1NSSA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243a complexed with glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIAHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nssA00
1OJPA 3T0BA 1JYVA 1NS7A 2HTBA 3IAQA 3DYMA 3T08A 3T2QA 3NJXA 3VD7A 3VDCA 1JZ4A 1MMZA 1HM2A 3K25A 2WW1A 3DYOA 1N7RA 3VDAA 1NSZA 1JZ7A 3J7HA 3IAPA 1OJOA 1HMUA 3OBAA 3OB8A 1F4HA 1OJMA 3MV01 1NS4A 1X1HA 3Q1NA 2WW2A 1NSMA 1NS8A 1X1IA 3I3EA 1J0MA 1YGAA 1NKGA 1NSSA 2E24A 1NS0A 2WVXB 4TTGA 1LF9A 3DYPA 1JYXA 3I3BA 2BRWA 4BZHA 3IMHA 2WDAA 1JZ6A 4DUWA 3I3DA 1C82A 1JOVA 2E22A 2Q1FA 1N7OA 1RWHA 1HM3A 2ZQ0A 3MUZ1 5E1QA 1NSRA 2JKPA 1TXKA 2WVXA 3T2OA 2X03A 1MMUA 1MMYA 3WFAA 2WCOA 1RWGA 1PX3A 3SEPA 3VDBA 1K1WA 1I8QA 3MUY1 4BZGA 4DUXA 3VD9A 3NREA 1EGUA 1F9GA 3T0AA 3VD5A 5A1AA 1NS2A 1N7PA 2CISA 1JZ2A 1UG9A 4DUVA 2WZSA 1L7KA 1HN1A 1JYWA 1PX4A 3BGAA 3VD4A 2BRVX 2JKEA 2XSGA 3ECQA 4BZEA 2ZXQA 1N7QA 1JZ3A 1X1JA 2HTAA 3OS7A 1F1SA 1HMWA 1HN0A 1LURA 1LF6A 1LXKA 2D73A 4RNLA 2WW3A 3T09A 1NSXA 1OJNA 3CZJA 1F4AA 3T0DA 3NJVA 3T2PA 2WVYA 1CB8A 1LXMA 2BRPA 1ULVA 2JKAA 3VD3A 2WVZA 1RW9A 1W3YA 1DP0A 3DECA 2CIRA 1MMXA 1JZ5A 2XHNA 1J0NA 2WW0A 3DCDA 1NSUA 1RWFA 3E1F1 1LOHA 1SO0A 4BZFA 1JZ8A 1JYNA 1RWCA 1N7NA 2CIQA 1NSVA 1K1YA 1MN0A 3A24A 1L7JA 1Z45A 4AQ0A 3MWXA 1SNZA 3MV11 1RWAA 1YQ2A 1K1XA
chains in the Genus database with same CATH superfamily
1HWWA 1OJPA 1JYVA 2W0QA 3T08A 3T2QA 1KSIA 1MMZA 2CWTA 1HM2A 3VDAA 1UI8A 2WO0A 1JZ7A 3J7HA 3W7UA 1D6UA 1OJOA 3OB8A 3ACSA 1OJMA 3MV01 3ALAA 1X1HA 3D3IA 2EADA 2F7QA 3D51A 2RDYA 1NS0A 4FNUA 4UFCA 3EJRA 1DYUA 4K3AA 2F7RA 3EJPA 2E2TA 4OK2A 1EKMA 1N7OA 1RWHA 2ZQ0A 1TXKA 3T2OA 1IVVA 2FYVA 2CFGA 1RWGA 2D1WA 1K1WA 1TU5A 1I8QA 4BZGA 4DUXA 3VD9A 1F9GA 2C11A 3D4YA 3VD5A 1WMOA 1NS2A 4NEIA 4KTPA 3HIIA 2XSGA 1TQSA 3S4AA 1W6GA 4RNLA 1LVNA 3NBBA 2ALWA 1NSXA 1OJNA 3CZJA 2OW6A 3NJVA 2OQEA 3WA3A 2CFKA 2CFLA 1CB8A 1LXMA 4FNQA 5CA3A 1IQYA 2CG0A 3DECA 5JMDA 3CZSA 2XHNA 1W2ZA 1D6YA 3EJSA 4BZFA 1LOHA 1TQTA 3DX4A 3A24A 1AVKA 4OJZA 1TQVA 1NS7A 3IAQA 3NJXA 3VD7A 3VDCA 1JZ4A 1UI7A 2WW1A 1N7RA 3AMOB 3W7SA 1F4HA 1NS4A 3Q1NA 2WOHA 3TY1A 1HXKA 1W4NA 3BVUA 1N9EA 1NS8A 2F18A 1X1IA 4KFDA 1NKGA 2E24A 2YFNA 