4FNTA

Crystal structure of gh36 alpha-galactosidase agaa a355e d548n from geobacillus stearothermophilus in complex with raffinose
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSNNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELVYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
total genus 225
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fntA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fntA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fntA02
1XH1A 3CZKA 1D7FA 4IGHA 2YA1A 2FIQA 2F18A 3MI3A 3P80A 3KVLA 4JTJA 4LOCA 3QEZA 2WSRA 2VR5A 4EWND 2ZTKA 1TPDA 2WKLA 1FDZA 1EH9A 1AVAA 2WSQA 4JICA 3FYOA 4HP5A 3FLUA 4H8HA 2EO7A 1DOSA 4J9JA 5K7JA 5AYYA 3THAA 2A2IA 3EDEA 1GYNA 3GNDA 2ZXAA 2WNWA 2VFGA 3W70A 3OG3A 4TIMA 3S0CA 4JS3A 1TV8A 1B4KA 1SMAA 4IX0A 4B9YA 2VXNA 5I0DA 2TYSA 4QAIA 1WV2A 2UV8G 1CI1A 3FJLA 1DEDA 3W7EA 1UB3A 3TSBA 1ME7A 4AIEA 3A23A 2FGZA 1KCKA 3GXFA 1OF8A 1E43A 4H7VA 1VCVA 4Y96A 5DCBA 3EDDA 1NSJA 4YXGA 2E0PA 4H3DA 2V0TA 4ZVJA 2EHHA 1VJIA 3CZSA 4FNSA 3L66A 1BWKA 3GXIA 2V5LA 1SFJA 3VKJA 3F4NA 1B57A 3F4WA 1B2YA 1ICPA 1VPXA 2NWSA 1XKYA 3G24A 5FESA 3KXQA 5EMYA 3TXVA 3V1PA 1GPWA 4UIOA 5FF3A 3BLBA 3S8HA 2EGZA 3INPA 2WKJA 3PB2A 1VLWA 1H60A 1OFOA 1XSKA 2E9BA 3BSHA 1QDSA 1LBMA 3UG5A 4JX5A 3BPWA 2V82A 1C8VA 4LNYA 1VIWA 3AMKA 2CLKA 1UD2A 4U4MA 3TC6A 5CPLA 2D2OA 4HOWA 2G5WA 2QUVA 1G7UA 1GG0A 4NNCA 3ZWTA 3IV3A 4A2RA 2VT0A 2E8ZA 1ZS2A 5E1QA 1EUNA 3QW3A 4RZ5A 3LPOA 1PEZA 1MEIA 1JIBA 3BMWA 3ELFA 4FO4A 3IIZA 2C18A 3DHPA 5CSSA 5D30A 4HNTA 1C8QA 3II1A 1F76A 3LHYA 4LC8A 1A47A 4ZL1A 3D4YA 3KVJA 4JIQA 4DF1A 1W9XA 1HO4A 3LDVA 4FX8A 4GUIA 3PBWA 1F2JA 3EKZA 3W7IA 2ZBTA 4KMQA 1D3CA 1PS3A 3UWVA 3UY8A 3O6DA 2WNNA 1ZCOA 3VX0A 1WZLA 1PL9A 4OWGA 4JFSA 3OA3A 3N34A 3BGGA 3CLMA 2XN0A 1T96A 3TA6A 2PCQA 4K37A 1OYBA 3W7DA 3SFKA 4UTKA 2AQWA 1XCXA 2ZXBA 2V9DA 2ZZ6A 1QPOA 3QMSA 3NDOA 1GVQA 2EJ1A 3P5ZA 4MY8A 3GAKA 4NT0A 2V30A 5A8GA 4LC6A 1SW7A 4FLSA 3NEVA 5IM51 4EF9A 3BVWA 1LRTA 1MO0A 1YDVA 5HULA 3BAIA 4NUWA 5G2WA 5DY2A 3A24A 4QITA 7TAAA 1IIGA 1QHOA 3KX6A 3C2RA 6CGTA 1U33A 5CXPA 3W88A 1JCMP 1A53A 3FS2A 3E49A 1Q6LA 4LY8A 3O15A 5AHMA 5HINA 4WZHA 2XVGA 4DO4A 5D2YA 4JXCA 1TSIA 4RJEA 2OX1A 3WEMA 4FXRA 4IWWA 3AXIA 4YMZA 2ZX5A 1HX0A 3HF3A 4HHPA 5AC7A 4IXHA 1CIUA 3A21A 3BUPA 1ZAHA 5D2TA 5F4SA 2H8XA 4ADSA 1QWGA 4A29A 3ZT5A 1VFOA 3EDJA 3W7NA 1AMKA 2ZWYA 1KBIA 1BEUA 2IQTA 3TUUA 1KTNA 5IBXC 2Y7GA 1PS9A 4TMBA 3TV8A 1QWNA 2XIBA 3A6OA 1M7PA 2B4GA 4XUGA 4Y6GA 4J3SA 3BC9A 1O7DC 1HO1A 1KM6A 1PVNA 2ZYFA 3OVRA 3RF9A 3P60A 1W0MA 2AAMA 3BMVA 2J25A 2BY1A 1LBLA 2X2GA 5D04C 3E96A 3BVTA 1ML1A 1DTUA 3G0SA 4TX9A 2X2JA 4MZ1A 1GVSA 3TW6A 3DI1A 1UD4A 1IGSA 5EPDA 2F1AA 5A2AA 1MEWA 2FDSA 3B06A 1K03A 3O63A 1V3JA 3K30A 5HQEA 3WK2A 3E12A 2DH2A 1TTIA 5DLCA 3KRZA 1CGUA 1SZEA 3L67A 5L9FA 1UA7A 2DP3A 3PS7A 4UFMA 3TJXA 1MZHA 1R46A 1M5WA 5HR6A 4HA1A 3WDHA 1K7FA 1DJNA 2DJXA 1HNYA 2DZPA 1EUAA 4AMWA 3S5OA 1I2OA 2FE0A 2BY3A 2WV8A 2Q3OA 4LW7A 2A7PA 2FPTA 3SJ3A 4EIVA 1CYGA 5D38A 3W7CA 1W56A 4MZ8A 1OFEA 3NGJA 1OJXA 4PODA 3HMJG 4BFAA 2LLEA 1X1OA 2FHBA 3QFEA 5CZJA 3B8DA 4ZQRA 3W87A 4ADUA 3BUDA 3WY3A 5HPOA 4MLRA 2EADA 1CGWA 2YXGA 2ZXDA 4H4IA 4M7TA 3MO7A 3O6YX 3I7SA 1Z44A 4CQAA 1E40A 3S42A 3OLDA 3KE0A 2FB2A 4AB4A 3SI9A 1UUOA 1H51A 4DO6A 3IJ9A 3FYPA 3L4TA 3GXTA 3PG9A 3SECA 4C1KA 3NQVA 2OT0A 2JGQA 2Y63A 4AXKA 1SZFA 4AF0A 1PCKA 2QAFA 4Y90A 3PM6A 2WVSA 3SW6A 2ZZ2A 1QO2A 1SSGA 4CN1A 3A5FA 4QSHA 2RHGA 5D37A 2PWEA 1TCDA 4MAZA 1TMHA 7CGTA 4R33A 1KM4A 3PSVA 1G4PA 2X1RA 3GDKA 4WQ6A 1LZOA 2DZXA 3DFQA 4OT7A 3EB2A 1XH0A 2J24A 3M16A 5AHNA 1XBVA 1EP1A 4UMAA 1OABA 1QPQA 5EMUA 3GAYA 1F7BA 3OVPA 3WK0A 3DAQA 3QC3A 1UD3A 1VYSX 3LCFA 5TD4A 3DX0A 4IPJA 4J3VA 1H62A 1U30A 2G96A 4U2ZA 4JCMA 5AC6A 3CTTA 5BRBA 1EP2A 1KFBA 3W6YA 1MW1A 1HL8A 3VGGA 3W7KA 2GPTA 4UQDA 4WY0A 3DDFA 1KGXA 1AL8A 2X2IA 2WC7A 1OX4A 5HUPA 5I24A 5F2IA 1DV7A 4NX5A 1KW1A 5GVJA 3U6WA 3S5ZA 4N6FA 5E0FA 4AMXA 3MW7A 2AGKA 3MMTA 4JY9A 1H7OA 3W1TA 3VMPA 1VFUA 1FCQA 3B0VC 3RILA 4J27A 3LCLA 1JRCA 3WJWA 1BSIA 3PUOA 4PL2A 4UTIA 1XDMA 3MUXA 2D3NA 3M5ZA 1Q6OA 3QQ1A 1JCJA 4FX7A 4HSOA 1NF0A 3RU6A 3NR0A 3STEA 1XDLA 3TH6A 2NV2A 4OGZA 1CXEA 3S1XA 2YYUA 3LPPA 1RR2A 5E93A 3S1VA 4NX0A 3G22A 2Y4SA 1K7XA 1G67A 3TW7A 3BAWA 1H50A 4AEEA 4RV8A 1HG3A 2ZZ5A 4JIPA 1S5TA 2F61A 4AIOA 1GVIA 3TNOA 1VRDA 1HT6A 2V3DA 4K39A 3E0IA 3BV4A 5C54A 2WCGA 3VE9A 3BUQA 4MOZA 1Q3NA 2ZZ3A 3B04A 3WJXA 4EOUA 4JFVA 3M5YA 3NPXA 3S1WA 1I75A 3QF0A 1VQTA 5DBTA 3DFSA 4N4QA 3KRUA 2QMKA 3EWZA 2JKEA 1YXDA 3BVJA 2ZX8A 3LCIA 3UD6A 4UZUA 3W84A 1MW0A 3KL3A 1NEYA 3BLIA 4LWWA 2V2DA 2Z6JA 2NX9A 2TRSA 2YGYA 4PSRA 3DX1A 5DO8A 3RNDA 1J0KA 3ABSA 3CZLA 5HUOA 3UYCA 3S2CA 3HGOA 3B05A 3LHUA 2C19A 4OE7A 3ZT6A 2Y85A 1WP6A 4K7VA 3Q94A 1IZJA 4JYEA 2CZFA 1YPFA 5FF2A 1GOXA 1LORA 3TTYA 1UH4A 1PCWA 4WY0B 1PIFA 2C16A 2JKPA 2VNCA 3CB8A 3K1DA 1RV8A 1FWRA 2WVVA 4LQ1A 1F74A 4ORMA 1P0KA 3QH2A 3UZ5A 1Q4NX 1YDOA 1O5KA 1ZY9A 3WNNA 4IMFA 1KFLA 3L2LA 1OF6A 5HDRA 2O7QA 4HN4A 1SO4A 1CGVA 2EAWA 3ZR6A 3M0ZA 4WSJA 2QJHA 1SUXA 