LA 1JCNA 4LV4A 2ZX9A 3EJRA 1VLWA 4LS2A 3EB2A 1A53A 4PA8A 1W37A 4B5NA 2TRSA 1XBVA 2CWNA 3CC1A 4AW7A 1AVAA 1VYRA 2ZUSA 1TPFA 4NJIA 3SI9A 2R8WA 1J0KA 1ZY9A 5I3KA 3BVJA 4XQ6A 1EO7A 3L2LA 4KFNA 5D30A 5A6LA 3S1UA 3DI0A 3S5ZA 1YTEA 3P61A 1WOBA 4RV8A 2H8ZA 1LBLA 1WAUA 2QAFA 4UQCA 3VX0A 2NX1A 4MPQA 4GKLA 4H2CA 4UMCA 4ONVA 4YWIA 3UWZA 3PB2A 3A24A 4WD0A 2J24A 5BMWA 1VRDA 3VSUA 1Z42A 3QQ1A 3GZ3A 1TQSA 3QQ0A 2A0NA 4Z1AA 5HJLA 4PEKA 2V3FA 1OYBA 2ALWA 1XXXA 2I1OA 4JX4A 3AJXA 3R12A 1B4KA 5A2CA 3C2VA 5ABTA 3UXAA 4J7RA 1MFUA 1VCVA 1QWGA 4JFUA 4A22A 4TR9A 3BAXA 4MAZA 3ZWTA 3KX6A 3SFKA 4LV9A 3CV5A 3P81A 3QF0A 1KCKA 4U2ZA 1WBJA 5FI8A 3CB8A 3W7OA 4LOCA 1B2YA 2ZRWA 4IJBA 4LVAA 2GQAA 2X30A 4QJ1A 3RILA 3QGVA 2QUUA 2NZLA 3WJYA 4H6KA 1B4EA 2JK2A 4BR1A 1DEDA 4HNTA 1HUVA 2RKXA 2W79A 3DU0A 1JVNA 4GUGA 2BY3A 1DKWA 2D3NA 5C54A 3TXZA 3G1AA 8TIMA 1C9DA 2VXNA 1TQJA 2DORA 2YGYA 2OSXA 2DZUA 2ISSA 4MY9A 3W1UA 3W2MA 1SFLA 4ATWA 1PHQA 1CW2A 4RZ4A 4UMAA 1Y0EA 3TSBA 1MW0A 2WO5A 4O14A 2C8NA 2YJQA 4O4WA 1VC4A 3S8HA 3O63A 1KTBA 2PWHA 5A6MA 1OX6A 3OVPA 1E3ZA 1CPUA 3CEPA 1UH4A 2GVJA 3C2RA 4MZ8A 5DY2A 4TMBA 3BUBA 4MY8A 4IPJA 1QHPA 2VFFA 1QO2A 1TQUA 2WVSA 1OHLA 3GXNA 2OT1A 3L2MA 4MFEA 3P8JA 2VC6A 1XSJA 3IIXA 1G94A 1P0KA 4NXKA 2ZZ1A 2BY2A 4R33A 5CZ0A 3STEA 4IXHA 1H50A 4O1AA 1Q3NA 4GQQA 3H55A 4UTUA 5LNRA 3ZOAA 5CPNA 1XFBA 2Y89A 2OYKA 1F76A 5DELA 1TPWA 4K39A 4UTWC 5I24A 3FJ6A 4XBSA 2VR5A 4LC6A 1MXDA 1U83A 1TO3A 2QCFA 3S6DA 3W6YA 5BNKA 4UQDA 5EPDA 4EWND 3VM7A 2CZFA 3TXVA 2EHHA 5LNWA 3C2FA 2R14A 2FLIA 2PC4A 3A4AA 2Y62A 3WDIA 1PS3A 4NNCA 2Q8LA 1CXEA 3W38A 1U2YA 3FEMA 3CLWA 3R5EA 2FHFA 4O53A 1F73A 4GBUA 1EP2A 5FF3A 5AFDA 1MWOA 4IXXA 1FWWA 3L21A 3KL0A 4WX2A 3D52A 2JGYA 2RFGA 2DZVA 2CXGA 3C6CA 3TC7A 1HWWA 1HTIA 2WNQA 4NU7A 3BMVA 2GQ8A 1NEYA 1XH0A 4NT0A 2VUYA 3QMTA 4FO4A 4L4LA 3LTPA 3B05A 5E1QA 2A7PA 4A3UA 2QCEA 2YA0A 1YLVA 3IIPA 2VRKA 3WNKA 1TV7A 1RV8A 2WOQA 2BXYA 3Q94A 3NVTA 2BY1A 3LM7A 1UKQA 2ZICA 3LV6A 3NQCA 1J5TA 3R13A 9CGTA 2JKEA 2WVTA 4AXKA 1U5JA 4GI8A 5FEZA 1X7FA 3DAQA 2X2HA 2TPSA 2ZXDA 3FAXA 4O52A 3M7WA 1ZS2A 3RNDA 3P5ZA 2ZX8A 3C56A 4X0NA 4UTIA 4JIQA 1TB3A 4HHPA 1WV2A 2E1DA 4O54A 2Z6IA 2DP3A 2EEXA 1I2OA 3VE9A 1G5AA 1W5NA 1KLZA 3MP5A 5HPOA 4PCSA 1TPB1 1XCFA 1BLIA 3YPIA 4IOTA 2FDSA 2XN2A 3MBFA 5FF2A 1WZKA 5CPMA 4J9JA 3BMWA 1W3TA 1CI1A 3IV3A 3L4UA 1KM2A 3A23A 3TU9A 4HNVA 3KRUA 3N3MA 4JIPA 3S5NA 3T55A 1TPDA 2HTMA 2G95A 5HXMA 3SW6A 3C3NA 3BUQA 3OVRA 4Z0SA 1TMHA 1LWJA 1VAHA 4RCXA 1LBMA 4WY0F 2FTPA 1WA3A 3TROA 3C52A 3PS7A 5AOUA 5E70A 2VENA 3UPBA 5E93A 3GX9A 4ZVJA 3GDMA 4BWLA 2XWEA 1L9WA 1HXKA 3W1NA 3IIOA 3L0KA 4KMQA 2B0MA 5I3FA 3CM4A 3HGRA 2CHNA 1EX5A 4O4VA 2QDHA 1G6CA 2QCLA 1FWTA 4MJMA 1XSIA 3M43A 4KWUA 1KBJA 3TA6A 4ZQNA 2WKGA 3W7GA 3FYOA 3DX3A 4O28A 4LUIA 4WY0A 5D37A 5D32A 3GXMA 1CXIA 3AMKA 1W54A 2ZXQA 3BAKA 1K8YA 2B4GA 3UY8A 3LCGA 1BVNP 5E0KA 4HA1A 3TK7A 1OFPA 1ME9A 1QHOA 2J6XA 3GXTA 3N9SA 1WE5A 1NSJA 4BWLC 2ZE0A 5CXPA 1BVZA 4AIOA 1OFDA 3M5ZA 5F7UA 3HG3A 1XUZA 5U7SA 4CNPA 5DLCA 1RVGA 1DJNA 3CPUA 5HINA 3P8IA 1JRBA 4UCGA 1DTUA 1KBKA 1AL8A 1T8XA 3BVUA 1ALDA 4JTLA 4XTDA 1DQXA 3G0XA 3ECQA 2FE0A 5FEWA 3NPWA 3N19B 3P62A 1OFQA 3W7JA 1KBBA 4PC8A 3THAA 4DPQA 1TJRA 3MYPA 1EB3A 5LSMA 4MJZA 2OZ0A 4N4QA 2D0HA 2EPHA 5F4SA 4QAWA 3GNDA 4MYAA 5G2WA 1TRIA 5IM51 1PHWA 4UTHA 3CLMA 3MHUA 4LTSA 1GT8A 3DHPA 1I4NA 3LTYA 2FPTA 5D04C 2NUXA 5CZJA 2TAAA 1P6WA 2E68A 1SZEA 4HN4A 3P67A 2ZZ5A 1LRNA 3I7QA 4I7WA 1Q6LA 3L67A 1S5VA 1KFEA 3PSWA 1F6PA 4TX9A 3DC0A 3NQMA 3L68A 3C2EA 1SU5A 1B9BA 1V5XA 3W72A 3ANYA 3VGEA 2PURA 5KTLA 2NUYA 1WPCA 3W7MA 3WK1A 3EDEA 5EBUA 1Q4NX 3EJSA 5D2WA 4BK9A 1KB3A 1GEQA 3BGJA 1EUAA 1XH1A 5E0FA 5D2XA 4JDBA 1ZAIA 3UG4A 4UCFA 2GVLA 4OBTA 1LORA 3BVXA 3BAWA 3R2GA 3LXCA 2VEMA 3N2MA 4BFAA 3FW6A 4GIAA 4WSKA 2NXHA 2OJPA 1FX6A 2Y2WA 4DEFA 2DZWA 3NQAA 1ZJBA 4JEQA 3WNNA 3EWWA 1Z32X 2YW4A 3UWWA 1O5XA 2F1BA 4DO4A 3DH7A 2QCGA 2EABA 1VJIA 2F84A 3STGA 1FDYA 2C19A 1KXHA 4FB7A 1EWDA 1G1YA 4CCCA 3HMJG 4UXDA 3S1WA 2GPTA 3TNOA 3QSRA 1S5TA 2KZHA 4J3TA 1CXKA 1QOQA 6TIMA 2Y7DA 1G69A 1GJUA 3VNYA 3M47A 5T26A 1PCWA 5I3JA 3G1FA 3F1QA 3HOJA 1HNYA 1W3NA 3BV4A 7TIMA 1CGTA 2V8ZA 5C55A 3M6YA 4LXFA 3B4UA 1AW2A 3BARA 4QNWA 4PEEA 2PWGA 3IJ7A 2QCDA 3BC9A 4AIEA 3W2NA 3MW7A 1BG9A 1ZENA 1UD3A 1VGAA 3U8GA 