4BTYA 2WVXB 1LF9A 3I3BA 4J5TA 4BZHA 1RKYA 3X42A 1SIIA 3X40A 3I3DA 1JRQA 2E22A 1SPUA 3X3ZA 2CG1A 3BS6A 3MUZ1 1NSRA 2JKPA 4MMIA 4KFFA 1MMYA 3WFAA 1IVXA 1W7CA 2ZL8A 1PX3A 4MMHA 3SXXA 3NREA 3T0AA 5A1AA 2F1AA 2CISA 4DUVA 2WZSA 2E2UA 3T0UA 1JYWA 3VD4A 2JKEA 5JMFA 2ZXQA 3EJTA 3OS7A 3HI7A 2FUQA 1HMWA 1A2VA 2BT3A 2WW3A 3DX1A 2WVYA 2F7OA 3VD3A 3WIRA 3RRSA 1QAFA 3NBJA 2CIRA 1MMXA 2WW0A 1NSUA 1RWFA 1SO0A 2YFOA 3WIQA 3D4ZA 1QAKA 1HTYA 1Z45A 3W7WA 3MWXA 3CV5A 4FNRA 1V7VA 3CZNA 1RWAA 3QFYA 4FNSA 2HTBA 3W7TA 3WA2X 3DYMA 3S4CA 3DX0A 3QFZA 2YX9A 3DX2A 3DYOA 3S4DA 1NSZA 1V7WA 2Y73A 1W5ZA 3IAPA 3OBAA 4BTXA 2CWVA 3KN4A 2WW2A 1PU4A 3EJQA 1J0MA 1YGAA 4TTGA 3DYPA 1JYXA 2WDAA 1JZ6A 3BVVA 3RSYA 4FNVA 1RJOA 1IVUA 4BTWA 1C82A 3D52A 3BUBA 1HM3A 5E1QA 3N9HA 4FNPA 4EV5A 1QALA 1IVWA 3BUIA 2F1BA 3SEPA 3KIIA 3MUY1 1US1A 2WGQA 3AFLA 1N7PA 1H54A 1JZ2A 1TQWA 3BLBA 2XN2A 1L7KA 1PX4A 2BRVX 2CQSA 3BLCA 3X3YA 2PNCA 1N7QA 2OOVA 1F1SA 3QDEA 1HN0A 1LXKA 3VSNA 2OW7A 3DDGA 1F4AA 3T0DA 3LVTA 3T2PA 2CFDA 2BRPA 1ULVA 2CWUA 1W3YA 3W7XA 1JZ5A 1J0NA 3BVTA 3DCDA 1JYNA 1RWCA 2CIQA 3BUPA 1K1YA 1MN0A 4AQ0A 3BVXA 3MV11 1QWUA 1AV4A 3AFJA 3T0BA 2E2VA 4FNTA 3K25A 2XN0A 2WOFA 1HMUA 1AVLA 3A0OA 1NSMA 2FUTA 1QWNA 3I3EA 3PGBA 3D50A 2OQEC 3DX3A 1SIHA 2EABA 1NSSA 2EAEA 4KFEA 3S4BA 3BVWA 1TQUA 1WMNA 2BRWA 3IMHA 3AMOA 4DUWA 3K5TA 4EV2A 1IQXA 3QG0A 1JOVA 2Q1FA 1O7DD 3WVFA 2WYIA 2WVXA 1OACA 2X03A 2F7PA 1MMUA 2C10A 2WCOA 1R33A 3VDBA 3BUDA 4OK4A 1EGUA 2CFWA 3ACTA 1V7XA 1UG9A 3X41A 1HN1A 5KBPA 3BGAA 1QX1A 3LOYA 3ECQA 4BZEA 1JZ3A 1X1JA 2HTAA 3MPHA 4K35A 1LURA 1LF6A 2D73A 1W6CA 3T09A 3E7JA 2Y74A 1PS3A 1WMPA 1D6ZA 2EACA 2JKAA 3VSMA 3MI6A 2WVZA 4KTRA 1R34A 1RW9A 1DP0A 3HIGA 5GW7A 2OOVC 3E1F1 1JZ8A 1N7NA 2CQTA 1NSVA 3E80A 1L7JA 2XN1A 1SNZA 3SX1A 2WYHA 3DDFA 3EJUA 1IU7A 1YQ2A 3X3XA 3BUQA 1K1XA
chains in the Genus database with same CATH topology