3GDTA 5FI8A 1I4NA 3DX2A 1OYCA 1KXHA 3CEUA 4DF0A 2NX1A 3DBPA 2DORA 2ALDA 4A22A 1FUYA 5E9AA 2F7QA 3L21A 1TQWA 4FNUA 1C9DA 3HG2A 1XXXA 2VENA 3B0PA 2CFFA 3BG9A 3N3MA 4MFDA 3S6DA 3G1XA 2V2CA 1H63A 5F2LA 1KB3A 3A22A 1W5OA 2V3FA 3W75A 1F6KA 5E0KA 1CXKA 5G4WA 4IMEA 3LLDA 3Q58A 1AQMA 1V3KA 1G4EA 4LS1A 4RZ6A 1JFHA 2CLLA 3DHDA 3MP5A 4GUFA 2PWDA 1GJPA 5BMXA 3KL5A 1WBJA 1CXLA 4ZQNA 1I2NA 3EJSA 1O95A 2FB3A 1YXCA 4OBTA 4RXGA 1R75A 5LSMA 1LTDA 1L6SA 1JCYA 1JUKA 3L65A 3EWXA 4L4LA 2BLEA 4PA8A 1I2RA 1JI2A 4OV4A 1KXTA 5CLTA 2DZVA 1RQBA 2HMCA 2R91A 1SPQA 4BR1A 3TAOA 1VS1A 1UH3A 4UQEA 1BPLB 2Z1BA 4PEEA 1KLZA 1TRDA 3PY2A 1W5PA 3N9RA 2GQ9A 3B0UX 4H2CA 4O10A 5IBXA 3CV5A 1K8ZA 3KRSA 1A5AA 1CW2A 1EP3A 1VAHA 1QNVA 3EJRA 4CNOA 4TMCA 3EJQA 2EACA 4FLRA 2GJLA 3G18A 3I6RA 3LOTA 2CZEA 5DELA 5DCDA 2J27A 1ALDA 2QCLA 2B7NA 2YIHA 4JFWA 3TIMA 2QUUA 3USBA 3G0XA 1EEPA 2ZE0A 4IXXA 3STCA 4IX2A 5K4ZA 4NXSA 1THFD 3GB6A 1UKSA 2NV1A 3IIVA 1P6WA 1B3OA 2TPSA 1DKWA 3NQFA 3RIKA 3TR2A 4ZQPA 1XUUA 3CPUA 3NQCA 2FH6A 2F7RA 4XQ6A 1Q45A 3KAOA 1D9EA 4CQ9A 3EDFA 3BAKA 5HXMA 1H7NA 2QAPA 2OT1A 4O1AA 5F1VA 1KM1A 4LT9A 2XN1A 4UFKA 4X3ZA 4K8HA 3ZWSA 4XBSA 2QDGA 3OIXA 3SSJA 1UD6A 1ODUA 4C1LA 3MHFA 4LVFA 4HOXA 2CZDA 1DBTA 2QPSA 1W3TA 4JY8A 2OYLA 3ABRA 2RFGA 3O06A 4UTJA 3PAJA 5K2ZA 4AEFA 3L4ZA 3WY1A 1MW3A 4UQCA 1FDJA 2QCDB 3FAWA 3GXDA 1SU5A 3AJ7A 1TQTA 2WNQA 1VH7A 2A7RA 4OHQA 3WFZA 2Y7EA 1HTIA 1XL9A 3STFA 1HWWA 4UQAA 1CX9A 1QMLA 3H53A 1VC4A 2PRHA 2BY2A 3FFSA 1K8YA 2GQ8A 4YLWA 4BWLA 1BLIA 4IMDA 3C2VA 3TKFA 2R94A 4JN6A 2B7OA 4JFUA 1ZJBA 4XBKA 3DHFA 4YWIA 3W37A 4AEOA 1QAPA 1GEQA 3DKJA 3KL0A 2CHNA 1KXQA 4UZSA 4MZYA 4FNRA 3FJ6A 3IIPA 1YPIA 3BUBA 4NI3A 2O7SA 2QCHA 1E3ZA 2WOQA 4FF7A 4UTLA 2DH3A 2QJIA 2VFIA 1XUZA 1X8FA 2BHUA 3OLEA 1I8JA 3EXSA 1YTKA 3YPIA 1PIIA 1WOAA 4O17A 5L6UA 2G3NA 5TBOA 3QPYA 1XC4A 1MFVA 2HS8A 2VEIA 4JYDA 2W79A 5ABTA 3LV5A 1KFCA 3G8EA 3IVTA 5CZ0A 1QI4A 4UFIA 5I3HA 1Y7VA 1GCYA 3BLKA 3GNNA 4AVFA 4RR4A 3BCFA 4WLCA 4LVDA 5FEZA 1PPIA 1L9WA 2C1HA 3PR2A 4GUGA 3W7RA 4JEQA 3WJSA 2H3DA 1YADA 3W7MA 4HPXA 1H3GA 1ZJAA 3WY2A 5DY3A 4AHOA 4MUZA 5AB3A 3NPVA 1AG1O 5AYXA 4AWTA 2EAEA 3G1YA 3VGEA 4RK8A 3TQKA 1YYAA 3UQNA 1R47A 4GJ1A 4BZYA 1QPNA 3SR7A 1VCGA 4JFTA 2OYMA 4MLJA 1V5XA 3BAXA 4N4PA 3LXBA 1WE5A 3NNTA 3CZNA 2J9ZA 3TTSA 4K6AA 4HSNA 1HL2A 3TFCA 1P1XA 3A47A 2Z2UA 4X9SA 3DKLA 3QW4B 5LNVA 3L4YA 1TO3A 4DXVA 4XTIA 6ALDA 3V75A 2ZX7A 1KGUA 2Y70A 3UWUA 3W07A 1PJ9A 3T4CA 3GKAA 2YCEA 3BLEA 2GJPA 4UTWC 4KFNA 2A7NA 2QCCA 3BAJA 5KZEA 3TMLA 1WZMA 5DXXA 3W1PA 1TQUA 2JK2A 2C13A 2RDTA 1OX5A 3SY5A 2AAAA 4M6VA 1U83A 1HFBA 1OT2A 1ZHAA 1W54A 4JTEA 5KZMA 2WKGA 2ISWA 3MP4A 3HIJA 4J3WA 3SIZA 3R2GA 3W1NA 2ABAA 1CXHA 2D0FA 4PCFA 3HGRA 1XD1A 2VC6A 5G4EA 1X1ZA 2E68A 2NXHA 2ZX6A 1ZENA 1XSJA 2E6AA 4X0NA 2XFWA 1LYXA 1R2TA 1H5YA 3L4UA 3CT7A 5E70A 4XKYB 5A2BA 4ZQOA 2YJQA 1WQ5A 1G94A 1P0NA 2VEMA 2EEXA 2PWGA 1ADOA 2Z0IA 4RX0A 2QLYA 4Y8FA 2BXYA 1LBFA 4WD0A 8TIMA 1R30A 3NG3A 2ALWA 2X2HA 1U2YA 1SO3A 2Q8ZA 3DENA 1JDDA 3GR7A 5D32A 4E2DA 2V3EA 3FAXA 3DFOA 2AMGA 3M43A 1TJPA 4N9BA 5KINA 3VCRA 1EB3A 3BO9A 2CLMA 1CXFA 3NL6A 2Y7DA 2BSLA 2VFHA 1TTQA 4WJEA 1OG0A 4DELA 8CGTA 1G1YA 5K4XA 1KFJA 3O07A 3G1DA 1WA3A 4QNEA 5SWUA 2CLOA 1DVJA 4LXFA 2NXIA 1UKQA 4XTDA 3QMRA 4O0KA 3NQAA 3MP3A 3WEOA 3K8KA 3H55A 4Z0SA 1VYPX 4NJJA 2OSYA 1SZGA 3TSDA 4KWWA 5AFDA 1WOBA 3TQ0A 4ZMGA 4KWUA 3UPWA 2WPGA 3DFTA 4WSKA 2NXGA 1YTDA 3LHZA 5D33A 3Q2DA 3P81A 5I3JA 3CQ0A 3CTLA 4CCEA 3LHWA 1XI3A 1I45A 3L0KA 2DIJA 5LGZA 1MVYA 2W6RA 4RZ4A 2GUUA 3HJZA 2H90A 1JQXA 5AN7A 1ZNNA 1TREA 4O52A 4UXDA 5CPOA 1QX1A 2ZRXA 1IIHA 2ATMA 1PHQA 1T99A 4FX6M 4GC4A 3UWZA 4XZ9A 1KLYA 1TPC1 5TQLA 3CZGA 1L2UA 4NNAA 4UFJA 1QI3A 1TQVA 1SFLA 3MI6A 1GWJA 3TDFA 3UXAA 3L2IA 4JTKA 3EJUA 5CGMA 4UFHA 1LLZA 1UJPA 2ZZ1A 1TV5A 1CDGA 3EX1A 2OSXA 2DZUA 1AW2A 1NAL1 4O13A 1TTPA 4KFOA 1QW9A 2ZIDA 3E02A 4HOZA 1QPKA 4HNNA 4LUIA 2QCNA 2OMAA 4GINA 4ADTA 1KM0A 1RP8A 3GR8A 4GQRA 2D73A 1LLWA 3KVKA 1LROA 4AMAA 2C3ZA 3M6YA 2EKCA 3LM7A 1ZAIA 1XBYA 4GE8A 3P7YA 3HB9A 4PFMA 4O1DA 4FNTA 4GI8A 3L5LA 3S5NA 3LRLA 3N2MA 3PWAA 3IIXA 1MXSA 5C2XA 1XCWA 1UD5A 1F73A 4Z1DA 5I3KA 1LDCA 2F7PA 3ECQA 2NUXA 3LTSA 5E6ZA 3CU2A 2F7FA 3W1UA 1EWDA 4E2OA 3O6CA 4PTNA 2VRQA 3EKLA 4K36A 3N19B 4W9TA 1FBAA 4LVAA 2NT0A 2ZICA 1LRQA 4N9DA 3JS3A 1X7FA 2ZRVA 3SGZA 3MBDA 4JNMA 2PURA 4PC8A 2Q3RA 5LNRA 4I9AA 3VMNA 1PZ3A 3PF3A 2E4TA 2JGYA 3VNYA 4J3TA 5BRPA 1ZALA 4MIMA 5J5DA 2YDAA 1CGTA 5I5RA 1BKSA 3BSGA 3W85A 3K8LA 3M7WA 2Y6ZA 1UH2A 1A50A 2I1OA 1PIGA 3UERA 1RZMA 3BLFA 1JXJA 3EWUA 4WY0F 3T40A 3S9YA 4KKXA 1TPB1 3S1UA 4DQWA 1KTCA 1VB9A 1L6YA 3R8RA 3STGA 3P8JA 3W73A 2ZZ4A 1QOQA 4AW7A 2EF9A 3EWBX 3UZJA 4P2VA 2OYKA 3U2OA 4NJIA 2DZWA 3ATZA 3UNDA 3VGDA 2C8NA 1FWWA 2V5BA 1PZ2A 3FOKA 1H7WA 2YX0A 1TQSA 3EX6A 4RKAA 4NU7A 1G9HA 1UD8A 3D4ZA 3C2FA 1DJQA 3R5EA 2CLEA 3I7RA 1IXNA 5K9XA 2A85A 3UXDA 3THQA 2ATSA 1FX6A 1FDYA 1F6PA 3JR2A 2EPHA 1R33A 4WF7A 3W22A 2D0GA 4PH6A 1KM2A 1KV5A 2EQDA 1E51A 1KWGA 2E6YA 1Q6QA 3KLLA 4LPCA 5C6MA 3UEQA 1G6CA 3HZ3A 4HIBA 4OV9A 1NFBA 4QNWA 2NX3A 1FXQA 