1TPUA 2WNWA 1ZJIA 2ZTJA 2CW6A 1JXJA 3W7EA 4FX8A 4X3ZA 4HP5A 3ZSSA 2A7NA 1QPOA 3PUDA 1XBXA 4JTGA 3HGOA 1YPFA 1UKTA 5I0DA 2V5BA 1H7WA 2OT0A 3L4YA 2WSQA 3FYPA 4XKYA 3CTTA 1HL9A 4Y8FA 5KEZA 1XUUA 3ZS4A 4NX0A 4LRSA 4WSJA 2C13A 1VFMA 1XH2A 4DBDA 3BAIA 1KXQA 2QMKA 4J27A 3NQ6A 4X22A 2CLEA 1WOAA 3ABSA 3PF3A 3WNLA 3HO8A 4Y90A 4QM1A 3TW6A 2CZEA 1FWSA 4FF7A 4UNKA 3LERA 3O1NA 3E9AA 2YYTA 3MHFA 2JBMA 3DFQA 5CLTA 4AHOA 3KL5A 5AYZA 1TCDA 4WY0B 3ZT5A 4EVZA 5LGZA 1O95A 1AW1A 1UUMA 1ZFJA 4BI7A 5CZTA 1G4TA 2ZZ7A 3UWQA 5CGMA 1KWKA 5LKYA 3BGGA 2DZSA 3FJLA 1QO5A 3LV5A 5DN1A 3QRHA 2NX3A 4B9ZA 1DOSA 1JUEA 3TH6A 3NZRA 4UC5A 2EAWA 1M53A 4GO8A 4LQ1A 3DHUA 1G4PA 3M9YA 4JYDA 1JCXA 3IIZA 3IEBA 1Q6RA 5DO8A 4JDYA 1UH3A 1AMKA 2W6RA 1SFJA 1Q45A 3UYCA 1SR9A 3GDRA 3BUIA 1BF2A 4IPIA 2WCSA 4JICA 1EIXA 3GBDA 1MEWA 4E38A 2WVVA 4JGDA 3LCIA 2CLLA 3M5YA 3I68A 2XN0A 3D4ZA 3MBDA 2EAEA 1W5MA 3LHYA 3WEOA 4MLRA 2OW7A 1JUKA 3RMJA 1K8XA 3VGFA 1QAPA 3WELA 2A85A 1PZ2A 4AWTA 1BKSA 3ATYA 3LRLA 3HZ3A 4MY1A 3UQNA 4O11A 5FESA 1LLZA 4ML9A 3EX6A 3TR2A 4WXZA 2YKKA 5AYXA 1TPEA 4ADTA 5CSRA 2F7OA 2ZZ4A 4JL2A 3L65A 1I2NA 2QPUA 3W2JA 1KXTA 3W2LA 1CXHA 5BOOA 2OSWA 4TVUA 4CN1A 3NQGA 4IX0A 3ELFA 5EY5A 4J3UA 1WX0A 1XBYA 3W2KA 3UEQA 3N14A 1QPNA 4E0CA 2XIIA 3QH2A 4JFVA 1J4EA 3Q58A 3RFAA 3EWUA 3U6WA 3E02A 1Z48A 2PCQA 2V3DA 3PM6A 1QX1A 2OCZA 3L2IA 3BCFA 1HL8A 3SJ3A 2E5CA 5I5RA 1IZJA 3BW3A 5J5RA 1Y7VA 3W7NA 4UQ9A 4Y6GA 1RZMA 2Y88A 3PSVA 1F6KA 6TAAA 1HTYA 3DDFA 4M6VA 2GJPA 3CWNA 4N6FA 4QQ3A 4K7VA 3CZLA 3NQDA 3OBKA 4UFHA 4TO8A 3MI3A 1UD4A 3S1VA 5SWUA 3SGZA 5CGQA 3EDDA 1TRDA 4NZFA 2Y7GA 1QDSA 3AJ7A 3G3DA 1R47A 5E6ZA 3VMOA 2ATMA 5D02A 2GJLA 3WK0A 5HR7A 1H3GA 4UUIA 4PODA 5BRBA 1TYGA 3ZWSA 1FXPA 3IVTA 3P60A 1K8ZA 3MO7A 4GFSA 5F1UA 2AAAA 5A2AA 4NXSA 4H8HA 1OK4A 2EO7A 1L6SA 3VGGA 1FDZA 1MZHA 2H3BA 2YA1A 3QMRA 1OGSA 1V7YA 1P0NA 3NXFA 5D09A 1CGXA 3DXIA 1FWNA 1TQWA 1G4SA 3C8FA 5D2VA 2QCDB 4DF1A 3W83A 1SW0A 3ZT6A 3DI1A 3CHVA 2YW3A 1LM1A 4IGHA 4UTJA 1J0JA 3KRSA 4X2RA 2GUUA 4M7SA 3QPZA 1FCVA 3FOKA 3TQVA 4AMAA 3QW4B 3TFCA 3CIWA 1GTHA 2FB2A 2RDUA 1Q6QA 2QKFA 2ZUTA 2DIJA 2CZDA 2XVLA 1LRQA 4O13A 4XBKA 3VSVA 3UD6A 4XKYB 1JAEA 1T96A 4O8RA 2QAPA 3BLPX 3KVMA 2YCEA 4UOZA 4KFPA 2WKLA 4AAJA 1IGSA 3HGSA 3MP3A 1MW1A 1RPKA 1KM3A 2C1HA 4O12A 3Q2DA 5F2MA 3SIZA 3F4WA 4AMWA 2ZXAA 4OV9A 2ZZ6A 3W07A 5D2TA 3WJXA 3ZR4A 3FFSA 3LB0A 2QUTA 5G1YA 2CLHA 2WSKA 3LXAA 1LOQA 3S9YA 2XFWA 2A4AA 3IIVA 3MHGA 2FQIA 4AYSA 3LBMA 3LLFA 4HOZA 1UKSA 4K37A 4JTFA 1MW3A 2C18A 2Z0IA 4RXFA 1TQVA 2VNCA 1SQ7A 4EOUA 5DXXA 4QIUA 5F2GA 3HG2A 3P80A 4UQAA 3MI2A 3NL2A 3B8DA 3KFTA 2B7PA 4ICNA 5K9DA 5DXYA 2OSYA 3IGSA 3TQ0A 4JTUA 3BLEA 5BRQA 3NGJA 5I3GA 4M56A 4OGZA 1I2PA 3G0UA 3QZEA 4U3CA 1SZNA 2V0TA 4PL2A 1LOSA 3SR7A 2X2GA 4UTWA 3SY5A 3SZ8A 1H7OA 5HUOA 5LGXA 2E0PA 1KFCA 4XTIA 3NQVA 2NV1A 3WFAA 5E6YA 1U30A 4UFIA 2WVVB 3BVTA 5K9CA 3OHIA 3GR8A 4MKNA 3G8RA 3W1LA 2VEPA 4MIMA 2QEZA 2B7NA 1CLVA 4FNUA 3L4VA 4OE7A 1OK6A 1O60A 4K7YA 5FF4A 1VS1A 2G5WA 1BAGA 4QAIA 5K4ZA 3QW3A 3G3MA 2ZWZA 4GRSA 1KLYA 4FLOA 2NWRA 2YDAA 1WYIA 2WVUA 4FNRA 1THFD 2H3DA 3S42A 2Y4SA 3GAYA 3KE0A 4OV4A 5IBXA 3TIMA 4LS1A 4BI5A 3KXQA 1CGVA 4JY9A 1YPIA 2E6YA 2Y7EA 4IX2A 4Z1BA 1VR6A 2V2DA 1ADOA 1D3CA 1MEIA 3TTYA 3LHWA 3W84A 4HSOA 3EKZA 1OF8A 3L66A 5GVJA 3NDOA 2XVKA 1UA7A 3LRKA 3TTSA 1KTNA 4BI6A 2QDGA 3HGJA 1R75A 2E09A 4Z1DA 2F7RA 3IGXA 3PG8A 3EDJA 5IBXC 1D3HA 3U2OA 3LBCA 3AXHA 1SO5A 4N2YA 3B03A 3S5YA 1UH2A 5A2BA 2JKAA 3DZ1A 1HVXA 4UFLA 2FHCA 2RDTA 1VYSX 4NJKA 1MW2A 4E2BA 1GTEA 2E77A 3G1YA 2FJKA 3NG3A 3KVKA 1UD5A 3LI0A 3NEVA 1D7FA 4R53A 1TTQA 1A47A 3G8EA 1KGUA 1LRTA 1VCGA 1VHNA 4A21A 3L9CA 1YXCA 3UZJA 3LPPA 3GXFA 2YR1A 5CPLA 4RR4A 2Z1BA 2FH8A 2NWSA 1H61A 4WF7A 3Q37A 3S0CA 3BK0A 2B7OA 1VYPX 5G4EA 1FCUA 4OQVA 3LLDA 4PTNA 3STCA 3QSTA 4XUGA 1GWJA 3K1DA 3GAKA 3EJPA 1FCBA 2X1TA 2NXGA 2Z6JA 4JTKA 3KHJA 1MFVA 1SO3A 3LCHA 1GQNA 1KM0A 3W76A 1JCLA 3N73A 3T4CA 5G2HA 1XV8A 4AWSA 1TTPA 3CZGA 3TSMA 3VMPA 4K38A 1H7NA 1OG0A 1WZMA 3K30A 2QJGA 3ZR5A 3KAOA 4FXRA 3UPWA 3FA5A 2NUWA 4A2SA 1BPLB 2P0OA 1YTDA 5D03A 4FNTA 3DX4A 4OJYA 3UCQA 3BCDA 3IGUA 3NPXA 1KFBA 2GVYA 2Y61A 2ABAA 3DENA 4R7JA 3GR7A 3L0NA 3NPVA 1W31A 4H8VA 4RZ5A 3A9IA 2D0GA 3O06A 4J28A 1JIBA 5KINA 1DV7A 3UNDA 4HPJA 4Z08A 1SW3A 4MZYA 4D2JA 5J5DA 1JD7A 