1OJPA 3T0BA 1JYVA 1NS7A 2HTBA 3IAQA 3DYMA 3T08A 3T2QA 3NJXA 3VD7A 3VDCA 1JZ4A 1MMZA 1HM2A 3K25A 2WW1A 3DYOA 1N7RA 3VDAA 1NSZA 1JZ7A 3J7HA 3IAPA 1OJOA 1HMUA 3OBAA 3OB8A 1F4HA 1OJMA 3MV01 1NS4A 1X1HA 3A0OA 3Q1NA 2WW2A 1NSMA 2FUTA 3TY1A 1NS8A 1X1IA 3I3EA 1J0MA 1YGAA 1NKGA 1NSSA 2E24A 1NS0A 2WVXB 4TTGA 1LF9A 3DYPA 1JYXA 3I3BA 4J5TA 2BRWA 4BZHA 3IMHA 2WDAA 1JZ6A 4DUWA 4FNVA 3I3DA 4OK2A 1C82A 1JOVA 2E22A 2Q1FA 1N7OA 1RWHA 1HM3A 2ZQ0A 3BS6A 3MUZ1 5E1QA 1NSRA 3WVFA 2JKPA 1TXKA 2WVXA 3T2OA 4MMIA 2X03A 1MMUA 1MMYA 3WFAA 2WCOA 1RWGA 1PX3A 3SEPA 3VDBA 4MMHA 1K1WA 4OK4A 1I8QA 3MUY1 4BZGA 4DUXA 3VD9A 3NREA 1EGUA 1F9GA 3T0AA 3VD5A 5A1AA 3AFLA 1NS2A 1N7PA 2CISA 1JZ2A 1UG9A 4DUVA 4NEIA 2WZSA 1L7KA 1HN1A 1JYWA 1PX4A 3BGAA 3VD4A 2BRVX 2JKEA 2XSGA 3ECQA 3BLCA 4BZEA 5JMFA 2ZXQA 1N7QA 1JZ3A 1X1JA 2HTAA 3OS7A 1F1SA 2FUQA 1HMWA 1HN0A 1LURA 1LF6A 1LXKA 2D73A 4RNLA 2WW3A 3T09A 1NSXA 1OJNA 3E7JA 3VSNA 3CZJA 1F4AA 3T0DA 3NJVA 3T2PA 2WVYA 1CB8A 1LXMA 2BRPA 1ULVA 2JKAA 3VSMA 3VD3A 2WVZA 1RW9A 1W3YA 1DP0A 3DECA 5JMDA 2CIRA 1MMXA 1JZ5A 2XHNA 1J0NA 2WW0A 3DCDA 1NSUA 1RWFA 3E1F1 1LOHA 1SO0A 4BZFA 1JZ8A 1JYNA 1RWCA 1N7NA 2CIQA 1NSVA 1K1YA 1MN0A 3A24A 1L7JA 3E80A 1Z45A 4AQ0A 3MWXA 1SNZA 3MV11 1RWAA 1YQ2A 4OJZA 1K1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJP A;  3T0B A;  1JYV A;  1NS7 A;  2HTB A;  3IAQ A;  3DYM A;  3T08 A;  3T2Q A;  3NJX A;  3VD7 A;  3VDC A;  1JZ4 A;  1MMZ A;  1HM2 A;  3K25 A;  2WW1 A;  3DYO A;  1N7R A;  3VDA A;  1NSZ A;  1JZ7 A;  3J7H A;  3IAP A;  1OJO A;  1HMU A;  3OBA A;  3OB8 A;  1F4H A;  1OJM A;  3MV0 1;  1NS4 A;  1X1H A;  3Q1N A;  2WW2 A;  1NSM A;  1NS8 A;  1X1I A;  3I3E A;  1J0M A;  1YGA A;  1NKG A;  1NSS A;  2E24 A;  1NS0 A;  2WVX B;  4TTG A;  1LF9 A;  3DYP A;  1JYX A;  3I3B A;  2BRW A;  4BZH A;  3IMH A;  2WDA A;  1JZ6 A;  4DUW A;  3I3D A;  1C82 A;  1JOV A;  2E22 A;  2Q1F A;  1N7O A;  1RWH A;  1HM3 A;  2ZQ0 A;  3MUZ 1;  5E1Q A;  1NSR A;  2JKP A;  1TXK A;  2WVX A;  3T2O A;  2X03 A;  1MMU A;  1MMY A;  3WFA A;  2WCO A;  1RWG A;  1PX3 A;  3SEP A;  3VDB A;  1K1W A;  1I8Q A;  3MUY 1;  4BZG A;  4DUX A;  3VD9 A;  3NRE A;  1EGU A;  1F9G A;  3T0A A;  3VD5 A;  5A1A A;  1NS2 A;  1N7P A;  2CIS A;  1JZ2 A;  1UG9 A;  4DUV A;  2WZS A;  1L7K A;  1HN1 A;  1JYW A;  1PX4 A;  3BGA A;  3VD4 A;  2BRV X;  2JKE A;  2XSG A;  3ECQ A;  4BZE A;  2ZXQ A;  1N7Q A;  1JZ3 A;  1X1J A;  2HTA A;  3OS7 A;  1F1S A;  1HMW A;  1HN0 A;  1LUR A;  1LF6 A;  1LXK A;  2D73 A;  4RNL A;  2WW3 A;  3T09 A;  1NSX A;  