3VGHA 4LS2A 3W1LA 1LOSA 4UUIA 5FEXA 4PEKA 2FTPA 4GWEA 4QM1A 1SO5A 2ZRUA 5BW6A 1LCOA 4O28A 4PSPA 2H3BA 5LNUA 1TQJA 3QSTA 4TR9A 3P67A 1TPH1 4Z1AA 1VHNA 4JD4A 2YW4A 3L2MA 3KLKA 4JCLA 2B0MA 4GI6A 2YW3A 3QSRA 1TIMA 2A21A 4FNQA 4O14A 3W83A 1SW3A 4MY1A 5D02A 1W8SA 1TTJA 2VOMA 1AL7A 3NXFA 4H6KA 3WENA 2FHCA 3AJXA 2HTMA 2XWEA 4GUHA 4O53A 5C55A 3DH7A 2A4AA 1ZJIA 1VJSA 3AO0A 4ORIA 4FHAA 4G1KA 1VLIA 2R8WA 1T8XA 2WJZA 4JTFA 4X9YA 1GTEA 4O16A 2NLIA 3OHIA 5FEWA 1JUEA 1WYIA 3TQVA 4JTUA 2ZX9A 3L0GA 4TU1A 2YA2A 2C15A 4XKYA 1SR9A 3HPSA 4MFEA 1YLVA 2J6XA 5KEZA 4JDYA 2E09A 4NJGA 5LKYA 1XSIA 4JL1A 4O15A 3T78A 1B0IA 3IEBA 4UTWA 4CQ8A 2ZZ7A 3HPZA 3LCHA 4IUOA 5DFAA 5BOOA 3BW4A 5F4WA 3PSWA 4UCFA 1TPFA 3NM1A 4O19A 1NF7A 1Z48A 2QR6A 2F2HA 4GNJA 5EA9A 3TU9A 1HXKA 1FCUA 4XB3A 4O11A 1PE1A 1LRNA 2PC4A 3BG5A 4N9EA 1TPEA 4FEZA 5KSWA 1MXDA 3IRDA 4U33A 3G3DA 3VO0A 1RQHA 4M56A 4UNKA 2PRLA 5F1UA 4BF9A 3W38A 3DX4A 3BARA 4AH7A 3L4XA 1OK4A 1XFBA 2QMJA 3IVSA 4POCA 4UNLA 4AHPA 1WO2A 4R34A 5A2CA 3IGXA 1H7PA 3QGVA 1GTHA 4NXKA 3VMOA 4O12A 3HQ1A 3CEPA 2G95A 1OVDA 4UR7A 4S2CA 3W7LA 1GJUA 3LX9A 4GO9A 2E5BA 1ICSA 2QEZA 3QM3A 1KFEA 4RLIA 5HMSA 3HG4A 1XGZA 1J2WA 3NA8A 3VX1A 3LGEA 2X1UA 2ZA1A 1TYGA 2WNZA 3BCDA 5TIMA 2W0UA 4MY9A 5D2XA 4Q32A 3WNKA 2DZSA 1EA9C 3VSTA 4MVAA 3M44A 5T26A 2YR1A 1VYRA 3NQ6A 5AOUA 2VFDA 5KTLA 3TK7A 4DEFA 1WX0A 3LXCA 4UR8A 2BX7A 3M1ZA 3QJAA 4OJYA 2Y89A 5G2HA 1GZGA 2VEKA 4CVWA 1G7VA 1LM1A 3VI2A 4O54A 4ATWA 1M7XA 3C52A 2RKXA 2DIEA 1RPXA 1DHPA 3C8FA 3QQ0A 1SZNA 2FFCA 1OFRA 3MJYA 1JL8A 1QR7A 2NWRA 3JRKA 2C6QA 5EKYA 3LI0A 4HKPA 4DPQA 1JI1A 3TAKA 2E5CA 3RMJA 4TO8A 4BI6A 3GX9A 2FPVA 1EPXA 2ZWZA 3DXIA 3OEXA 3ZOAA 1G4TA 1RQEA 4Y9AA 5AHLA 4M19A 2WVTA 3TE9A 4GRSA 1JG9A 3F1QA 2YKKA 4UTUA 3GDRA 4E2BA 4UOQA 1OFQA 3LERA 4FMVA 3WY4A 3EWYA 3W2JA 4Z1BA 3GLCA 1OFBA 4J3UA 3DFNA 4AYGA 1XH2A 1W5QA 2V8ZA 3QMTA 2HS6A 5D05A 1KV8A 2WPBA 3LHVA 1NOFA 3CWOX 5G1YA 4HNVA 2DU2A 3UWYA 3L0NA 3B03A 3W9ZA 1WZAA 5F7UA 3BAYA 2J88A 3L68A 1G4SA 5EL1A 4DBEA 2DZTA 1TJRA 3IJ8A 5LNWA 1OT1A 2A6NA 2NSXA 2G97A 3ZO9A 4M8UA 9CGTA 3T44A 1AQHA 4K7YA 3WK3A 3KHJA 3A4AA 3GXPA 3RLUA 1DHKA 3S5YA 3PBVA 4ZZ9A 3CM4A 1OFDA 4UFLA 3VNDA 2QUTA 3LV6A 3M5XA 4UC5A 1RPKA 4Z08A 4FLOA 4CNNA 3C2EA 3N2XA 1J0HA 4QISA 4YL2A 1Z41A 5MHBA 4WXZA 1UA3A 2QF7A 4LRTA 3ANYA 3UG3A 3G1HA 3GKFA 2VFFA 2QV4A 1BTMA 1IF2A 3W2UA 1SSDA 5CZSA 4PL1A 1GJWA 3WJYA 2H6RA 4I7VA 3ZR4A 1KM3A 3UPBA 4HNUA 1QO5A 5HWMA 1M7OA 5I3FA 5CSRA 4AF0B 2C14A 5LGXA 4CLMA 1BVZA 2HSAA 2OW7A 2TMDA 5CPNA 3TOPA 2D0HA 5C5YA 1JAEA 1K02A 3UWWA 4LV4A 4B9ZA 2OCZA 3EDKA 3I7QA 2BZNA 1O94A 1VR6A 4NQ1A 4A21A 3WNMA 2F7OA 5CLWA 3EWWA 3G1AA 3PG8A 4RXFA 3VM7A 5LZLA 1I2PA 2VKZG 5HR7A 1JD7A 1OGSA 5H2ZA 3FIGA 1UOKA 1IXPA 1W1ZA 3GYEA 2RH9A 2E6FA 3UWQA 4U28A 2WQPA 4GUJA 1M53A 2FYVA 3PBUA 2CLFA 5F2MA 2YPIA 3NQEA 4ZQMA 1AW1A 2A5HA 5F4XA 3W1QA 4LVGA 1EHAA 4MB1A 3AXHA 4W93A 5KMYA 4UMCA 4AHQA 2X1TA 1MSSA 2YSWA 3O1NA 2F1BA 4WXYA 1DORA 1X6UA 3PUDA 4A2SA 4I7UA 1ME8A 3I68A 3BVXA 1Z32X 3L4VA 3MHUA 3W7GA 3N73A 1N8FA 1SMDA 3OVQA 3TC7A 5E6YA 4OQVA 5CGQA 3R89A 2YZRA 1K7EA 2QJGA 5F2GA 1TPVA 3RK8A 4UOZA 1NVMA 3U8GA 4AYSA 2Y2WA 3C61A 3EXTA 1OFPA 2A0NA 1J5TA 3T7VA 3MYOA 3KVMA 4IMGA 1BF2A 1GYLA 3GZ3A 3W23A 1P5BA 3IGUA 4FIRA 1VCFA 1LWHA 1O5XA 3EXRA 2ISSA 2OW6A 4M7SA 4UCGA 1JUBA 4H8VA 5U7SA 2E5DA 3W2LA 4U2YA 1QW8A 1WPCA 3GVGA 3N9SA 1K3UA 1VFMA 4IJBA 1MXGA 2WVUA 2OSWA 3FKRA 3R12A 3BH4A 1KCLA 3DX3A 1O60A 1U5JA 2GVLA 3W86A 3CZEA 3M5VA 4JTIA 4UTMA 1DQWA 3UG4A 3O16A 3ZT7A 3BLPX 3QPZA 2VFEA 3VFLA 1TV7A 3FA5A 3VGBA 2Z1KA 5J5RA 1D3GA 3TFXA 1QI5A 2QCEA 5HNRA 1EWEA 4UTHA 1IXQA 4PCSA 1EO5A 1RP9A 3CC1A 3L5MA 2ZRWA 4O50A 2D3LA 2ZTJA 1WDWA 5A6MA 4K8EA 2WVVB 3P61A 1V7YA 3CIXA 4S1FA 1TCMA 4QJ1A 4WUIA 1LWJA 2ZCGA 1H61A 4JGDA 4NVTA 5HJLA 5LHEA 2GVYA 4GIAA 4O1BA 3WN6A 3MBFA 4IQLA 3GIYA 1UUMA 1N7KA 4LVBA 3DGRA 5DXYA 2PWFA 2A6LA 1CGXA 5DCEA 3W7OA 4CCDA 1GVFA 2P10A 5D09A 4MYXA 4NZFA 3LXAA 1LOQA 4Q33A 2Q8LA 3NQGA 4MPQA 3BG3A 4TVUA 5FEPA 3TSMA 4LUJA 5A5WA 3C3NA 5HWNA 4M6QA 1JJKA 2NZLA 2ZQ0A 1JCXA 1CLVA 3KWXA 2YFOA 1KWKA 2TAAA 3D50A 3WDJA 3ZQ9A 1AMYA 2E77A 1K8XA 3NZRA 2FJKA 5HWJA 3B4UA 3ABQA 1JXKA 3I65A 3LLFA 3CLWA 1FWNA 4LS0A 5I3IA 1F05A 3L9CA 4IOTA 2VRKA 2H8ZA 2QCFA 2J9YA 5H91A 4KFPA 4BI7A 3HG5A 2CPUA 3M41A 1R34A 1SO6A 3DU0A 1UASA 4WOQA 4H8UA 4CNPA 5BRQA 1IV8A 1BG9A 2OZ0A 3HOJA 3UCQA 1PV8A 4IPIA 4Z1CA 1QOPA 3W7HA 3IK2A 4JX4A 2GJNA 2Y62A 4YCPA 3EJTA 4UMBA 1TPWA 5AC8A 1JF5A 4N9CA 5EBUA 3W2MA 1TMQA 3D0CA 3DHUA 3NL2A 2FH8A 4DO5A 3C6CA 1RD5A 3GDMA 1Z42A 3NOEA 3O8AA 3E9AA 3BUIA 2XVKA 3W74A 3NQMA 3P5YA 2BHYA 1OX4B 3WDIA 2GVJA 4N2YA 1S5WA 3W71A 2E1DA 1PHWA 3WMSA 1EIXA 2YOCA 1B9BA 4EF8A 4E0CA 2BXZA 3W1AA 2B7PA 1OB0A 3EJPA 3W7QA 5AHEA 2E6DA 3IJ7A 2F84A 3DZ1A 3PB0A 4JTLA 1CGYA 1QWUA 3NPWA 2VEPA 3BW2A 3W2NA 3HJEA 4ONVA 3NVTA 2BY0A 1HVXA 3QRHA 4NJKA 4Q4KA 3W1XA 2ABBA 3MI2A 2X30A 1H7XA 4QIUA 2JKAA 3ZSTA 1R2RA 3C4UA 5DBUA 1G5AA 1JQVA 2R14A 2E8YA 1MEHA 2CLHA 3W76A 1AW5A 1JR1A 1M6JA 3PC0A 2QDHA 3W1MA 1H7RA 4L4MA 3VE7A 1TB3A 2GOUA 2QKFA 3ZFHA 