1PEZA 3VU2A 1KFLA 3LHTA 3MP4A 7CGTA 3D50A 1V3JA 3HPSA 1CGWA 1QCWA 1OFOA 4ZQCA 3G0SA 3VGBA 2E6DA 2E9BA 1ZJAA 4AEEA 5AHEA 2BTMA 4X9SA 4CCEA 2J27A 2WPGA 5DFAA 2NLIA 1KM4A 4JX6A 5CPOA 3L4ZA 1TPH1 4JD4A 4H7VA 4CCDA 3LOTA 1KGXA 3W70A 4ZQOA 3WNPA 1GVRA 3G1XA 3ZSTA 1X1OA 1ZAHA 1TV5A 4AF0A 3UG5A 3ABRA 1NM9A 4WJEA 4FLQA 2F7PA 1JI2A 5BRPA 1Z41A 2NT1A 2ISVA 1JQVA 2FPYA 3UWYA 3WENA 4RJEA 1AMYA 1H5YA 1VH7A 4CNNA 1E43A 1GYLA 3FKRA 1XC4A 1WXJA 4P2VA 4PH6A 4YMZA 1XD0A 3DDGA 3IK2A 3IVUA 1JQXA 3BSGA 3GXDA 1UCWA 3O6YX 3AO0A 4KWWA 2A6LA 2R94A 3B0VC 4UQEA 1F5ZA 2Y7FA 1EP1A 2F7FA 3VFLA 3VO0A 1T99A 3LI1A 4MB1A 3I6RA 3R89A 3HJZA 1CYGA 4JFSA 1YDOA 1XDMA 3JS3A 4HKPA 1VFUA 3DX2A 3EDKA 2WSRA 4IMCA 2BSLA 4FNSA 4RK8A 4CN6A 3HPZA 4FNQA 2ZZ2A 4IMDA 1VZWA 4J3WA 4HIBA 3CZNA 2GOUA 1I75A 2RHGA 5HNRA 2IQTA 3RU6A 3M5XA 1FWRA 1G7UA 1AW5A 2J9YA 2QJIA 2ATSA 1VLIA 1ZNNA 1VHCA 2Q8ZA 4OWGA 2AAMA 3ABQA 2B7QA 4AMXA 3A5VA 2BZNA 1MXSA 1O7DC 2ZFAA 4JCLA 3EEGA 1L6WA 1DL3A 3O15A 1GG0A 3W3OA 3DFTA 4WZHA 3HG5A 5BW6A 5TD4A 4MVAA 5C2XA 2EJ1A 2A7RA 3NQ2A 2BHUA 1XGZA 1W5QA 2QUVA 2TSYA 3GDKA 3W1QA 3VGDA 1LWHA 1EO5A 4UFMA 4FX7A 4PSPA 1H51A 3VCRA 1P4CA 1JL8A 2XWDA 4QSHA 4Z1CA 5FF0A 3DKLA 1TPVA 3EX1A 2A6NA 3TDFA 2TMDA 1PIFA 1AK5A 2QCCA 2YXGA 2BX7A 4JTIA 5AHNA 1OSEA 2EF9A 3W7DA 3ZR6A 3L5MA 1RP9A 3GB6A 1W8SA 4H3DA 1GCYA 1UJPA 2JGQA 4FHAA 3H53A 1OB0A 1K7EA 4GE8A 4POCA 4UZUA 2C3ZA 4LRTA 3S2CA 4FMVA 3C61A 4RZ6A 1H62A 3LCWA 2ZX5A 3BW4A 3NPUA 4IMFA 3T78A 3KLLA 3FS2A 1JJKA 3DFPA 2E8YA 2ZQ0A 1ZAJA 5CSSA 2V30A 3W9ZA 4BZYA 3W1RA 3WDJA 1PVNA 3LGEA 1H1ZA 5DBTA 1S46A 1GJWA 3W7IA 1UB3A 4GXMA 4NJJA 4CN4A 3N2XA 4UFJA 2Y6ZA 4WUIA 2ZWYA 4WOZA 5FF7A 3R8RA 2DZTA 3EKLA 4CGTA 3CZEA 3KWXA 3NYZA 3STFA 3W87A 1EA0A 2NT0A 1PS9A 4HSNA 2OMAA 2YSWA 4AB4A 3B04A 4JY8A 4R34A 1UOKA 3EWBX 3TCEA 1WBHA 5D05A 2ZX6A 1C29A 4O15A 3BSHA 4J3XA 4NZJA 3VX1A 3AXIA 1HO4A 4HPXA 3DX1A 3K8KA 2DJXA 4A29A 1TJPA 3DFNA 3MMTA 2ABBA 2D3LA 2FH6A 2QR6A 3NR0A 1QNVA 2ZZ3A 3WY3A 1W56A 2A5HA 1HL2A 1V3MA 3WNOA 4KWVA 1NF0A 2VRQA 2E6FA 2V82A 3THQA 1HFBA 4DO5A 2FHBA 1JFHA 3QYQA 2WSPA 2X1RA 3NA8A 1IF2A 3PG9A 1CX9A 1EWEA 2Y85A 3DX0A 1GPWA 1LOLA 1OFEA 4FLRA 1VIWA 4ZQRA 3TAKA 2HS8A 3W73A 4AF0B 5LZLA 2YPIA 1ZALA 2QCNA 2QLYA 1M7PA 5EKYA 3QMSA 1W9XA 3HIJA 2AMGA 3O05A 4LC8A 4LW7A 3W1TA 4CQ8A 1IXNA 2V2HA 3VI2A 3DFOA 2OYLA 2Q3OA 3T7VA 3RLVA 4OT7A 1FXQA 1GZGA 3BVVA 3S5OA 5G2IA 3TJLA 1NOFA 5F2IA 4LWWA 3FLUA 1X1ZA 2DIEA 1VJSA 2ZA1A 1JI1A 1QW9A 3W75A 4GUJA 4KKXA 1YXDA 2A21A 4FNPA 1A50A 5DBUA 1NAL1 2A2IA 3PBWA 3NO5A 4EIVA 3NQFA 4U2YA 4ZQPA 1GG1A 1H60A 1KCLA 4QISA 4IMEA 4PSRA 1QWNA 4UMBA 1YADA 4NX5A 1ME8A 3BH4A 3ZQ9A 2LLEA 3VM5A 3BLFA 2CPUA 4X9YA 3W23A 4GI9A 3LHZA 2ALDA 2CLIA 5LHEA 5DCDA 1KM5A 2FPVA 3D51A 1W5OA 5I3HA 2ZA3A 2H6RA 1S5WA 1UD8A 1AQMA 3QPYA 4GNJA 3GDLA 1VPXA 3KEHA 4B9YA 1CDGA 1WQ5A 3CQ0A 3GK0A 4UTMA 1T0OA 5C6MA 4GUIA 4DF0A 1UBSA 4WXYA 1KV5A 1GVIA 1DHKA 1B3OA 3LDVA 3NQ7A 1H1YA 1G67A 2C0AA 3TFXA 1E3XA 5AN7A 2E5BA 3CT7A 1I45A 3W74A 3LHUA 4PCFA 3BLKA 4RLIA 1KXVA 5LNUA 5DY3A 1QI3A 1OFRA 4IUOA 3K8LA 5EMYA 4M8UA 1IXQA 1YDVA 4WQ6A 4FX6M 1SO6A 3PBYA 3RLUA 3OG3A 3TV8A 1YTKA 1M7XA 4JS3A 1G4EA 4MZ1A 2EGZA 3LCLA 2CZ5A 3QFEA 3NM3A 1M7OA 1OABA 1R2RA 3HJEA 1JGIA 1ME7A 3EWXA 1OF6A 3D4YA 2ISWA 3CZKA 4N6EA 1JCJA 3CIXA 3A22A 4WLCA 4RKAA 4TIMA 1CXFA 2YFOA 5EYWA 1RQEA 3BG3A 2H8XA 3EJTA 3P74A 1R33A 1UD6A 3W71A 4GJ1A 4NJGA 1TCMA 4KFOA 3II1A 2BHYA 3EJUA 3W37A 1LCOA 4M5PA 5CZSA 4JXCA 1DVJA 2E6AA 5HQEA 5L9FA 1PV8A 5TIMA 2YA2A 3I7SA 2NXIA 1KA9F 3LXBA 4HT3A 3ZFHA 3GIYA 4ORMA 3JR2A 3S1XA 1D9EA 3GXIA 2HSAA 4PL1A
chains in the Genus database with same CATH superfamily
4GUCA 2ROXA 1OWWA 2HVBA 3C60C 2WM0A 5D7IE 4QY8B 4PJCA 4DN4L 1M3UA 1GIGH 4NG3A 3NL6A 2Q2LA 1E9OB 3EGJA 5I6NA 1M7IA 2ORBL 1LHZA 2D7TH 3RPDA 5KG9A 3MNMA 2ZG2A 1UOWA 2P5WA 4MNLA 1V93A 3N55A 1MCPL 3UZEA 1EEQA 3TF4A 1I8MB 4M6PA 3NIGF 2G60L 1T22B 1LP9F 1ETZA 2OZ4H 3ITVA 4KOBA 4M7JL 4N8VG 2Z1SA 4TYUA 3F7KA 4CD6A 4YK4C 2ITDB 3KWUA 1LZOA 3EBVA 4O9HH 3V36A 3B5TA 6A3HA 2Z35A 2G9HB 2PCFB 1Z9LA 4UYPA 2AJ3A 2EDRA 4AHQA 3OVGA 1T80A 5HOSA 4EK7A 4YHOH 4G1KA 4KKQA 4AH2B 2PNDA 3KPQA 4OSUL 4IU2B 3BV7A 1XAUA 3GHEL 1UKPA 4V2CB 1O9VA 4NIRA 1P1XA 2WJZA 5IFAL 3U82B 3E0IA 4KW2A 4PJBA 4LOUC 5SWZE 1LK2B 4ABWA 3ELQA 2HSIA 2NQLA 4X4YB 