5FF7A 1BVNP 1JRBA 3NL5A 3LB0A 5AHIA 3M47A 1KFKA 2FLIA 4MYAA 2WANA 3G0UA 1W3NA 3NPUA 1SW0A 6TIMA 5DN1A 4O4VA 4GFSA 1O4UA 5AYZA 4GI9A 1TPUA 4NZJA 5K3VA 3BVUA 1GVRA 2EABA 3TROA 4GQQA 2ZA3A 4E38A 3WK1A 5FF0A 4FIQA 4JTGA 2ZXQA 4GO8A 1S46A 4GBUA 1CPUA 1FWSA 3LTPA 5G1TA 3TCEA 2X16A 1MWOA 3D51A 3G1FA 1ICQA 2GUYA 4FLQA 2ZRYA 1SQ7A 4I7WA 1EA0A 3HG3A 7TIMA 1J0JA 1GT8A 2XN2A 2FPYA 4HPJA 4JTSA 4M5PA 5EYWA 5CG7A 4WX2A 3NQ8A 1EX5A 3G3MA 3P8IA 3PBYA 4CN4A 4M6PA 3K8MA 3LHTA 4A3UA 5KZDA 2V2HA 4JL2A 3CGTA 3FW6A 5G2IA 3GDLA 3PULA 1FWTA 4X2RA 1W37A 1JCLA 4JX6A 2CZ5A 3IIOA 3WELA 3ZSSA 1F5ZA 4AAJA 2PE4A 4KWVA 2FHFA 3EX2A 4CKQA 1XBXA 3BK0A 4O57A 3EX3A 1ZAJA 4FB7A 1XM3A 3P62A 3WNPA 2C7FA 3HO8A 2GVGA 5U4NA 4CGTA 2WSPA 6TAAA 3TJLA 2VUYA 5EY5A 4MJZA 1W5NA 4PCTA 3NAVA 2XWDA 1WBHA 1YDNA 2Y61A 1A5BA 4R7JA 3TX9A 1AK5A 1JF6A 3QZEA 4LTSA 3R13A 2BXVA 1IXOA 3MHGA 3GTNA 1J4EA 1OYAA 3IVUA 5D03A 2XVLA 1YXYA 1OSEA 2B7QA 1V3LA 1A5CA 3TMQA 2I14A 3AMLA 3MYPA 1KTBA 4GXMA 4EVZA 1H1ZA 5LHFA 3M07A 2X1SA 3CWNA 1W5MA 1OK6A 2RDWA 4BI5A 3W2KA 1W31A 3G8RA 3OBKA 4XWUA 2G3MA 3PVFA 1JD9A 3WNOA 1GQNA 1H1YA 4JR5A 4DBDA 4YCOA 2GJRA 1WZKA 4N6EA 2BWGA 3VGFA 4CCCA 5K9CA 4X22A 4OIFA 4JTTA 3LRKA 3OLIA 1L0PA 2Y7FA 1FCVA 5CZTA 5I23A 4DPPA 1WXJA 1S5VA 3O05A 4IMCA 2ZFAA 1I2QA 3Q37A 1C29A 3NQ7A 3VU2A 3L4WA 5BMWA 1N55A 3WNLA 3W7JA 2BHZA 3HGJA 4FXSA 2WCSA 1T0OA 1UCWA 4QQ3A 4D2JA 3TONA 2YYTA 2NT1A 1V3MA 2KZHA 1P4CA 2CWNA 3BVVA 3KEHA 1OHLA 2CW6A 2WSYA 2BTMA 2CXGA 5CKSA 3BW3A 2ISVA 1RVGA 3CIWA 1OX6A 3DI0A 2FQIA 2GQAA 4ICNA 2QCGA 3G1VA 1QHPA 2Y5EA 1XCFA 1GVOA 3OLGA 1BWLA 1FCBA 3T55A 1E3XA 3L5AA 3C0JA 3PUEA 1YTEA 4P61A 3UY7A 1KBJA 2YFNA 4U3CA 4UQBA 2NUYA 5KITA 4FNPA 1NM9A 4J28A 2ZUVA 4J7RA 3HGSA 5FF4A 4AWUA 2ZUUA 2P1FA 3EEGA 4UTTC 3GK0A 3LCXA 4UNIA 2I9EA 1WAUA 1LP6A 3WFAA 4OKDA 3BGJA 3HPXA 2J9XA 4RCXA 1J0IA 4N02A 2CLIA 4O18A 1ONRA 1Y0EA 3GBEA 1QPRA 4WOZA 1JULA 3W1RA 1VZWA 1S3HA 3DFPA 2VELA 2RDUA 3LI1A 4HT3A 3W7PA 4LRSA 1XV8A 1KA9F 1JDAA 2QPUA 4MKNA 1FQ0A 2PRMA 1QCWA 3LCWA 4UTTA 1XBZA 3P74A 4LV9A 3EX4A 3VNZA 2A1YA 4DF2A 1VHCA 3P82A 3C2OA 4MJMA 5AHFA 3QYQA 4ALDA 5CGTA 5BNKA 2ZUSA 3NM3A 1KXVA 4AWSA 5LNSA 3KFTA 3CHVA 4GKLA 3FKKA 2CU0A 1GG1A 1G69A 3G1SA 1JGIA 3ZS4A 1ZFJA 1A5SA 4HPHA 3TXZA 5D2WA 3NZ1A 1UKTA 3LCGA 2YA0A 3NQ2A 1ME9A 3P84A 1B4EA 2ZRZA 3M9YA 3ATYA 4BWLC 1IZKA 3RFAA 2ZUTA 3ZR5A 4Z0JA 1KBKA 1HUVA 1TRIA 2WSKA 3H54A 4UQ9A 4K38A 3SZ8A 4B5NA 2NUWA 1R2SA 1FXPA 3SGUA 1LOLA 3NL3A 4JTHA 3A9IA 1PAMA 4BK9A 5D2VA 2JBMA 4OU1A 3GXMA 3N14A 3RLVA 2WO5A 1CXIA 2IGTA 3NYZA 3CPRA 3W3OA 4O4WA 4NNBA 1KM5A 4JYFA 3DC0A 1UBSA 1L6WA 1KGWA 4ML9A 2ZUWA 1OFAA 3LTYA 3W72A 3MWAA 3GBDA 5I3GA 2QCMA 4O1CA 4CN6A 3D52A 2DJLA 2OJPA 1BAGA 3VM5A 3DDGA 1FY6A 2Y88A 2P0OA 1MFUA 3HBLA 1JCNA 3C56A 3F03K 3LBMA 1KBBA 3LBCA 1MW2A 1JVNA 3NO5A 1W3IA 4JDBA 4ZQCA 1DL3A 2V81A 1DQXA 1QFEA 1JDCA 4J3XA 5K9DA 4QAWA 3VSUA 3NQDA 5G5IA 3ABOA 2Y24A 2PWHA 2C0AA 4S2BA 3GXNA 1EO7A 4BA0A 3KOFA 1HL9A 3LRMA 2QCDA 2Z6IA 1XD0A 3A5VA 3WJZA 1VGAA 1HTYA 2XIIA 2ZA2A 3VSVA 4NJHA 3FEMA 4O0ZA 2TSYA 4R53A 4O8RA 5CPMA 1D3HA 1TQXA 2ZDRA 4LU0A 1Q6RA 5A6LA 3IGSA 4U31A
chains in the Genus database with same CATH superfamily
3S34L 2OR9H 3N42B 3P4OA 4LPWA 5ESVB 3HV8A 3VFMB 4RV3A 2VH5L 2FIQA 1NAMA 2F18A 3AG1B 1DO6A 4BWWA 4LDOB 4EZMA 4YSQA 2DQGH 4B9GA 1A7QL 1GKPA 4M6MH 4X42A 4X99A 5G2NA 3PZNA 5EORL 4RZCA 1UOVA 3GI8H 1TPDA 3Q1EA 5TK4A 2UXGA 1DQLL 1UCBH 4Q4EA 4JICA 1H6EA 4JFDE 5KBPA 4H8HA 5FFLA 2EO7A 3UR2A 1IAKB 4GAYB 3RX8A 3TNMA 2V2TA 3AY2A 4NKIL 2YXMA 4L5FE 2ZYIA 1NCCH 4QRRB 1DZBA 2AJSH 3ALPA 4HWZB 3EDEA 1T8QA 1GYNA 3AU1A 4PJCE 3S2JA 2PEVA 1PZUB 3ULSA 3D08A 4HK7A 1WNOA 4N90E 2EKSA 2IAAC 1AZZC 1NKGA 4NFCA 1A7QH 1JVLA 2LU4A 3U57A 3L7FB 1B4KA 3RAOA 3DTXB 1IVUA 4B9YA 3O4OB 2VXNA 2P44B 1I8KA 2TYSA 5EZJA 5IB5B 1Z5LB 3ULUH 3WLWD 4JFXA 4ES9A 4V11A 4N2BA 4LE8A 2BIOA 3IPFA 1G1KA 1W0YT 3VTAA 3WIHL 2IMRA 5INCB 5J13B 1JRQA 3GM8A 4A8RA 4WU7A 2YN3A 4X6EA 4XHJD 1FF5A 1JNNL 1G7LB 4PJBF 1IC7H 2IW0A 3P93A 3VKDA 3MRLB 4MMZB 3W7EA 4MDOA 3TSBA 5JQ6L 2KC0A 4IOIA 2V6HA 2KMWA 3NZ8A 5HHME 3JTTA 4FTDA 3QUMA 1IQDB 5FA3B 1R6VA 2BVOA 4AQ8A 4EDXA 1SOSA 2KI6A 4W5ZA 2A83A 1PFCA 1RA0A 3AOFA 4U7SA 1EDYA 4LSPH 1AOZA 2PW2B 4ZVJA 2YJLA 4P2OC 4TN9A 1B2WL 2F68X 3L66A 1KCSH 1A65A 3WL9A 1SFJA 2V5LA 4FC3E 1E7UA 1K6QL 3NQIA 1TG7A 1MIML 5L8JB 4H5SB 4M5TA 3F4WA 4B2DA 1ACZA 2X1OA 3LD8B 3NQBA 4ONOA 4BHUI 4KY1H 1YY8B 4RRPA 4F0SA 1JNHA 3AS0A 4M93C 1XKYA 4XAWH 2ZKYA 1SXNA 3RGHA 3G24A 3DETC 4WDIB 4KCWA 3KXQA 4N3TA 1UB5A 1M7JA 2J8FA 4IMEA 4MA1B 4HS3B 3BPCA 4P0DA 3DGBA 2FLBT 1FNHA 1NCJA 3DYPA 5F7HA 4X2PA 3UFYA 3BLBA 4TVCA 4LH8A 3T8XA 2UV3A 1C08B 4AQAB 1ZXKA 3U2CA 3VIHA 5KUMA 1AZ2A 3WS6C 3H3KA 5B1JC 1AZVA 1S7XA 1UROA 2X4TA 3FT4A 4ALAL 1I8MB 3BPWA 2V82A 4LNYA 1KKRA 3CAVA 3D25A 4OQTL 2CLKA 4HIXH 4M7JL 4A7GA 4APXA 5I1LA 5JHDA 3U2EA 4M7KL 2BIQA 2WCOA 4NQSB 1Q7MA 2HJFA 4LAKA 2H6UA 5F6HI 4Z1PA 1G7UA 4M6NH 4N0YH 2W94A 1V55B 3X13A 2Y7QB 4EI5A 2FL5A 2ALRA 1G9EA 3C87A 1QJWA 1RWAA 3KR3L 5AW3B 1ZS2A 2N4IA 4GAFB 3VXUD 5KVDE 2NY6B 3F5JA 4OF7A 3KBSA 3UAJA 2D03L 1QYGH 4QRRD 4UDUA 1UPMB 2F54D 1IQWL 3B83A 5B38B 3WFBH 2KYIA 3NFNA 2C1PB 1IBYA 1MVFA 4EP8C 1SFSA 4FO4A 4PUWA 4Y7MA 3UJIL 1DP0A 4ZMNA 4LIQL 2BSRA 3LZPA 2Z1VA 4UIKH 3HE6A 1MY5A 2OTUA 5CZRA 5EU7E 3I74A 4B3EA 3IXTB 1F76A 4H2AA 1HOCB 1A21A 4X6DF 3EJZC 3D4YA 1IT9H 3AADB 1HO4A 2WB1A 3CFNA 5AKSA 2PZNA 3LDVA 2FBRA 3MDUA 5B8CB 3PBWA 5BXRA 4NWTL 4C83A 3LQAH 3MREB 3NJNA 2DIAA 1I1YB 3IRCA 3V5KB 1LD9B 1D3CA 1PS3A 2GJ6E 1A3XA 4C6QA 4G8FB 4A6YL 2KBGA 1ZCOA 3LKSA 1PL9A 4QCEA 1Z9OA 3N9GH 1WDRA 2Q8AL 4JFSA 3EUDA 3BN3B 3X12B 1EFXB 1K85A 3N34A 2XN0A 3VI4E 1DVQA 1QD0A 3RLGA 2PCQA 2PFHA 4FXKC 4IL0A 1W3LA 3W7DA 3TIDB 1W72B 1HINL 2NY2B 2WOYA 4JTAA 4JRYD 4DVOA 3O2DL 2ZZ6A 4UTAH 3GW0A 4Z77B 3X41A 3NDOA 3QORA 1LO3L 1V3IA 1G7PB 4KTDL 3FRUB 2MNJB 3HI5L 3JV6A 2QGBA 3GQFA 1FIGL 3CHEA 4HIJB 4E3VA 1KTDB 2XWCA 3QA3B 4WU5A 1P7HL 2CO1A 4EF9A 2CERA 3E0FA 1MO0A 3V5HB 3VFRB 5G2WA 3GJFK 2OEJA 4HIEA 3KX6A 1MUWA 1E7VA 2P80A 1Q9LB 1YNTF 3UO1H 4Z3GA 3AU1B 3WTSA 4JN1L 5CXPA 2H9AB 3W88A 3S9IA 4OF5A 1JCMP 2H5UA 3GM0A 2QYGA 5HHNA 1K9TA 1W9BM 2KZWA 5CSBA 5BOPA 3FZUC 4M43H 2XVGA 1AXIB 4DN4L 4JXCA 3W27A 5C92A 4RJEA 3DX9A 1LEKB 4GEIA 3WEMA 1MQQA 4FXRA 4ZMPA 4WK9A 1HX0A 3VB8A 2GVEA 5MP6L 3SDAD 4FYSA 3KS6A 4HHPA 4YWGL 5G5DB 5AC7A 1CFSB 5FO2A 2Y7MA 3BUPA 3KAAA 4R4FL 5H37G 3NDYE 2AEPL 1XLBA 5CBIA 2H1XA 3PIQA 3BIBX 3QIUC 4FLHA 4BJLA 1KBGH 2OLDA 1U8QB 5KS9F 1WUEA 3DXAB 1RVFL 1HEHC 3FUNA 3QDJE 4C91A 1FVCB 3SKMB 1KC5L 1OW0C 3U4AA 3ZT5A 1UR3M 5AALA 2QJJA 3K81A 2ZWYA 4FFVC 1AMKA 1TWDA 3WO8A 1VF5C 4C4KO 4OFYA 3RCMA 3IK4A 2DI9A 2EVFA 1WAAF 3EEZA 3NIDF 4LLUA 3DGCR 4NO5B 2WGQA 3RTQD 3Q8BA 5I26A 4XUGA 3CLFH 4KMTL 3HC3L 1T1YB 3TZVA 1RFDL 2DV0A 4EO5A 3BC9A 5KVGL 1PVNA 1WBZA 3WKNA 5K93A 5A2JH 1KM6A 3OP2A 3RF9A 1LMKA 2ICWA 4JN2B 4DP9X 2AAMA 4FQ2L 4BH8B 2CKBA 3BMVA 1V03A 2GGHA 3PZQA 3SUWA 1UWGL 2D4FA 1JTTA 2XFXA 2GDVA 3KEDA 3DX8B 2YAFA 1RVFH 1IU1A 3I9IA 2O5ZH 3UX9B 3E96A 3BVTA 3PP4H 4AKPA 3WD4A 4YLBA 3K2UH 1KGYE 4DHLA 4FNVA 1DTUA 1DBMH 3WA3A 1Q85A 1P2CB 2QFPA 3C2AH 3GT6A 3CVHB 1GZQA 3ISRA 2VDPB 3KPTA 4FQCH 4LCCC 4XWOC 1GVSA 2PW1B 4JFFA 1IGSA 1QBMH 3ZDWA 1CLKA 4KCVA 1GOFA 3OPZH 5DHEA 1BYCA 4E41E 1QUMA 1LM8V 3B06A 4I4WB 4G8EA 3P40A 3P4MA 1JGUH 3IBEA 1UZ1A 3X3ZA 3K30A 4FQJL 1L6PA 4KROD 1EDQA 1E5ZA 2DH2A 2QQNH 3ETSA 5DVKA 5E8OA 4IRJC 1CGUA 1BYPA 4F4RA 3V6BR 3L67A 5L9FA 1YAZA 2FL5B 3MUAA 2J8TA 4FQQA 4LOUD 3EWCA 1IM3D 3CXDL 1KXTB 4L29B 3WBAA 1GPFA 4N5UA 4Z18A 1K4HA 2Q3OA 4KX8A 2OMYA 5L2KA 1CYGA 1SF5A 3PFUA 1C5DB 3PL6B 3THCA 2VLKD 2MCPL 2IADB 5HDBF 3QPQD 3QSKB 5FGCE 1OJXA 3NREA 3MVSA 4WDXA 5BRZE 3T0AA 3HTLX 1X1OA 3LMJH 2FHBA 4K68A 3QORD 4H1ZA 1NFAA 4AYBA 1MQKH 3B8DA 3E8UH 3IETB 5ETUB 3MCKA 3W87A 3WL0A 4B3ZA 1FO0B 3MRQB 1RH8A 4PJAB 1F58L 1SF3A 5B7EA 4MLRA 2EADA 3UGUA 2AXFA 3TH4T 3LPFA 4XMTA 3OV6A 3U4FA 4NKOB 3ZVHA 1CGWA 3UCDA 1P7TB 1U3HB 1B90A 1BIHA 4A2HA 4ZYKA 4H4IA 3MO7A 4M7TA 2HVJA 4OK4A 1YEHH 4CQAA 1LVNA 4G1EB 3S42A 4QHKI 1W80A 2X70A 2EZ0C 3OLDA 4LEBA 5AYUH 3ZDYB 3ZTJG 1MQRA 2FB2A 4H6RA 1O66A 3SI9A 1DBBL 1XIWD 3BP4A 5GRYA 2AXJA 1WLHA 4GSUA 3DBSA 4D3CL 1LL1A 1MCFA 2AL2B 4CD5A 1PZ1A 3STPA 4FG6C 1C90A 2JGQA 2NSOA 3L3GA 3OXRA 4RRPG 4QPEA 5FKPA 1SZFA 2H1PL 1WGVA 4PRBB 3AFJA 3RX3A 4A35A 1L7TL 1S9VB 4Y90A 3UBXA 4IW4C 5EC2B 2DWTA 1JK8B 5FGBC 3N2CA 3SW6A 3Q3GB 3E0LA 1QO2A 4S0HA 3IDIA 3ULVE 4WO4C 2GT9B 1WDPA 5DVMA 2A6KA 4L65A 1F4XL 5AZ2L 2XTJB 4JRFA 4O2EB 1RCQA 4QSHA 4AZUA 1NICA 2A4EA 4PJ8D 5D70H 1S2TA 3DUUA 5C09E 4MD5B 2DLHA 3IJEB 5C9UA 5D2NA 2J4WL 4WQ6A 3BN9C 3VCCA 5HHOA 3W9DA 4XC3H 3DFQA 4G59C 1EJWC 3WOVA 1P43A 3EB2A 1KTKE 4OT7A 3M16A 4NKMA 1UM6L 4ZX5A 1AGCB 1L7TH 2OSLA 5IOPA 1JZ3A 2BMKB 2A4ZA 4U1HB 1PYMA 1XBVA 1BF5A 2AABL 4DNLA 4LEFA 5EMUA 2FUQA 2NCEA 4IGBB 3MQIA 2E2VA 4I77L 2BRVX 5C9KA 2AF2A 5GSRA 4ELMF 4FG0A 3DX0A 2YB4A 3FO9A 1H62A 3H2WA 4PJ5A 3C0LA 3NSJA 4Y4HA 1VADA 3MWXA 2G96A 4XO9A 2ZKMX 4R9XA 3VCLA 3S2NA 1AGEA 5T5NF 4KQ4L 5AC6A 3SB3A 4TXVB 1YNKL 3CTTA 1N12A 1KULA 4LUTB 1TKWA 2JKWA 1EP2A 3PZGA 1IU7A 4PJEB 4JY6B 1Z0NA 1FSKB 1GGYA 3DDFA 3MLTA 4NO5A 4UQDA 3T1FB 1AL8A 5FO9A 5J8LA 4PJEE 5F9WC 1CE1H 1L7KA 4Y9CA 5F2IA 4KRLB 1TVBB 1DV7A 1I9CB 2D3VA 1KW1A 4XC1H 5IFHH 4CCZA 5HI5C 1U8CB 1EV2E 2AQTA 2BSSB 1BX2A 5E2UL 5SWZB 3TO4A 3UZEC 2AGKA 3LLXA 3MMTA 4GOAA 5D9NA 3W1TA 3VMPA 3ACTA 4R96B 3RILA 2R2EB 5ECUA 3F58L 1U8JB 4LRNL 4UT6H 4AZHA 4AL8H 4BQ6A 1TU2A 5F93C 4YHML 2D3NA 3DCDA 1Q6OA 5G1MA 3T6XA 1THCA 1JCJA 2YEQA 3GIPA 1E8XA 3QEGH 4TNEA 1NF0A 1R3TA 4PJHB 4PTVA 2UXTA 3MSYA 3KBMA 5GS0D 3T65B 1FUNA 3VDCA 1K6WA 1CE1L 1HILB 1XDLA 2NV2A 2QVIA 3PREA 1BEXA 3K6NA 3PWPE 1CDHA 1NZRA 1CXEA 1IC5H 2F19H 3O6FC 4OGZA 1W1IE 4LYRA 2X6UA 3CCHB 5KW9H 4S1RL 4AQZA 2XU9A 3GRGA 3LPPA 3IDUA 4XP6L 4MMWA 1F6AA 1W9PA 1V7MH 3BKYL 4HBQA 3G22A 1K7XA 4UBDD 5C2XA 2R1WA 5D1ZA 2X05A 3QARA 3MJ9A 4AEEA 4ELMB 2FGLA 3Q6FA 4RV8A 1HG3A 2ZZ5A 4KS0A 1UP2A 4LB8A 3K1GA 2XG4B 4CVUA 1LYQA 1VRDA 3V5CA 1HT6A 2IOMA 5ESAA 3QEGL 2VC2B 3BV4A 4K39A 1MN4A 2WCGA 3UJFA 5EMKA 3GSVA 2DQFB 3BUQA 4MOZA 4J1UB 5J06A 1Q3NA 1N2VA 2IAMD 2ZZ3A 4BHYA 2V5TA 