1ZT4A 3W7HA 5JQ6L 3KCPB 3HLAA 1KTDA 4BFGA 4XGZA 4KRZA 1F4WL 3TIDA 1NCTA 2J5LC 2PU1A 3SPJA 2ALAA 3FTGB 1KN4L 1OM3L 3IFOB 4C7DA 5J13C 4ES4A 4RMSA 3BIKA 4I0KA 2WV8A 2Q3AA 4X2PA 3RHWK 1C82A 3AICA 2DV6A 4PRHE 4G7YH 4P3DB 2FO4B 4ZTPL 3BD3A 4UIKH 2YCLB 4BUGA 1GZHC 3VE0B 1OD0A 1ADQL 3MSYA 2XV6B 1ZGLB 2IQAB 3SCRA 3BUPA 4XNYH 5TQ2L 3CBRA 5K1VA 1H63A 4MCMA 1UC6A 1IXPA 2BXVA 2OXGA 4PJ9A 5KSWA 1F97A 2GFBB 5M1TA 4JIHA 3BXNA 1D2KA 2C9RA 1M71A 4NKCA 3C8KB 4NZRH 2GIXA 1TE1A 5SX5H 4PJ5B 4KQ3L 4QITA 3RUGB 3SBFA 4YHEA 3VMNA 1GVOA 3TEYA 1IM9D 4PQXA 5IVZA 3N0PB 2CFFA 1S7UB 1ZHBB 3URQA 4R2GB 3UBXG 2Q3ZA 1VFBB 3VTAA 4O02L 3TZFA 1TQTA 1IGWA 3A6OA 3WEMA 5IKCB 5DJ6A 5D6CB 2A9CA 3D07A 1FFOA 5B1CA 1BQ5A 1UJ3B 1XF4B 2PNCA 3HFFA 2XG5A 1O7AA 1P5BA 2NX5B 3QXTA 2I25N 5DFTA 5E9AA 3WS6A 2CR0A 5IROC 4UOW1 4MNHB 4BF9A 3WMLA 4N5EC 4ONFH 3M0ZA 3L3DA 8CGTA 2P5ED 3AITA 2GB2A 3NJLA 2BIPA 4JFDB 5DVPA 3NURA 1MMXA 1QZ1A 2FATL 4J3VA 2MKLC 4V33A 5EULV 5LLIC 1U8MA 3RHWF 4AX3A 3HG1D 1DDTA 1EGMA 3GD6A 2RDWA 1FPTL 3GLEA 1KCUH 3JV5A 3IRDA 1WAPA 4RQQA 1I7ZA 2B81A 3O8XD 3E8VA 4ZMNA 2QVTA 4XVEA 1IFHH 1JDAA 3NAAH 1MH5A 2PTYA 5DJDA 3M5VA 4GINA 4IK6A 5HHNA 1FNFA 1EJ6A 1DVFC 1HKIA 2Z1KA 1OP4A 5K7JA 5DCBA 3L6FA 2XH4A 2YQBA 1EDGA 5CJQL 3QZNA 1EAJA 1FZMB 4BWUA 4ORIA 2L3BA 3NDYE 1C92A 1OIOA 2BVWA 1FE8H 3UZ5A 1Y65A 3K74B 2ITCA 2V5TA 3EXJA 4X5RA 4CNOA 4ZUUA 5JBEA 1H0GA 2AZUA 4OFQA 2F0CA 1LVNA 4XMLL 4J3OD 2HLAA 4IUGA 5B21A 1NGXB 4UV4H 3EAUA 4A2LA 1UM4H 3RB5A 3W56A 2FVNA 2WW3A 1K2DB 3RX5A 3WLBA 3LPOA 3BOLA 5TH2B 4R5TA 3AWEA 4J12A 4KV5E 4ADUA 2NW2B 1SMDA 4BHUI 3DHDA 3GSRA 3MLRH 1LO5B 2AXHA 1W1YA 4PMYA 4F8TA 1LTDA 2HFFB 4ZUSB 5A8PA 3LTSA 4BINA 2EQDA 3WK2A 1WHPA 4I5XA 4IRSC 5AVRB 3KBEA 3L3OA 1EF3A 1GVSA 4XBMA 3W81A 1T6WA 4MA8H 3ZZ1A 1P1VA 3M17A 1I9CB 5BQDA 2EJAA 3ULVE 4LKCA 4BCZA 1Q0YL 3ECBA 1A7PH 4X7FC 1N82A 2RACA 3V35A 4TSBH 1QRNB 4S1RL 1YEHL 3Q9QA 1OE2A 1DQDL 4LSQH 4ZFFB 3SI9A 5JW5B 3HMCA 2Y1VA 1INEL 1O0VA 5I16A 1IILE 2RGMA 2NX1A 4MPQA 4P4RB 4QWWC 4ZUTA 5ITBL 5IP4A 5HJXA 1P5UB 3UCDA 2CBJA 2V3FA 5CD5D 2VLJD 1BXAA 1KLUB 3BAXA 4JFHD 2WLJA 1E9QA 3VIFA 1S3KL 2WP3O 2X30A 3ULSB 3HE6A 4QXTA 3P4NA 1I1AB 2X8RA 3OP2A 3OF6D 3S9DB 3GSQA 4Z2HA 2MEJB 4E9LA 4C91A 4CSZA 2IDUA 4ES9A 4XH2B 2WO5A 1NC2D 2PYEE 1IBFA 2BNQE 9XIMA 4KROC 1QA9A 3KOZA 2DQHL 3NZQA 4YE4H 5EU6D 1QHPA 1KJVA 2CMRL 5DQ9B 2ZZ1A 4WDIA 3ARGB 1R3VA 4JHWH 5KVEE 1TO3A 4UQDA 3QARA 3TXVA 3C2FA 2RFXA 3A4AA 1PY9A 4NNCA 1U2YA 1RWAA 1D6ZA 1YNKH 3TZVA 4HIIA 1QNRA 4E8CA 3QUKA 2FVLA 4WV1C 1YW1A 1JZ4A 2BP3A 3BLCA 4PGJA 2KLRA 3PQYB 3BX7C 3WNKA 4LALA 3HJ0A 2LVCA 3U25A 5BVPH 1XFCA 4HCDA 2ED9A 1XR9B 5IUSA 4TUFA 3SCMA 3T09A 1YN7B 1J8VA 4P48A 3CSPA 5D1ZI 4YTTA 1U4FA 1ZLEA 5HY9A 3VH8A 4UTIA 2C1OA 1D2OA 3FQTB 3RQ3A 1I1FB 3ARFC 1W5NA 1FHNA 4QE5A 5T5FL 3BPNC 3NXLA 4GW4B 5EZIH 3TU9A 3HBZA 3UYRL 3I6LE 4N8PA 4OUOA 4Q6IB 3FT2A 1AQDB 1JNHA 3MA7B 2JVUA 1MFEL 1CZ8H 2ZKXA 5JTWA 3DVGA 4DFHA 4KMQA 3MSGA 2JF6A 3ISWA 5AALA 2NNAB 3M43A 4NRYB 2P80A 3EJYD 2FYMA 3AMKA 1K8YA 5AVSB 4OSUH 4DYJA 4U10A 2F53E 3GXTA 3TVMB 3HG3A 5HTSA 5J7CC 3ITYA 4LCUA 5E6SB 4ZT1A 3V5OA 5SWQA 1EB3A 2IFFL 3WTXA 2DI7A 2VD9A 1X1HA 2F54B 1MIML 3OZOA 3T8QA 4U1GB 3U0PA 2AV1A 2AJVL 2V9RA 3GBML 4Z78A 1ISXA 3H2FA 4LHUB 1Q9OA 3L48A 5JXAH 2NY2B 3AS2A 2YGOA 1E9PA 1SU5A 4HHGA 1UWUA 1RLDA 1WPCA 4LLDA 1UZ8B 1JHLL 4Q8WA 4ODXA 5EBMA 5E0FA 2XG4A 3IANA 3MWCA 4PV1C 2W0PA 4PLJC 2INZA 3JQOB 1XIIA 4JEQA 1L9PA 3RRQA 3UWWA 2NTSP 4ZTOH 3ZGIA 2FR4B 1GZQB 2CBUA 1BWWA 4PAZA 1S5TA 2CO7A 1LG2A 2ADJA 5J8LA 3MJ8A 3T71A 1TV3A 1E42A 2HN7B 5EO0B 3O6KH 3KWWA 5FS5A 1DVFA 1LNUA 2LR4A 3EMZA 4UIMB 5FIPA 2QCDA 4X99B 5DJ8A 1UD3A 3BWWA 5I6SA 2E7DA 3N2BA 2W0KA 3W7EA 4X3ZA 1NKRA 1XBXA 1J1OH 5DR5L 3V4VH 1YPFA 4FKKA 5EOCL 4H41A 4DP6X 4LRSA 2WN2A 1VFMA 1AP2A 4XXCC 2A0LD 4WI9A 4QE1A 4PJGE 4ERSH 3WNLA 3QNFA 5F44A 3PIQB 1OOAA 3UEZA 5CNHA 1SFTA 1FVCA 2H3NA 5AZ1A 4WHTA 4M61B 4AHOA 3EADA 4V1XA 4QRAA 5D1XA 4OV6F 2EDMA 1VGKB 3MZTA 1QZNA 4RMBA 2Y1ZA 1JCXA 4JDYA 1UH3A 1JPHA 3UYCA 3U83A 4IP7A 5I5MA 2H8PB 1EIXA 3K6IA 1QEWB 3GMMB 5CPTA 3D4ZA 4KFFA 1XQLA 2PTUA 5IG7A 4WJ8A 3QIUB 3SCSA 1JUKA 2WJFA 5J12C 3WELA 2IDQA 4IRSA 3LRLA 3EX6A 4G5ZH 2P47B 3OKMA 1BQSA 1CR9L 4IX0A 3T8MA 4UDUB 4JQ2A 4JLRB 5C8BB 4J3UA 2F5BL 2YBTA 4JY6B 5CMAA 1CENA 1RZKL 2XIIA 3RFAA 