4F0LA 4CVZA 2XVBA 5ADOL 4MB3A 1QSEE 3PPSA 1MJJB 1VQTA 3ZE0F 3FT3B 1W16A 3QZOA 4R97B 4HALA 4N4QA 2CK0L 2P42B 3IXAA 4P8XA 4PYSA 5JIQA 4LF2A 2J1KA 4PR4A 4UZUA 2AKMA 3U79A 3UD6A 1QFUL 3AXLA 4RIRA 2VURA 3W84A 1MW0A 3WQPA 2CFGA 1UR4A 4AQAA 2Z6JA 5CBAA 4KO5A 5IVXE 5C0RH 4Q9BA 4ZFZA 2YGYA 3P0VL 4ERIA 4LNRA 3RNDA 1FO0L 2QQLL 3PHOA 3CFBA 3KXFA 5HUOA 2O61B 1U3HA 4XNUL 3GB7A 1VP5A 2PDMA 1R5WB 1RZFH 3I6KB 4GFTB 3LHUA 2X89A 3BT2H 1WP6A 4H1LH 1AHWA 5AQ0A 4S3CA 4MXWL 2Q0ZX 4J2XA 5AOMA 5IHBA 4PV9B 1W9DM 1GOXA 5F9AC 1HL5A 2FZ3A 1LORA 1XZ0A 4W9EC 2ERJC 2I69A 4E9XA 3TWCH 3RRSA 2OP4L 2VDQB 3QZPA 3GC4A 2WVVA 2IAMC 2PDBA 4WJ8A 2X28A 3BSZA 3QH2A 2BVOB 1C3FA 2HTKC 3B43A 1LTXA 3QH3A 4G70B 4WCYH 3L2LA 4NUMA 5HDRA 3CDYA 5AB9A 1RZFL 3C6LC 2ENQA 1TJ0A 4AX6A 4RMUA 4P8WA 4U4IA 1W6WA 3MLUH 2XM2A 4L4VE 5FO7B 2IUZA 3M0ZA 2A3AA 4WSJA 3GDTA 4IS6A 2KZ1B 2WBJC 2D23A 4RNRB 4P46C 3WQGA 9XIAA 5KSAD 4H9UA 1DL7H 3DJ9A 4GPNA 4FADA 4Z78A 3H12A 3F5WB 1I7UA 4DF0A 5DZLA 2FNBA 1BJ1H 4KBXA 3FB7B 1AA1B 3OZKA 5AW9B 2OU4A 1OSYA 1KT2A 1TJIL 1TQWA 2NX5E 4TMPA 4U1LA 3W7WA 2EG8A 3KYKH 4PQXA 5IQ9B 2VENA 1QA9B 4S39A 2OQJB 3FJNA 4MFDA 3G1XA 3GJEB 2V2CA 4CSPA 1V7NL 5F2LA 3MLUL 3W5NA 4C65A 1MJUL 3AGWA 3M1BA 3VD5A 4I90A 3CK0H 4PJIB 4NS0A 5CUSL 1F6KA 4WDWA 1QVOA 2H4EA 3EFDL 3IJSB 2ZWKA 3PWVA 1BZ8A 3MMEA 4NKMB 4TOYL 4Y19D 5DJ6A 3LLDA 2HJFB 1A6TA 1PLAA 3PJXA 4CKVX 1V3KA 2RBLA 3ARDB 2BSBA 3P4NB 5DA0B 3GO2A 2GTWA 1PFOA 2PWDA 2XZ9A 4DGIL 1GJPA 5K9KB 5F70A 1I2NA 3EJSA 4MZRA 1YXCA 1HE7A 4QYAA 4UDUB 1R75A 1E4XH 4Y4HB 2CQTA 5DQ9A 3R8QA 4IPPA 3W7SA 1RSCA 4L3CB 2WZHA 4PJXE 3SBRA 1JCYA 2IV9A 3PY9A 3T1WA 3EWXA 2AEOA 1KCWA 1I2RA 1W2ZA 3G5WA 1JI2A 1XGUA 1IQXA 4OV4A 2XLLA 3UDWA 1WTGT 4L5FL 2DZVA 3BW9B 3K4ZA 2R91A 5T1DL 3O3DB 1AFVH 3TBVB 1JWSA 2NY3B 1UH3A 4YFLI 2DL2A 4S3EA 1X6LA 1BPLB 2ZKWA 3BE1L 2I16A 1VFHA 2H26B 4CW1B 4IG2A 1RK0B 1E4XL 4L80A 3PWJB 4ONHA 3VG9C 3QPXH 3KPMB 4H2CA 2DMHA 4O10A 5E8EA 4C57C 5IBXA 3KRSA 1A5AA 4OD2B 1EP3A 1TMLA 5H8PA 1UJ3C 3EAKA 1QNVA 3K2KA 5BXTA 2APSA 4KQ3L 3HKZA 5JH1A 2EDQA 1GXEA 4M9OA 1IVVA 2FZDA 4CNOA 2ZYSA 5C07A 4TMCA 1PF3A 4Z0BH 2Z4GA 1I8QA 2HXUA 2DD8L 4Z95L 3KW8A 1DQJB 4HV8A 3IKCA 3FKUS 3FTZA 3LZFL 1ALDA 1O1HA 2J27A 1LF1A 3W23A 4OZGF 1NCHA 4PW4A 1OP3K 4RGMB 5L7XH 1X1JA 4MNQD 3S96B 3TIMA 1G0YR 1EEPA 1MH5A 2ZE0A 3JYCA 4PWGA 2AK4B 1DCLA 3STCA 1MDLA 1OTUD 3H1ZA 4NXSA 3T2NL 4EXPX 5J8OA 2CIIB 1THFD 2NV1A 5D5ME 3IIVA 3P84A 1LEGA 2BCKB 4AMKH 4A8LA 5EBLA 1FJ1B 2C7UB 3RIKA 4J39A 4ICXA 4XNQA 3I6LD 3OHXA 3QI9A 5H1WA 3GSXB 3KYNA 2DGAA 3GSWA 2ZYHA 4JK0D 1UWEL 2CCVA 4FOKA 4NGHL 1D6UA 1PG7H 3L3DA 1F2XK 1NMCC 1XX9C 5FHAL 3T2PA 2F7RA 4GYKA 3TF4A 1DDTA 1Y18B 5DURB 2AJ3B 4LGSB 1BWWA 1DE4A 1Z7JA 3ABKB 1D9EA 4L1WA 1NUDA 2HKHL 3BAKA 3EDFA 3AXLB 4RIRB 3DBXA 4HSCX 4GMTL 4Z7OF 2A77H 1ZVNA 1BQCA 4EPEC 1KM1A 3NJLA 3T5WA 4QRSA 3UWEA 3K4WA 4APQB 4N0YL 3E1F1 1HU8A 2R0LL 4XBSA 3UESA 3WQ5A 2QDGA 3SSJA 5BV7C 4C1LA 1GKQA 2CZDA 5F7YC 5EULV 3DCPA 1CDUA 2WZPA 3CFUA 1O7VA 3AW5A 4JY8A 5EIIG 2VX6A 5SWSA 4DELA 5FHBL 4ZFFB 3BGFB 1P0DA 2GTZA 1G1CA 3NAAH 3BXNB 3TLRA 3A3WA 5L4IA 3S83A 1VBJA 2WQAA 4G7SB 4AEFA 2IPKB 5K69A 2X4NA 1T80A 1WFIA 2Z65C 3LN5B 5B22A 2YXOA 1B54A 5D7LE 1RERA 3MRPA 4KTGA 1VRXA 3H42H 1H11A 3CUGA 2NY4C 4HJUA 2EVIA 1HHGB 3EO1A 4AZBA 4HUXA 3QDEA 4JZJC 5FYLD 4HWBL 4WVXA 1YEEH 4OHQA 2A7RA 1Q9KB 3E2HC 4AM0A 1US1A 3SSZA 1CBVH 3QR2A 2W9LA 1T03H 1XL9A 2WVYA 1HWWA 3EOTH 1KEML 2X03A 1ZT1A 1EGZA 1VC4A 3MSRA 4L1XA 1ZCRA 5HHVH 4GW5A 3FFSA 4P7NA 3CWHA 1JPGB 5BMFL 1BLIA 2Z8WC 3H7BA 5MEPA 4KRNA 1QNIA 2NDFA 4DEPC 2GLKA 4M6OL 4FCAA 3WI9A 3FA3A 1OARL 2EDHA 1FWAC 2R94A 4JFUA 2R2CA 2FO4B 4JPVL 5DEFB 1ZLVK 4AEOA 2K8MA 4QDGA 4Y16B 1GEQA 2HISA 3DKJA 5FUCE 2WXPA 2J7EA 3WMBA 2A3BA 2HT2D 1C16A 3EOTL 4U1GB 4FNRA 4I9WE 1GC1H 4JJOA 1E9LA 4JG1L 4NIRA 1HN1A 1A4JA 5B4MC 1WCGA 3IIPA 4LCIL 2K7PA 3QUML 5GZOC 1MFBL 2Q86A 3N11A 3HS0C 4FF7A 4UTLA 3SDOA 5DD5H 3LN3A 3ZTCC 2PDHA 4KESA 2IXUA 3AREA 1KELH 4QXUH 1X8FA 3QNXA 1HXMA 4ZB0A 5IHRA 2BIIA 5JW5A 3BQUD 4QXVA 4MA7H 3B34A 3K6IA 3MLRL 4PTUB 2HWZL 4AY0A 4NWUH 2G3ZA 3FT1A 3FUDA 2VAAB 1IVTA 1PIIA 3C0QA 4KU1A 4G6AD 5L6UA 3B7RL 4X5XB 5E2TH 3UTOA 5EEWA 2VJ0A 4GG8A 3IFPA 3O3AB 4PV8B 1SDDA 3BQUC 3HLAA 4PU2A 4JYDA 3A3YB 3QXDA 4AVKA 4P9HH 2YCKX 3UR7A 1K2DA 4L61A 3LV5A 2YD6A 4QRTB 4UTBL 4Z9KB 3H4GA 2F8OA 4P2OA 5CZ0A 1E1EA 1WS7A 5BZXA 1VBHA 3GIQA 2MWCA 2X0WA 3RY5A 3F00A 4AZCB 2XC8A 3MACL 3KPMA 4P23C 3VCLB 3EOSA 1K5NA 1QOXA 2CITA 3GMNA 4EOWH 2UWEE 5FEZA 3T2OA 2K9UA 1PPIA 3S5LG 4AGQA 1L9WA 3K5XA 1WHPA 4AVJA 5L88L 1PU4A 1JGMA 1KC5H 1XIWA 1QT1A 4GUGA 2G5BB 1TVPA 4HTBA 5CAHA 1YADA 3TBTB 3X11A 4WCJA 4RE4A 4A29A 4HCLA 5FA4A 2ICSA 2H3KA 1MIMH 1Q1PA 2BOLA 3JWOH 5I19H 2VXQA 3QWRD 1E8YA 1M2VA 2XSGA 2PDYA 1UZ6F 3WY2A 5IVNA 4PRBA 1TNNA 3HC3H 2GBUA 4PTTA 4RAHA 4BFKA 4HKXB 2RAMA 4P7LA 1M3JA 4RVBA 2E9LA 1SRDA 2PUQT 1IRAY 2APWA 1S9YB 3V4PB 5HY9A 3WS3A 2X1XR 3CDGA 3L2NA 1AG1O 2I7GA 3PTDA 2EAEA 2GSGA 3I9PA 4E8CA 1CFBA 4RK8A 2DQEL 2DRUA 1TIUA 2A1WH 5IHLB 1HM2A 1QPNA 3U3HA 1T2JA 3VKCA 3IDGA 4S1SL 4XAZA 1FNEB 4C4UA 3BAXA 2RB8A 4B95C 2F58L 1OINA 3UXKA 3NNTA 4PWKA 2VDOH 3BZEA 5CJOL 3B4YA 1UADC 4HJIA 4XSMA 5HGDA 3W0WB 4Z7QB 4X6DB 1TKKA 3S36L 1XIHA 1BMWA 1USZA 4X9SA 4XWGL 1ZU8A 1KNWA 5LNVA 5IT2L 1XFCA 1KB5A 3EHBB 4DP6X 1TO3A 3UGEA 1XWYA 3B3BA 4XTIA 3V75A 2ZX7A 2OSLB 4QE4A 3QE5A 2OMZB 2NW0A 1GOHA 3CMOH 2Z93A 3SD5A 2VDKL 1AQFA 3T4CA 4GXWA 3GKAA 2YCEA 1T4WA 4WW1B 1FWDC 2XFXB 4PIBA 3DEQA 5DZ9A 3FO9B 4C60A 1NSSA 1KCUL 4HCRH 1AKJB 5GJMA 3TMLA 5B7YA 2RHEA 5E5RB 3F12B 2RDTA 1JPST 1B3XA 4MMYB 4PJ9D 1OX5A 2I5QA 2ALAA 4M6VA 1OALA 4JTEA 3XINA 4ES4A 2FSDA 5F44A 3MSPA 2WKGA 4ZUTB 2Q76A 4S0SD 3UXFA 2ISWA 4LKXB 2GTZB 1MJ7L 2EC8A 4IPLA 2B2XH 2HRPL 2NNXA 1DQJA 4HV8B 5JU6A 2IAMB 5G55A 3N17A 1LO2H 2ABAA 1CXHA 4OSUH 3KTCA 3QHZH 4ODVL 4PCFA 3D06A 3MNDA 5G4EA 2XU2A 5BU6A 2C3HA 3QXTA 3GG7A 3B2XA 4L0YA 4LNCA 4PLJD 1EFQA 3QORC 5ISZD 1MQKL 2NXHA 3BYTA 4JY5H 1ZENA 2E6AA 5HATA 2HT3D 4YFLF 1QFWH 4X0NA 4F3HA 1NEZA 4BTWA 1LYXA 2WBJB 4XNBA 3L4UA 3UTQA 1NAKH 2K45A 2LE9A 4XKYB 2D9CA 1EHXA 4Y9FA 1R3IH 1JDEA 3VA8A 1TITA 3MS8A 3ZE1B 1UM5H 3QQXA 4QHKJ 1OCOB 1ADOA 3TA4D 4DB7A 3JYBA 4UTAL 2QLYA 1OAKL 2XPZA 4CD7A 5C0BE 4O4YL 1TZAA 5F6IB 3BFWA 4GW1A 2YAOA 5GZNC 4QX4A 2CWUA 2Y1VA 1TXKA 5EZJB 5IB5A 2ALWA 3BRGC 4MNMA 3WBEA 2OK0L 1U2YA 4JFYA 3UCRA 4XHQA 3DENA 3SYAA 4PBDA 1AR1D 5GRXG 4RGNC 3EFFA 3TBWB 1JDDA 5D32A 4E2DA 2MTAA 1ZLWH 1HCZA 4JKNA 1VZHA 3DFOA 3M43A 2AXFB 4NJAL 3LZOA 4N9BA 4JRXD 4Q8BA 4HXBL 3WLBA 3DURA 5I6KA 1EB3A 1ZL1A 4K8HA 5EWIH 5GS3A 2CLMA 1CXFA 4GW4A 3FSTA 3GH7A 4U3HA 3CV7A 5HK4A 4WJEA 2XKNA 3GS7A 4KVCH 1OG0A 4NFDA 3KM8A 4DTGL 1PY0A 2F54B 3SXXA 1G1YA 1KFJA 2WQUA 2FVLA 1OGPA 2ZCHL 3QUYB 3G1DA 3QLLA 4X80H 3WJMA 3ARRA 3RWJA 3G9AB 3WUEA 2OX5A 1WKDA 1Q2RA 2L0DA 1KGJA 2VWEC 4MQTB 5CJXA 2HVNA 2NXIA 3FSOA 2WSYA 3QMRA 4OUEA 3MJ7B 2WYHA 3MP3A 2IQ0A 4PLKC 1KBGL 1IQYA 2ACSA 5KJRH 3H55A 5IBUB 2PDWA 4U1SB 2D3JA 4IOSD 4DKFL 5EEYA 1VYPX 2B7DT 3EOAA 1GOWA 4Y1TA 5JDSA 4I77H 3WQOA 2OSYA 1SZGA 2D1ZA 4KWWA 1P7KB 5AFDA 3QJFA 4GXVH 4JG5A 3E2HB 3S36X 4KWUA 5HTSA 5HYJB 2DVTA 3UPWA 3DFTA 2H3NA 1XGRA 3CFCL 2NXGA 3PPCA 3FHEA 4X4MA 4GY0A 5JOPD 4G6FD 2NNCA 2IANB 1XG4A 5I3JA 3CTLA 1CDYA 4N2FA 3LHWA 1FVDB 3STLB 4XKMA 1N68A 1SXSA 5DQ9B 1XIEA 5TQ2H 1HDMA 2A9CA 3D85D 3GJFH 3KDNA 3DECA 3LBOA 5FX3A 1BMZA 2B59B 2J73A 4QD2E 2YS4A 4P9MH 7PTDA 1E9OA 1IGYB 1S9YA 2O5ZL 3R1GL 3WS3B 1MMXA 1ZNNA 1QX1A 2ZRXA 5E2JA 4O52A 3N41B 5T1KA 3KYOA 5FYJU 1F4WL 1T99A 2ATMA 3UU0A 2Y72A 1MRCL 2OOVC 1DDHB 2Z64C 1KLYA 3FQRA 3CAFA 5DSCB 4P59L 2AXGA 2JLLA 3DXAD 2O6CA 3KDPB 4H20H 4L8SC 4P46D 2YUZA 1N0LA 4UT6L 5TQ0H 3ZDXB 4ZFOA 1BWMA 1RVKA 1TQVA 2MHAB 3ARWA 4EQ3A 3TDFA 3TOYA 5BO1H 2VDQL 4JTKA 1SHSA 5ANMA 3SO5A 5FAAA 4ZNEE 4BGDA 1Y1UA 3QFJE 3ELAT 4NQCE 4KK9D 4QCIB 3URBA 1KV7A 5HQMA 4XXWA 1X4XA 1FGVH 4LBEA 1F4YH 2DQJL 3RGBA 4G80B 3ZKXB 3EBVA 3HC4H 3B9KD 2VITA 2YD5A 2Y6SD 3FQUA 3NFPB 4K3JL 4Q6KA 3U4EA 3WVFA 4TOQA 2XSKA 4P4KC 3I3EA 2OFQA 3FXYA 4P2OB 4WK2B 4KFOA 1QW9A 2K70A 3DI2B 4HOZA 1FVEA 4L6DA 4P59H 5TNVA 3E6HA 3WGVB 4E3TA 3MCLL 1AXTL 3PGCA 4N9GA 2YBVA 2E1WA 4ADTA 4L8DB 2WO3B 1FNFA 1KM0A 3ETBF 4M7LT 2X38A 1SHMA 4PP1C 5FYKL 2VZ1A 1LLWA 2EKCA 1HGWA 4UU9A 2FJHB 2YK1L 4HFUH 1H15A 4WWKC 3P7YA 2ITDB 3RLSA 5E5LA 1Q9WB 3ECVA 4PJAE 3S5NA 4BQ4A 4F0MA 5FW8A 4Q8QA 4X7DC 2DTSA 3GSXA 3KYNB 4YBQD 4YXKH 2VGGA 4WSHA 4F15B 1Z3GL 3OGOE 2WLIA 5F0LB 5FW7A 1UD5A 4NUJA 1GW1A 3S6CA 3E5PA 1PKYA 2QJDA 4Z1DA 4L3EE 1J8VA 1H5BC 3MB9A 1LDCA 4LMQI 2EP6A 3CN3A 1OKEA 1U3HD 3QEQD 2HKFL 3ECQA 1YEHL 4NKQB 3V5HA 5E6ZA 1YPZE 3SO3C 3VXUB 2VFFA 2O9TA 2Z1XA 3CU2A 2XTKA 1EWDA 1R5IB 2DYSB 1QAKA 2BGSA 4PUMA 5FSDC 4K36A 3GIVA 3L3OA 4IQHA 4GXPA 5M3WA 4GZIA 5DJDB 3BZJA 5I77A 1N64H 2WTRB 2A3HA 4CMMB 4F58H 2GYIA 1LRQA 2NY1D 3GUGA 3SCSA 5K9QG 3B0YA 3BLDA 1BFOB 1XH3A 4C56B 5IHSA 4M81A 4LYKA 3WH7A 1WFUA 1LMIA 1TYRA 3COTA 5EFIB 3VNYA 3HHMA 5DRWB 5BRPA 4XCNB 3WLSA 5IIEA 4MIMA 3LNGA 4EXQA 4US5D 4LNRB 5I5RA 2AJUL 3C6SB 1GW9A 3CXOA 2PO6D 4IU3B 4FALA 3GYRA 2ZZUT 3BSGA 2BC4A 2VERN 3K8LA 3M7WA 3HZYB 4KK8D 2NNAA 1UH2A 4H0IA 1CD9B 4LOVA 1PIGA 3FSWA 3P77B 3EWUA 1JGDB 3LEPA 3HB3C 3S9YA 5F2FA 4B50A 1FZJA 1NFDB 2YD3A 3P11H 1F0LA 5IFJA 1AVKA 3D39D 4D0CB 1DJYA 5C2BL 4G2AA 2PZ0A 1NCNA 2NUTA 3S4TA 4F7CA 4YHPB 1E5BA 3G5YB 3HMXA 1ND0B 4G9DA 4UBDC 4X61A 5F6HJ 3MRGB 5JW4Q 1CU4L 2YXVA 1PG7W 3ATZA 3LSCA 2PN5A 1XB3A 2C8NA 1YG9A 3VXTA 1FWWA 3MLWL 4YHOH 1UTDA 3BQUB 3DTXA 1GYVA 1WWBX 5JW3L 3KOWA 5CC5A 2ZWNA 1G9HA 3FOMA 4JVPA 3ATFA 5F0PB 3E6EA 4IJTA 2ZJSL 5LA1A 2FQDA 2CNYA 4G1EA 4NERA 4AD0A 2ZP0T 5K9XA 3FFCE 2PW1A 4JFFB 1AC6A 3EMQA 1CL7H 2V9QA 2XV6B 5D1QA 5I0XA 1FX6A 4LEQA 4TULL 3LQMA 1J8HD 1H3VA 3IMSA 1MUJA 1XWVA 4QHNA 5REQB 4Z7UA 3M7FB 2G37A 4PLOB 1KM2A 2XBDA 4PH6A 3W22A 1NFKA 3LS5H 1IYXA 1ECEA 2E6YA 3HPFA 1BQKA 3DRTB 2NNFA 2WOFA 5DWPA 1A1OA 4PRTA 1ZGLA 4HVBA 1Q6QA 1T7LA 1DBAH 2BHFA 3DX6B 1YPZA 4OV9A 3VI3B 1TZIA 2R69L 4IGBD 1K1DA 1NFBA 4HK5A 4YHMH 4AL8L 1V6TA 4Z2IA 3GUTB 4MLSA 5C9JA 1FXQA 3ECBB 1WKYA 2B1HL 5KSVB 4W9ZA 4UUIA 5C09B 1FH8A 1R4XA 4M3PA 3HC2A 4YTUA 2JELL 2HT2C 4GWEA 1MELA 1NBZB 1SO5A 5I1DB 3UYIA 1LCOA 