4GNKB 3BWUF 2PCQA 3VTTA 3OJGA 1ACYL 1NICA 2EDEA 2LV4A 5J5RA 1QKZL 3FMGH 4Q2ZA 2DLFL 2PW1A 4UQ9A 5G5DB 2WVXB 5DQJA 2XUCA 4CVXA 3ERPA 3BH9B 5D96C 4H83A 3DSNA 1AD9B 1KCRH 1F3DJ 4LSSL 1KXQE 3IDYB 2CLVB 1X5KA 3QYMA 3AWNA 1KN2L 3BWUC 5EU3A 2DQMA 5FGCB 2Z64C 1CGXA 3WF1A 1SW0A 3WSQL 3CHVA 4IGHA 4DHGA 3VFNA 2GUUA 4M7SA 3BP4B 3N1FC 3TFCA 3TA3B 5LYRA 2H26B 2XA8L 2I9UA 3GJFA 2IAMC 3RY4A 2VLLA 1T96A 4AIZB 2EYRB 3VOCA 3XISA 1VKXA 1WMNA 3MP3A 3TVAA 4LAZA 3W4RA 3ZR4A 1IAIL 3O3EB 5CHNA 1RUPH 4G8GE 1UKSA 4PJ7E 5EU7C 2IDTA 3NMEA 2R0WL 4N2IA 5I28A 4IKIA 3WIHH 2XTKA 3IUIA 1Q0XL 3WF0A 1MQ8A 3NZUA 4P9HL 5HYQA 4WFED 3SN6N 4WWPA 5I5IA 3K25A 2EUXA 3SUTA 2H0PA 4ADJA 4YBLC 1N2RB 2W92A 2VEPA 4QO1A 2B7NA 1WNOA 1P7QB 1PLAA 4OE7A 1SF5A 3G3MA 5ISZD 3MUIA 2EZ0D 2N1KA 3S42A 3BP7A 2D9CA 4H9VA 4NQVB 2FLMA 3UTSE 3SJVA 3BJSA 4PREA 2Y7EA 2R39A 2XPZA 1G43A 3LHWA 3QJVB 2CKNA 3X13B 3QUZC 2BCMA 2SFPA 3LBCA 2HPMA 4GRLA 3GG1A 4ECLA 4N2YA 3B03A 1LF1A 2NY4B 1HM2A 2FX8H 1MW2A 2BNRA 4R53A 1I7TB 1N4XL 4XN1A 3LMJL 3I3DA 1BZDA 1AIFB 3MRGA 1W9UA 3PG2A 5E95B 4RNHA 4KRPD 4Y5VB 3CFMA 1MCWM 3FTZA 4S2SB 3RFZB 4OQVA 4MNKA 3QSTA 3C0QA 4KX9A 4FYQA 3U6RA 4ZB2A 4U3SA 5C0JB 3O7UA 3PPFA 4OZIB 3ZDYB 1KJ2L 3SKNA 1XCTB 3KYMA 1AQ0A 1BP3B 5E0CA 3PL6A 5ENWB 3EWCA 3MLUH 1B0GB 1F11A 2XQYA 1BZ9A 2NQZA 3RWHA 3SD2A 1U2CA 1FRBA 2MQ3A 1FWHC 1T1WA 3HAEB 1Q63A 4BYHA 5J04A 3HFYA 3T0ED 3WQ5A 2GVEA 2UZYB 2XU9A 5FWRA 3PHOA 4XO7A 3GI9L 3WJJC 4HZ1A 4A7SA 4WJEA 3P9MB 3EZJB 4KQ4L 3U6XA 3RCMA 1AKJB 3VXRD 4FEMA 1PZCA 2R2EB 1VEOA 1SY6H 1QXLA 3P0VL 2HVKB 3QPXL 1ISWA 4PUBH 3GRIA 4JFSA 3U5UA 3GTTA 1SYTA 4BIKA 3JWOH 3F4VA 1IVWA 2CO3A 4U5KA 1VZWA 3HHSB 2IQTA 2R9RA 2J6VA 3QGKC 2UYLA 5XIMA 4JN1L 2EXOA 3QRBA 4GYPC 3S3BB 5TE4H 2TSYA 1INDH 4L8CB 1FH5L 5H6HA 1UZDA 3AT0A 4XISA 1P7KA 1LXMA 3LJ3A 4KKLD 1M1XA 3GSOB 2QCCA 4JFZL 5CFAA 5GZND 3UTPE 5C09B 1OSEA 1W2PA 1V7WA 4HUWA 1V77A 1W8SA 4YQXL 4H3DA 4W86A 3M88A 3MV9A 4BXVA 1QFWH 4BQ3A 3CZ8A 4G83A 3FH7A 3STLA 2ZX5A 3BW4A 3T78A 1X6LA 4GS7B 1B9ZA 2BCKA 4N24A 4BZYA 2DQTL 5HJ3A 1NWSA 4PJEE 4MXWL 1J9QA 3EKLA 1MHPL 2IFFH 4W8BA 3VI4E 1ND0A 4LLWB 1J11A 1UOKA 1C29A 4MQXC 1JV2B 4L4TD 3AACA 1JNNH 3DFNA 2D3LA 3FB7A 4KNTA 3WL9A 3BPLB 4MM1A 4H7CA 2IGFH 2B9BA 3SQOL 5K9JL 2BP0A 1EKMA 3PJNA 2YO3A 3O6FD 1GPWA 1VIWA 3HFTA 3E0GA 2WZEA 1KRBC 3UC0H 1DIEA 3P4OA 1S9WB 3FCTB 3B3BA 1QO3B 3OXRB 3OAUH 4AZ6A 3KM2A 3BH8B 4X4MA 5CCKH 3MO4A 5DT1L 1H60A 4PSRA 1QWNA 1OHZA 2WZTA 1MCLA 2CLIA 4RMQA 3D51A 5JUVA 3QWRD 5GS2H 1VPXA 5BROA 4UTMA 1TYJA 2CQSA 2QS8A 3IK4A 4K15A 1HHKB 1HWGB 3WN5C 5ALBH 3H24A 3H6AA 1BGXH 3CH8A 3N2CA 5LNUA 1ANUA 2UVFA 5DR5H 3SB3A 4J6RH 4R6UA 2X0HA 3PBYA 2FVMA 3ILPA 3RAJL 2W0QA 4HCFA 4FERA 3AHZA 4XB8A 1RMFH 3U7YH 1WFUA 2QJMA 4WW1A 3WFHB 1E8WA 2YXOA 4M5PA 1GJIA 1JPFA 4OF8A 4JXCA 2WW2A 5M3WA 1KA9F 2XWRA 4HK0A 1YNTF 4FQXB 4F92B 1NDYA 3SGUA 3HZYA 5EF3A 4OUUA 4NQ1A 1J9TA 5DGQA 3AU1B 2PWFA 3MV11 4AV4A 4LCIL 5D71L 1KM6A 4NJ9L 3QFJD 3N1MC 1Q6OA 4MMZB 4RDVA 2WZHA 4S2CA 2WINA 1IXOA 4M5YH 2V38A 1F3EA 3DECA 4XMPH 3C5SA 2BHZA 4ZW3A 4YDIL 3CK5A 4JDTH 3QV7A 4Z2GA 4K5LA 3B0YA 3D05A 1Z9PA 5KTEH 4GQ9L 4H9MA 5DYOA 3I75A 2P24B 3S6OA 3CH0A 1X8FA 5A2FA 2H6PB 2ZJSL 3QUZA 3P5YA 3QNXB 7FABL 3MV7D 2EDOA 3HRZC 1RUQL 1QMLA 4F7TB 3WBYA 4PJHE 4BUQA 4XAKD 1SO4A 4UR7A 4NSBA 3MPCA 1LE5A 5F7NC 3CIAA 3GSVA 2NY7H 3O3BA 4LBEB 2HTLD 4FK9A 4MLIA 5HI4D 3H42L 4W1TA 4PB9H 4EUPB 2GGEA 2PFHA 1AG1O 3QCTL 4GG9A 4TTUA 3Q45A 1NSMA 1EF2A 2ICEB 3PZMA 4LVEA 3BG5A 4JFHE 4MS6A 4ZSOB 3QWNA 1T5WB 5DZPA 1E6RA 4X0KB 4R27A 2OO0A 4HJGA 1TVNA 4GLRI 1AOHA 1AD1A 2NY0C 4HUUA 1XYZA 3IGKA 2BRPA 1BVLA 2VABB 1UM5L 1TO5A 1Z5LB 1XYLA 4WSHA 5JZ7D 4TTDC 4EPEC 4QBXA 3TN6A 3SKMA 4DO6A 3D39B 1WAAE 4AZHA 3SM0A 3QJFB 1HKKA 1GPFA 3UWEA 5EU6E 3WY2A 3CJJA 3U0TA 4D72A 5JOPD 1UQSB 3LHVA 1TMLA 4HBQA 4Y7OC 3F4NA 1TTFA 3FXIC 3BHBA 3DFSA 4RGNC 4JQIA 3S3GA 2JB6B 1KGCE 3AIRA 2AXFB 3UXLA 2HX9A 1EAPB 4WUUE 1C93A 1OVDA 3EB3A 2PDGA 1JXKA 5IHRA 5B39B 4LVFA 1U8PB 1EH9A 4ELKA 4QRFA 5FJOA 5HGHA 1RWFA 3QQ3A 4EDXA 4Q6JA 3P84A 4ZENA 4JVUA 1H7XA 3V1HA 2X4QA 3IF1A 3LMJH 2E46A 3VOIA 5CG7A 3EMCA 2JLPA 3S2AA 2WCGA 1BECA 2AL2B 3G18A 1GC1C 4RX0A 1QWHA 1U5VA 4YWSA 3ZDXE 1N0XL 1CI5A 3W7QA 1FHUA 3WTWA 4M7ZC 3TBTB 4CD7A 3B2DC 1IQ8A 2GJZA 3ZE2E 1E9ZB 5F1IB 3EFOA 1R34A 1S7WB 3JVGA 4W5ZA 2DYRB 1KGWA 4L3FA 4IG2A 1NCWH 3TFKD 2PW2A 3QM3A 4HSCX 2F19L 4QTHA 2X1UA 1N3NA 1J0ZA 1FZOA 1AA1B 3QG0A 5BZWA 2Q86A 4NYLA 1URIA 1DJQA 5HUPA 5IEHB 3EHBD 1XD1A 1M5WA 1I8AA 5D7LD 4AGPA 4FFYH 3SN0A 3VYPA 1CI3M 2ENQA 3VG0L 5DMMA 2NZIA 2GZXA 1TCRA 3OGRA 1WDWA 1EZ2A 3QV8A 1FDLH 4TOYH 2EDHA 3UO1L 5A16B 4JUTA 1TXKA 1GVFA 3P0WA 4TNWK 5K39B 5DMKA 4XMKH 2VOMA 2AQTA 5FL0A 4FJ6A 1I0BA 2DWSA 3PWAA 3FFDA 2EXWD 2BFVH 1GIGL 1TSIA 4P8XA 2F18A 4S3JA 2D7TL 4FS0A 3TBVB 4ADSA 3QXBA 2DB8A 4P2QB 4OFKA 1OT2A 3CUHA 4GIOA 1RV6X 3WN5A 1JOVA 4PJIB 3BDBA 2YAQA 4FFVC 2UZIH 4R0LC 5EEYA 3OHXB 3BLOA 3QZBA 4I2XB 4KI5D 2X2YA 2OZ4L 2QQQA 1IWBA 2X7LA 2PP8A 1SPQA 3AYTA 1X7TA 2ZRVA 5EU9A 3S4SG 5C0BA 3L2NA 4O9HL 2OULB 3R79A 2ZRUA 4CMHC 2NXZB 1LMKA 3G1SA 4IIHA 1NIAA 4R4NC 3TOYA 1WZ1H 1FL5B 1RERA 4NC1E 3BKMH 4W6XB 3F5WB 4YHOL 4YTRA 4DZAA 3VVWA 2VC2B 1JCNA 1CVSC 4NEIA 2VZ1A 2TRSA 4B3EA 5EO9B 3T2LA 2ZUSA 1TPFA 1XIBA 1J0KA 1ZY9A 5FKPA 5T1LB 3L3GA 3SQOH 4JFEB 3QUYD 4OGQC 4RV8A 2H8ZA 3ILDA 2XWBA 4WU7B 3LAFA 3SDCC 3H1ZA 3CV1A 3VDHA 3KLQA 4HBCH 4RH4A 5C0IA 4F2FA 1Z8AA 1DO5A 4U2ZA 5SWSA 4HU0A 2GTWB 5EEUA 2O6EA 4TNWF 1WBXA 3QGVA 1MFCH 4IFRA 4IBTA 3BANA 1B4EA 3RU8X 3KUMA 4HNTA 1YPZB 3S6TA 3M6DA 1DBKH 4ZO7A 1IQXA 4JFFB 1P4BH 4U1IB 3HRZA 3V79C 4UMAA 1CICD 5CIPB 3JTTB 2WYHA 2J1YA 4G7YL 1XRFA 4NZCA 1SVZA 5FPIA 4UIKL 2HRPH 1E3ZA 2BSRB 4JIIX 3RY6A 2BG5A 1K4DB 5HPCA 2PO6C 4DEPB 4Z9KB 4XNYL 5JVLA 1F76A 3GU1A 4WKZA 4BELD 4IOFD 2N7BA 4R4BA 2R29H 4AUUA 5AECA 1VZHA 3VFRA 3ZPDA 1F73A 1E27B 1G87A 5AOLA 1M56B 4U05A 1NSNH 4OJAA 4XX5A 4CW1B 5IW1A 2CKBL 2CXGA 5KZCD 5KVDE 2GQ8A 3QMTA 2WXMA 4NQDE 3U7BA 4OF7A 3QUMB 3SDDD 4Q74A 5JXQA 4LLAA 4LP8A 1J5TA 2WVTA 3NIDB 5HI3D 4A1RA 3PNUA 1UR4A 1RK7A 4JIQA 2ACUA 1A9EB 1PNCA 2WMHA 1JF1B 4DJFA 1TJ0A 4Q9CA 4G11A 4L0PB 5DJCB 5KYWB 1KM2A 4MNGE 3KRUA 4ONFL 1YLBB 2OQJA 1OC7A 3COTA 2WIIA 3ITCA 1MCCA 4M6MH 2VC7A 4ZVJA 5I1EH 3VIJA 3W1NA 4XP4H 1H5BC 1WT5C 5I3FA 3W1ZA 2KZ1B 1WMPA 5C0QA 4LUIA 2AANA 1KCUL 4ZQTA 2J6XA 4I0PC 1FSKB 1BVZA 1KPRA 3FUFA 1L5GB 1IFHL 5JW4R 1DTUA 5E9DB 2XV2A 2OI9C 2QLVB 3OGSA 3G0XA 5ID1B 3TCSA 3NAAL 3RWEB 1JVLA 1JYWA 4PP1C 3KXFB 4MJZA 3MWXA 1QUMA 4AYBA 3DMMC 1CJYA 1YMMD 1I60A 2FPTA 4LZKA 1COBA 5BXTA 1S5VA 3VIMA 3WIQA 2AQ3A 3GMPB 1URZA 4LRNH 3AT9A 1J0MA 4K8RH 5E6IC 1FE8L 4RPPA 3WK1A 3HAEH 3EJSA 4QOKB 3FPXA 2ODOA 2YC1B 3S88H 2CKSA 3PWPD 3CQKA 1H19A 1FO0L 5D2XA 2RJGA 4B9GA 4OF3A 3RX2A 4JJOA 3JV6B 3LNHA 2NYZA 3EG9A 4U6XB 4LIQE 4AG0A 5JOFA 2UY4A 1GGIL 4UV4L 5LNGA 1UM4L 3E1ZA 3S1WA 3ESOA 1AIZA 3H3BC 4F0RA 2PDYA 2DYPD 3ZHFA 1H0DA 3L13A 1OAZH 3X3ZA 5L2JB 2Y6SC 5DHVB 3VQ1C 3MLRL 1HNYA 1R9FA 1SXNA 2XTJD 3U2IA 1BW8A 2V8ZA 3VWJA 4UYQA 4I1RA 4HIQA 3QKEA 2ZOOA 1JXJA 3V5CA 4HP5A 1UACH 3Q1NA 1ZRQA 3MSRA 1TVHA 2X4UB 1JP5A 3T0EE 3GFXA 5HD8C 2GCYB 4MA8L 3NSNA 3CU1A 3RNKA 2VTFA 4GBXD 4AC1X 3MQTA 5EZJB 1BJ1H 2VXQH 1A7PL 3H4GA 3E6HA 2YJLA 4K3DH 3N91A 3WLSA 4TSBL 5JYMA 5FW7A 1ZFJA 2H32A 4LSQL 1KYUA 5F7DA 2BZCA 5H4YA 4R90L 1DOSA 3OV6A 1M53A 1NELA 1AO7B 2LFGA 2EYSA 3MMDA 2I56A 4WTWA 4IPIA 5J56B 2BSBA 2OR8A 4LF3B 4J39A 2WWMC 4Q4MA 1E70M 2A85A 2FEJA 2XYLA 1BKSA 3HN3A 2BVTA 1S9VB 5AYTA 1BF6A 2AK4A 1NBZA 1VERA 2YLKA 4AD5A 4K5MA 4JL2A 5FA4B 4XX1E 1X38A 4TVUA 3ELFA 5CSBA 1JCTA 1XF3B 3N14A 1B4LA 1T66D 2ZG3A 3QIBB 3U6WA 4P8WA 5HGAB 2BSTA 4F58H 1P84J 2F19H 4MJ2A 1IZJA 3LA4A 1CC3A 4X4KA 4YE4L 3DDFA 4M6VA 4MZ2A 4WW2F 2ESVA 4PTTA 3CFKB 2A3CA 3VMOA 4OLUH 4CC1A 3ZWSA 3MO7A 1N64H 1X6NA 1OD8A 4JHWL 3IVKA 4QRPB 2LVEA 4ZZKA 5EIIG 4HEPA 3NXFA 1U3JA 2BGSA 4L4TE 2YW3A 5DA0B 1D5BA 1EERB 3FOKA 3GMRB 3QW4B 2FBOJ 4ZPTB 4WW2C 2IH9A 1YNKL 4OKVB 2QKFA 3PP3H 3FQNB 3KPNA 3VSVA 3RG1C 5C0FA 4G8TA 1JAEA 2QQLH 3KCJA 3UZVA 4KFPA 5F2MA 3F4WA 3OWRA 1M3JA 3GJEB 1DUYB 5BVPL 3FFSA 5I6KA 2PXYC 3MY9A 3FFCA 4Z7NE 5A2JH 3IIVA 4LSPH 4RGMB 4HOZA 4JTFA 2Z0IA 5CLZA 4UR9A 1S9YB 4L4VD 3PNRB 4HSAC 4KKNA 3DV4B 2OSYA 1J8SA 2R7EB 1REQA 3D9AH 2J1KA 4A3QA 2XFXB 5EZIL 3U2SB 1HMWA 1UZ1A 3GW0A 3ARBB 4U1JB 4UFIA 2A74B 4MIMA 4V1DA 3MCMA 1CZ8L 3GNPA 3CHEA 3QQ9D 1MI5E 1O60A 1QI2A 1BAGA 1OCQA 1S2AA 1XG4A 4GRSA 5FUCE 5JBFA 1NS7A 5IBLD 2H3DA 3G9AB 4YBQD 4YVNA 1A6VH 4HLEA 1OCWL 3QUXD 3TTYA 4XIAA 5INDA 1J9RA 1W0VA 4QP0A 1KTNA 2UY7A 2E09A 1QT1A 2MWCA 3TYCA 5DSCA 2CA4A 4Y1TA 1SO5A 2FUTA 4XZMX 4GSDH 1M04A 4G42A 4LBSA 3NG3A 