4HUXB 4O28A 4O02H 1TQJA 1OSZB 5F3BA 3QSTA 5EC2A 4TR9A 1CI5A 1AZNA 2NY1C 3OR7B 3DMMD 3ZZLA 1FLRH 1JE6A 1U8HA 1ZOXA 1QSVA 5AVWB 1OAUH 1VHNA 1G01A 5CGYC 4MBRA 3GTFA 3U2SA 3DN5A 4Z7VE 2IG2H 1R3LA 3VW3L 1KY7A 3MCKB 4N2DA 2RUSA 4Q4OA 2OQEC 1LDPL 2Y36L 3BHBB 4FNQA 3S4SA 4ECNA 4G9FE 3AC0A 1X1HA 1UI7A 1SW3A 1W8SA 2VOMA 4FE9A 4ZO9A 2JXMA 4CL7A 4PJ5B 1P69B 4OZFH 4NKOA 3ZVHB 4UV7H 2XWEA 3O9WA 3NIFB 4Z95H 2P5WB 4ZMAT 4RDZA 4JR9H 3ML8A 3JWNG 3QTGA 3BD4A 1IKOP 4YXHH 1VD6A 4G1KA 4MQXC 3FQUB 2B20A 3IANA 4X9YA 2WINA 3OHIA 3NACH 1JUEA 2HN7A 1OPGH 4BSWA 3TQVA 1SXBA 4TU1A 3SE4C 3VFUB 1I8IA 1OVZA 3FFCB 1KKOA 1UZ8A 4KPHH 5KVDL 1A4LA 2A3CA 1ES0B 2E09A 2OTPA 4JL1A 1E65A 1NPUA 4O15A 4OJFH 3Q3GA 5E2VH 2LQRA 3K5TA 1T04A 2IPWA 3AMDA 3DUGA 2VDGA 1B0IA 4JDVA 1FORL 2DQIL 4OLEA 3PQYE 3VH8A 3F05A 2OI9C 4PRHE 5C97A 2JEQA 2F8IA 2X7VA 3MVTA 4HAFA 4JRXB 4P2YA 5AZEL 1DCEA 4Y4FA 4WEVX 4QRQB 4WFHE 4ZTEA 1EQCA 4KIRA 4AVOA 5F4WA 2WW0A 1TPFA 3PSWA 2WUCL 1QSFA 1J8HB 4CC4C 3DSNB 4PUNA 3IDJB 1Z48A 1E4LA 4ZPTA 5F3HB 2QR6A 2MCMA 4O11A 1QAFA 2XUCA 1LRNA 3IUHA 4PMUA 2W3ZA 3GRWA 3NSMA 4CQDA 5KSWA 2PCYA 5IP4A 1ZHLB 2JJSA 3NCFB 4N2AA 4M93B 1KB5L 4KH9A 1FG2A 2NX5B 5F1UA 3CVHL 2EH7H 4BF9A 4QXWA 5MEQB 4DIXA 1WIPA 2PWUA 3A4XA 3M4HA 3L95A 1XLMA 3DX4A 5FDYA 4P3CL 2KQMA 2YL9A 4AH7A 3N9KA 5AZEH 3O0RH 3WD1A 2W0QA 3ONBA 4R34A 2KL6A 3D3AA 3IGXA 1H7PA 4PB4A 1JEZA 4NXKA 3RVTD 5E95B 4O12A 4UR7A 1VJZA 1OVDA 4KAQH 1UW9A 1CGSH 4P5KA 2HZGA 2VQUA 1RQ5A 3UXLA 4B2DD 3NFUA 2ITDA 1PY4A 4NCC1 5JIHA 2P28B 5D7IA 1EAPB 5HI4D 3CG8A 4L9ZA 5L8KB 3HAEG 4TVPL 2X1UA 2Z29A 3ZJ7A 1ZHNA 2Q1EA 2WNZA 3ZZQA 3BCDA 2YPLB 2J7BA 2VXUH 3M0LA 2J20A 3FXIC 3CHFA 5FDWB 1O0VA 4X6DA 2Z27A 4MY9A 4LPTA 4HW6A 3E8VA 4TUOB 4WUUD 4TOYH 3FOMB 2NOYA 3ZDYE 5T26A 3LNFA 4GRWE 2E5EA 4AQEA 5DUPH 2DSVA 5CHNA 3NQ6A 1KJ2B 4DEFA 4JMNA 3V4PH 5XIMA 4I0CC 3MRGA 3VNIA 4ZFZB 4KJQC 3WFDH 3SDDB 1H6UA 4UR8A 1GIGH 1NCOA 4W9LC 3FN3A 3BPLC 2QGDA 4CMHB 1ZGLM 3C52A 2E28A 2IQ9H 4KI5F 3ZE2E 3SKJH 4QXTA 5M7QA 1RPXA 35C8L 4I48B 3V0JA 4CU6A 2EC9T 4YEFA 3QQ0A 1K6QH 1TZ8A 1V10A 1XF3A 1A2VA 4UFKA 4XPBL 2QFRA 4PRDA 4PG9A 1NLBL 2JKLA 4P05A 3MLRH 1QR7A 2LW3A 4NWUL 4C58B 3D69B 4HJ0D 4OT1L 3HE6D 2KS0A 1IGFH 1BKHA 4DM1A 1ZA6B 2ED8A 3PWNA 4NM8H 5GRVK 3WO4C 1NCAL 4H19A 3LHAA 1JI1A 3NA4A 3QG0A 4YK4B 2P8CA 1EEYB 2WM0A 3BZ4B 2VB5A 5IBUG 4IKIA 5LGYA 1UR2A 2FIRT 3QUKA 1NEPA 1EXPA 5DR5L 1QALA 3FL7A 1RULH 3HB3D 3QXAB 3V6FB 4X6CB 1UB6B 3MOBL 1C9WA 1KB9J 3CIVA 2FT8A 3HIGA 4XZIA 4PMVA 5H94B 12E8L 4M7KH 3PDOB 2PABA 5EBMA 5AHLA 4WFFD 2WVTA 2ZWSA 2VLKE 5EIQA 2OKOA 2GI7A 1T5WA 4G8EB 4B92A 3SCQA 1MHHB 4KKCC 4LEXH 4IBYA 4G72B 3T6ZA 4JRYA 5SX5H 4HHGA 1JZ5A 1OFQA 1XRTA 2FUTA 2PDXA 2A9NL 1DXEA 2QHAA 2XGBA 4GRWH 3CAWA 4Q9QL 5B8CA 1U8PB 3ZKQD 2AKRA 4R3SA 2I7OA 4Z3TA 1RULL 4J3UA 4AYGA 1J05B 1XH2A 4JFZH 4OFIA 5C6TH 1F07A 1SJDA 1KV8A 1YGAA 3LHVA 4YYCA 4AIXA 4HNVA 3HG1B 2VSDA 4HS6A 4F80A 2AXGB 5MENE 3UWYA 4PB3A 5CJBA 1WZAA 1AGDA 3BAYA 4YSCA 3RZCB 2PP1A 5HQLA 1X5GA 2IFFL 1ZGLP 1VFBB 1XIMA 2W0FA 1JOIA 1OT1A 4HJWA 3ISWA 2LTQC 1QPPA 4WEEA 2NSXA 4Q4RA 5B1KA 1RBAA 5IDZA 4QCIA 2BSTA 3ZO9A 5K9KA 2A74A 4LHUB 5I66B 1AQHA 4K7YA 5XIAA 2OX5B 4XZUB 3RLUA 1DUZB 1DHKA 1R3KB 4KK9C 1N59B 4AZIA 4J4PC 4UB0H 3CM4A 4UFLA 4WI9A 4JM2F 4W9FC 1OQOA 2R0LH 3PN8A 4ZFOL 5IV2A 4WGWB 4P8VA 4D1IA 3QRGL 1L6FA 1EEUA 4JJ5A 5BS0A 3NJGA 3AUWB 3D1MC 1J0HA 2F53D 2UVEA 5F7WC 3WHE0 2EYRA 5MHBA 4WXZA 3QDMB 2QF7A 3F4VA 1RUML 4HWEH 4PMXA 1IMHC 1AJZA 5A69A 1WSST 3ANYA 4YX2H 4H9MA 3G1HA 1XC6A 4LFHG 4QJ4B 5HVWA 1N8WA 2PP3A 2Z25A 3TA3B 2H26A 1MREH 2IANA 1OEPA 1WB0A 2Q71A 5KS9E 5KSUB 4IBVA 3WJYA 4ACZA 2QADC 1Q0XH 4I7VA 1QVOB 5IF0B 3DOSA 3WS6A 3S3BB 3TN4A 4LVBA 4NRSA 1DVXA 1LO2L 1X5MA 4UANA 2SEBB 3VWKC 5LGXA 1GGIL 1ZV5A 5DD6A 4ZAKC 4AL8C 2OW7A 2VZVA 5M2FX 2QQKL 4F9DA 4B5UA 5HI5D 3TL5A 1NIAA 4NQCA 1XGQB 5HVHC 2PO6B 4FZ8L 4KZDH 1BYOA 3HFYA 4RZCB 1JUFA 3Q5TA 3FRPB 1GOMA 5HVFB 4MMYA 2OXNA 5CLWA 2FECL 1M41A 5AKTA 3S8WA 2KH2B 3GMMA 2HLFD 3G1AA 3VM7A 2P5WD 5LZLA 1AIZA 1XGUB 1I2PA 4BQ9A 2VKZG 1NDTA 4KZCA 2QBWA 1JD7A 1VCAA 4MRCA 5AW8B 1PKMA 2DEYX 3GZKA 3MV9A 4RMQA 1CTOA 2OPCA 3GF8A 4CDGC 1IXPA 2VGIA 1VFSA 4U28A 2WQPA 2OZNA 2L7JA 2CLFA 3FTWA 4YWGH 2A6IB 3PPHA 1VADB 4MJIA 2OMVA 2IJ0C 4K5MA 1AW1A 2PGEA 4EN3C 3UVAA 2A5HA 4KY1L 3AMOB 4LVGA 1EHAA 3FCSA 2Z4TA 4JQXC 4MB1A 3X1EA 4YHNB 4U1NA 5CBEA 4PJDF 4C54A 4UMCA 4GIYA 1JBJA 4JHWH 4MAYB 5XINA 1BHGA 3JWDH 4MJHA 3WKPA 3WJLC 5F97E 4G7VH 1TPWA 4ZB5A 5C7VA 4WXYA 1VFAA 2FEEL 4YHPA 3E7JA 1X6UA 3N2JA 3NIDE 5EC1B 4A2SA 1A4BA 3VKBA 1P5UA 3PWPD 4UTBH 5DVLA 1ME8A 1B4LA 3BVXA 5HHQB 3W7GA 1A3ZA 4E8DA 1I6NA 1OAJA 2VCOA 4LU5H 5BXFB 5M94B 4GUQA 2X4NB 3PTMA 4Q4MA 1ZHKA 3M1CA 5CGQA 3SB0A 1S7WB 7PCYA 4FL4C 4X9HA 2IQDA 3KPNB 4CD4A 4I1RA 4YDMA 1TETL 1NJ9B 1ZA6A 2CCLA 5JDJA 2VABB 4DKAA 3CHCA 4Z17A 1OB1B 4JO2H 2ZL8A 2Y2WA 2HA1A 3KRUA 5EU6A 2FEDC 3C61A 2Z28A 3SQBA 4QDMA 1WZ1L 3IBOA 3O4LE 3BKCH 3QUKB 1OGGA 2A0NA 2GZXA 4GRLA 1PCSA 1DQLH 3T8QA 6ENLA 2EPOA 3GHBH 3RWCA 2PDFA 3ZHLA 1AJ7L 1U2HA 2R1WB 2EDOA 5D1ZB 4ELMA 3NRQA 1P5BA 3DO7B 3NTYA<