4BGDA 4MD0B 1QACA 1OWRM 4UI2A 4OK4A 1G6RH 2PI6A 1JHTB 4NAMA 5JXAL 5CPLA 2D31A 4WGXA 5I1DB 3Q37A 3EA3A 1NFDB 2D2HA 1IU1A 1S2CA 1DVZA 2ZDSA 4J40A 2QQKH 4AVIA 1ILSA 1KY7A 3C09C 1NUFA 3CZGA 1QK2A 2PDLA 3TSMA 5E1IA 2QJGA 3FA5A 1EMTH 4OJYA 2J8FA 4PJ6A 4ZTOL 1NCHA 2Y9RT 4GKZA 4I0PA 5DUJA 3W0WB 3QT2A 5I0WA 1GS8A 3SKJH 5LGJB 3O6KL 2J43A 4FXGC 5I26A 2Z31A 4F7PA 1A9BA 4CQCA 1OADA 2WQAA 3T0DA 1X1OA 1Z3GH 3S98A 1IGJB 3N4EA 1R3SA 1FN4B 1GS7A 1J1OL 3V4VL 1CDYA 5CGYD 3AYSA 4XPGH 5E6IA 1P6FA 2CKBH 2CDGB 1PGRB 4ERSL 2A6LA 3GDBA 5HJBA 3ZTJH 1KJ3H 5D72H 2OA9A 5EOTA 4ZFOL 4PRID 5A8OA 1KV7A 4P2OD 2VLRD 4NWUH 4B5EA 3ZYZA 1WIUA 3LQZA 3FCSB 4B3VA 1VLIA 5J8OA 2Q8ZA 3W9DB 4BZEA 1FP5A 4Z7QE 1GG0A 2PWUA 3W1QA 5FAAA 3TEVA 4IBVA 4Q9BA 1O6VA 3WBEA 1FUNA 1K8CA 4ZOEA 5J57B 3WQCA 4RBPH 4G5ZL 4DGUA 1ZK9A 1N12A 3R06A 5DWUH 3ALWA 5IBUB 5F7AA 1E9IA 2Z25A 3LCWA 1IKNC 2K1MA 1N8IA 3DFPA 4P05A 5DD3H 2XACC 1H1ZA 3CUPB 4PJDE 2QDEA 1UB3A 2OSLA 4PGDB 4WOZA 1C5DA 3R8RA 3FMGL 1PX8A 7ODCA 3OJMB 1XWVA 1BG1A 2NT0A 1TZAA 4M3JA 3B04A 4JNYA 4JY8A 4EKJA 4ZSUA 2ZX6A 4C6NA 4J3XA 1KCRL 3NBBA 2FECI 1J5IA 2HFEA 3KD4A 1QNIA 1A3XA 5E1AB 2DQFA 2ABBA 1UWAA 3D87B 1HNGA 5HP5A 2FL5B 3NFNB 3A9BA 1HKMA 1W56A 2AVFA 3DGGA 1DIOA 3VFWB 2V82A 3S96B 2EDDA 1OFEA 4FLRA 1HCFX 2N7AA 2YPIA 3ZE1B 4I90A 2NLJB 3I84A 4OJDH 4A67A 1FO0H 2VDOH 4OT7A 1MREH 4APQC 3U4KA 2V4LA 3CUFA 1QBAA 2UXVA 1GGIH 4FNPA 2AAVA 1E7VA 1BFTA 1ZD6A 1RUPL 3LYEA 4UMBA 1VA9A 3VRJA 1CTMA 3DO4A 3BEWB 1TYEB 4BDVA 4JO5A 3WIHL 4BA8A 3IWVA 4BFJA 1G67A 3NBNA 5DY3A 4H8WH 5EMYA 4HAGA 1ODZA 3DYMA 1MFDH 1SO6A 3TV8A 1YTKA 1ZSDB 3NSCA 4M5TA 1M7OA 2AQOA 2HCVA 4WW2A 3RITA 1BFSA 1RQEA 2H8XA 1GY2A 2WAGA 8XIMA 4YXLL 4GZIA 3C60A 3QGAC 2Y7QB 4MNQD 4PI2A 2FX7H 3I7SA 3DUSB 3PNWB 3ARVA 2VLKB 4R90H 3GXIA 1I3RA 4PMEA 3T04D 2AOSA 1XCWA 2WGXA 1IT7A 5F70A 3VSTA 5F1NA 1P7BA 1XS2A 2FX8L 4GEJA 3RR1A 2E9LA 3ZW3A 1OG6A 1KRMA 3P9WB 1GYWA 3P7YA 3G08A 3W7LA 3DVNA 1XYAA 3M1ZA 1UXMA 2ACSA 3QCVL 5TE7H 1X96A 1QUNA 3EPMA 4L7ZA 3KZSA 3R0DA 3GVRA 2GI0A 2VFGA 1IT9H 2XKNA 1LP9A 3RL2B 3RM9A 3W2DH 1SOXA 3EJQA 2JIXA 4QRSA 4U4MA 43C9B 2HAZA 3MLUL 2WHKA 4O19A 4Z95H 1E71M 2Q0ZX 3GXPA 5D2LF 5EMMA 5ETUB 1QSVA 5AVHA 3ZRSA 2R1XB 3NNTA 3QNZB 3GEFA 5IIEA 2ZAGA 3HN5A 2FJUB 2E7BA 3AHTA 3T4WA 3IAQA 3HS8A 3QO0A 1FNGB 1HX0A 2CLZA 4RDYA 3T3ME 1B54A 4GP4B 5DI8A 1EGZA 4XZ4A 2BO0A 3JYBA 3NZ8B 2PP1A 4LPTA 1U8LA 4U1KA 2VO8A 4HNNA 4XP5H 4GC4A 4XMUA 2OL3A 5CIPH 4BRVA 1SY6L 1UYQA 5DURD 4C4KO 4B2DA 3MCKA 3DVIA 3WLHA 5FW6A 4PUBL 4U31A 1F56A 1L6ZA 3OS7A 2G4EA 4PMNA 4Y4FC 3JWOL 1DLHA 3G04A 4B16A 1E51A 3KL3A 4ILSA 1S6NA 5AVWB 3GTXA 2CLOA 3IETA 1XIJA 4ZPVB 1GZHA 1T7XA 4CQBA 1X9RA 5J89A 4B5WA 5TE4L 1INDL 1ZV2A 4FXGA 4PJCB 2PF8A 4U7SA 3VXOB 2VZ3A 3D0CA 4K5OA 1ONQA 5GNYA 4AQEA 3HBLA 5HHMB 4ZMWA 1M7IB 4FALA 4FIRA 5KG9B 3VZXA 3PFUA 2IKGA 2P5WB 1SJEA 3VCNA 3MAWA 1QFWL 2EACA 1MVYA 1YEYA 4Z18A 1IAII 3VFSA 1BEYH 4GIRA 1J8HD 3X1EA 1OCWH 1W3IA 1HJWA 2XXMB 5T9BG 3BLLA 1KIQA 1RZQA 1T7WA 2JJTC 1FBIH 5FC9A 4GWEA 4A7GF 3V6OE 3BKYL 3QJHA 4Y9FA 2Z35B 3WQEA 3CB3A 1A4CA 4K36A 5D7SH 1TJXA 3FSOA 5DMGD 2AJ3B 3W6MA 4K3GA 4YL2A 1ISVA 3VCLA 4LGXA 1JNNL 5IROA 1IBZA 2IGFL 3FSUA 1Q1PA 3BN9D 4HYTB 4NC2B 1FFNA 1R9ZA 4PMXA 1M68A 1N7KA 2XFRA 5FGRA 2W0FA 4W9ZA 5CLWA 5H37G 4PJBB 1HU8A 5LUMA 5G1TA 4N0CC 2NNXA 4HA3A 1CTNA 2YMOA 3BLBA 2HB0A 3NQ8A 5D2YA 1CE1H 3LSOA 3UC0L 4UIOA 3SIMA 2FGZA 1TTRA 1ZT4B 4CKQA 4AWEA 1PCXA 4GGBA 2N01B 3OAUL 3UPCA 5AL8A 4OD1H 4XGZB 5CCKL 4PJ8D 3TIDB 3VYOA 3KTCA 1A0EA 4E9WA 4WSGA 2PCPA 1QSEB 4A6GA 1HL4A 4YS1A 3BIKB 4E5XA 3NO1A 3C4UA 5ALBL 4CMMA 4JX0A 4L0ZA 1BGXL 3QDGA 1XTMA 5D1QD 2IANB 2YD4A 4V27A 1YDNA 4J6RL 5J6GA 2XSGA 2FWUA 1AR1B 3LZLA 2DZXA 4MDRA 3NGBC 2CQVA 3PC0A 1RMFL 5C0AD 5LAPA 3U7YL 3O4LA 2JFCA 1LQ0A 2CDEA 4I77H 2GSEA 3LRMA 2Q87A 4KFZC 1YMME 5DUBA 4AZ7A 5DHVH 5EA9A 4N02A 3I2CH 1ILUA 3ILEA 1M71B 2ARJA 3TASA 3INPA 2FKPA 1IU7A 4LMQE 4TMCA 5EV7A 5IVZB 4JFQB 5EUOE 3PWPE 1KELH 1RK0B 1HXJA 3E5BA 4KDTC 4FEIA 3PJXA 2HT2C 1Q9LB 5DJ6B 2ZWSA 4M5YL 1RQHA 3MXVL 1FFOB 4MLJA 2OMYA 4JAMA 4LOFA 4Y19D 4L3EA 2VKWA 4XMPL 5AKRA 2IOIA 2XG5B 3MNZB 1CIDA 3PULA 4WWKD 4JDTL 1DVYA 1A5SA 1AZNA 4U33A 2XTJE 1JF6A 5KTEL 4KO9A 5GZOD 1E2ZA 3L3DB 1XIHA 2ZRXA 4ZMTA 3BPWA 1V3LA 3CFUA 3MQIA 4ZD3H 3EB2A 1U8MB 4KK6D 3LN5A 2CO6A 3S5ZA 1L7JA 3VACA 4RQQB 4L9XA 1I7ZB 2NY7L 1I1CA 4OF6A 2XX1A 3WF2A 4J4KA 1BGAA 1MH5B 5JOEA 1Z42A 5DJDB 1OYBA 4QYAA 4L8DA 5IHZA 3LH8A 5E4IA 4PB9L 4MAZA 3B2VH 1XHHA 3L6FB 4XWOC 4LV9A 3CV5A 1AD0A 1A6ZA 4LOCA 1CBVH 1AS6A 1D6YA 4JZOA 2DUXA 4QJ1A 4AZUA 5RUBA 1GEHA 1P6CA 5L2KD 3O3DA 4M9PA 3LIZH 2DZUA 2PN5A 2ZOLB 2ITCB 3WVFA 3W1UA 2BRRH 3GQFA 3B9OA 4FZIA 4ZUUB 5TK2A 4NM4H 3MLXL 3QYSA 5FUOH 2HLAB 3EGDA 3CH9A 4LDCA 1AOZA 3WLBB 1XSJA 2CHOA 1H4PA 2NVCA 1H50A 2GUOA 3ZOAA 3GLZA 5D2LA 2WCOA 4DFIA 3CSBA 3GSRB 2ZD0A 5IQ9A 4LMQI 4WV1A 5DS1A 1N7OA 4YXLH 3MBEC 5LNWA 4XPAH 1ZK5A 1J01A 1DBAH 3STZA 5E7FA 3WDIA 4N85A 2FHFA 1BOGB 1DANT 1W9PA 5AFDA 2PAJA 3WHE1 5HNUA 2RFGA 2CZVA 3FU0A 1YO4A 1F3TA 3MUHL 3RVWC 1BZOA 4X7DC 3M17B 3G6JF 3UVAA 1XICA 3IGAA 3O2LA 1YLVA 3K7UA 4QLRA 3K1KC 2J7HA 1OHQA 3PK7A 2R1WA 1ZJHA 4LAJH 3ARFA 4R7WA 3ECBB 3QIWB 2C3WA 4P2YA 4HZAA 1RWCA 1ZS2A 3KOXA 2ZX8A 5D93B 3M0VA 2B1HH 4R4FH 3F4DA 3US0A 3Q1SH 3V4BA 4DK6A 4XAPA 1TB3A 2E1DA 4ANKA 3WFCH 3QCVH 2PDBA 4KKCC 5I16B 3F05A 2FDSA 3AQDA 3QO1A 4F0LA 3L4UA 4IOSD 3CN3A 4EN3C 4ZUTB 2OMTA 3VNMA 2K7PA 2H0JA 3HV9A 3DROA 1TELA 4NPYA 2CK2A 1HXKA 1E9QB 4CJ1A 2QDHA 3T65A 4HZLB 3SE6A 3HE6B 2DJ4A 1CXIA 3QG7H 1NCWL 4QXTB 1KDIA 3GSQB 2JI3A 3RZWA 1ME9A 1XF5A 4MNMA 5F7UA 1TPXB 1N19A 1JRBA 1QNPA 2I17A 4PJAF 1KENH 1CD0A 3ABMB 5LCVA 1W3JA 4A7GA 3UAAA 4X6CF 4LUSA 1RBLA 4FFYL 2RD0A 3DHPA 1I4NA 3EA1A 1KJVB 3PP4H 2TAAA 1SZEA 3V6ZA 5AEAA 1WITA 5AKTA 3UACA 3IAGC 2ZC8A 1XW8A 4WDIB 2OBGA 2HX8A 3C2EA 5DK0A 1FDLL 4TOYL 3FHQA 1DLFH 4ODWB 4XMKL 2HYMA 2YDQA 3WCYA 4WK4B 1CFSA 2EIZB 3TZVB 4HIIB 5FJPA 3O2VH 3QUKB 3F2BA 2BFVL 1DANU 3TS8A 1VJIA 3O3RA 2E2TA 4TPRH 1VF5C 5JW4N 3FN9A 1CXKA 1GJUA 4XAWH 3SCMB 4ZO6A 3I50H 5C9RA 2C4XA 2UZIL 2PGEA 4TRPH 3B4UA 5HY9B 2ZZUT 3VH8B 3VOFA 2C1OB 4MD5A 5DC4B 5G4MA 4XXCA 1E5YA 4DXXA 4F48A 1T2JA 3UZXA 1P7HL 4XX1G 2V5BA 2X40A 2XGZA 3NRPA 1SHXA 1IGYA 1XBRA 3AABA 5A6AA 4WSJA 4RESB 1WZ1L 3BKYH 3FT2B 1WOAA 3BKML 1FWSA 3CL7A 4FF7A 2Z92A 1XGTA 4DP5X 3DVGB 4K7FA 4DUVA 3ZKMD 4ZS6D 3DFQA 4LCYA 4IFKB 5IUCA 1O95A 1VF8A 1SUHA 1MJJB 2ZZ7A 3UWQA 2DZSA 3C08H 3NT0A 3DHUA 3LDBC 3UTOA 4JVPA 3MLWL 4KDTA 4LCUB 5DO8A 5IV2A 3BUTA 4Z2LA 2VLRE 4HBCL 1RSCA 4AKQA 5SWQB 2VDRB 4YSPA 2EIJB 3LHYA 3D0LA 1B2WH 3RMJA 4JPKH 3SODB 3U0PB 2R4SH 2AV1B 2MUCA 4Z78B 2A73A 1MFCL 1IVUA 1Q9OB 1T40A 4QDPA 1KXTA 2X38A 4PJFB 2IQDA 2OSWA 1VBRA 1JGUH 1E9PB 4FP8H 2P5EE 3R43A 4K9EC 4IJTA 2VN3A 4WR3A 3FN3A 1DBKL 4LLDB 3EOLA 4YPJA 3Q58A 4BJHA 2CO2A 3AS1A 5EBMB 1M6OA 1P4BL 1MUJA 2UUDH 3AM8C 2XG4B 4HKBB 4ICCX 2DVXA 3HG1E 2KKQA 2HRPL 2FQFA 2Y88A 4NCC2 3M1CA 4OCNC 4HDIA 5HATA 5SWUA 3S1VA 3GBLA 1WDPA 3PAYA 4DN3H 1RVFH 5E6ZA 2CO7B 3LPFA 3CQPA 4DWSC 5JBDA 2ADJB 3MJ8B 3T1FA 4BFOA 4H8HA 3KWWB 2IAMA 2YA1A 2R29L 3U57A 1LNUB 1INQA 3KIIA 3SDAC 1G4SA 2QCDB 4LDEB 3MHZA 1NSNL 2FB2A 3WA2X 4X98A 1IAOA 4EWJA 4BS0A 4WIWA 1AP2B 4JO2H 1IGSA 1KM3A 2EBNA 3Q2DA 1UFUA 3TYGH 3H21A 2F6XA 1FVCB 3WLJA 2CERA 3QSKB 1DYZA 1MW3A 4MXQC 1L9OA 3ETTA 2GHZA 3BIAX 4PJ5D 3CLFH 3MXVH 5D1XB 4AZBA 4DJDC 3B8DA 3PFRA 2XDHA 4Y4HD 3BLEA 4AMKH 4R97B 4HS3A 2GL5A 3HB3D 3T6XA 1W72A 2COQA 5CP3H 3NQVA 4W9FC 3W7UA 1JOIA 3MBEA 1RD6A 1RWGA 4M6ML 5IG7B 5I1EL 5E7BA 4G9PA 1CLVA 4XP4L 1OJNA 4K7YA 5DUML 2MTAA 1CLKA 4N8CH 3Q8EA 4C56D 1P5VA 1Z0NA 1XLLA 3LGDA 1V7XA 1HYSD 3QZWB 2DL2A 4YX2L 5CMAB 3VTMA 1H8LA 5E56A 3U9PL 1R75A 4UT7H 2F7RA 3IYLW 3AXHA 1ISZA 4JREB 4O1FA 2P8MA 3FEQA 4X4XA 5B8CC 4QEHA 4Q2ZB 2PW1B 1S7TA 5DQJB 1VYSX 4CVXB 1R3KA 3DSNB 3G6JA 3HG0A 4Y9BA 4EN3A 4LRNL 3GRWA 5T5NF 5FFGA 4K8RL 4WO4C 1VYPX 2VLJE 1KZQA 2H2SD 3ORJA 5EU3B 2E24A 4XUGA 3F65A 2X1QA 3D18A 3LCHA 1B3YA 3S88L 3VFNB 5HDBF 3T4CA 3O4OB 4BFEA 4A8LA 4FXRA 5F7LB 3GJFB 3BCDA 3MLXH 1DQML 5D2NC 2VLLB 4NFDA 4IMKC 3NPVA 4IPNB 4KRNA 3O06A 4X6BA 3WJJA 3L54A 3HPSA 5HI5D 1OAZL 1SIIA 4EACA 5CHNB 2DQGH 3L7EA 1K5NA 1M65A 4K07A 2VOTA 4JHMA 3CUXA 3RBGA 3W70A 3OJVC 3N9KA 2QGHA 5HVGB 3T8XB 3ATFA 2CC0A 1TV5A 5C6WH 4AF0A 2KC0A 1UACL 4CADA 2NT1A 3PV7A 5EH1A 3HN8A 1TIWA 4MMYA 3U5YA 3LNEA 4YU1A 3IK2A 1X5LA 3LNFA 3UG8A 3AO0A 3GZOA 4PJAA 1G7HA 3LI1A 4HTBA 2VXQL 4WHYH 2WO4A 4ZXBC 4X6CA 1PW3A 4K3DL 4OTKA 1VFUA 2WBJD 4OZHF 2BSLA 1YY9C 3VRIA 4GYPA 4CN6A 2ZZ2A 3BP7B 3HS9A 1RAMA 2EECA 3SJVB 2BIOA 4PREB 3JT0A 4L29A 2AKZA 5I77A 3LU2A 3WQWA 3UW6A 5FKAB 4W9KC