1OJN A;  3CZJ A;  1F4A A;  3T0D A;  3NJV A;  3T2P A;  2WVY A;  1CB8 A;  1LXM A;  2BRP A;  1ULV A;  2JKA A;  3VD3 A;  2WVZ A;  1RW9 A;  1W3Y A;  1DP0 A;  3DEC A;  2CIR A;  1MMX A;  1JZ5 A;  2XHN A;  1J0N A;  2WW0 A;  3DCD A;  1NSU A;  1RWF A;  3E1F 1;  1LOH A;  1SO0 A;  4BZF A;  1JZ8 A;  1JYN A;  1RWC A;  1N7N A;  2CIQ A;  1NSV A;  1K1Y A;  1MN0 A;  3A24 A;  1L7J A;  1Z45 A;  4AQ0 A;  3MWX A;  1SNZ A;  3MV1 1;  1RWA A;  1YQ2 A;  1K1X A; 
#chains in the Genus database with same CATH topology
 1HWW A;  1OJP A;  1JYV A;  2W0Q A;  3T08 A;  3T2Q A;  1KSI A;  1MMZ A;  2CWT A;  1HM2 A;  3VDA A;  1UI8 A;  2WO0 A;  1JZ7 A;  3J7H A;  3W7U A;  1D6U A;  1OJO A;  3OB8 A;  3ACS A;  1OJM A;  3MV0 1;  3ALA A;  1X1H A;  3D3I A;  2EAD A;  2F7Q A;  3D51 A;  2RDY A;  1NS0 A;  4FNU A;  4UFC A;  3EJR A;  1DYU A;  4K3A A;  2F7R A;  3EJP A;  2E2T A;  4OK2 A;  1EKM A;  1N7O A;  1RWH A;  2ZQ0 A;  1TXK A;  3T2O A;  1IVV A;  2FYV A;  2CFG A;  1RWG A;  2D1W A;  1K1W A;  1TU5 A;  1I8Q A;  4BZG A;  4DUX A;  3VD9 A;  1F9G A;  2C11 A;  3D4Y A;  3VD5 A;  1WMO A;  1NS2 A;  4NEI A;  4KTP A;  3HII A;  2XSG A;  1TQS A;  3S4A A;  1W6G A;  4RNL A;  1LVN A;  3NBB A;  2ALW A;  1NSX A;  1OJN A;  3CZJ A;  2OW6 A;  3NJV A;  2OQE A;  3WA3 A;  2CFK A;  2CFL A;  1CB8 A;  1LXM A;  4FNQ A;  5CA3 A;  1IQY A;  2CG0 A;  3DEC A;  5JMD A;  3CZS A;  2XHN A;  1W2Z A;  1D6Y A;  3EJS A;  4BZF A;  1LOH A;  1TQT A;  3DX4 A;  3A24 A;  1AVK A;  4OJZ A;  1TQV A;  1NS7 A;  3IAQ A;  3NJX A;  3VD7 A;  3VDC A;  1JZ4 A;  1UI7 A;  2WW1 A;  1N7R A;  3AMO B;  3W7S A;  1F4H A;  1NS4 A;  3Q1N A;  2WOH A;  3TY1 A;  1HXK A;  1W4N A;  3BVU A;  1N9E A;  1NS8 A;  2F18 A;  1X1I A;  4KFD A;  1NKG A;  2E24 A;  2YFN A;  4BTY A;  2WVX B;  1LF9 A;  3I3B A;  4J5T A;  4BZH A;  1RKY A;  3X42 A;  1SII A;  3X40 A;  3I3D A;  1JRQ A;  2E22 A;  1SPU A;  3X3Z A;  2CG1 A;  3BS6 A;  3MUZ 1;  1NSR A;  2JKP A;  4MMI A;  4KFF A;  1MMY A;  3WFA A;  1IVX A;  1W7C A;  2ZL8 A;  1PX3 A;  4MMH A;  3SXX A;  3NRE A;  3T0A A;  5A1A A;  2F1A A;  2CIS A;  4DUV A;  2WZS A;  2E2U A;  3T0U A;  1JYW A;  3VD4 A;  2JKE A;  5JMF A;  2ZXQ A;  3EJT A;  3OS7 A;  3HI7 A;  2FUQ A;  1HMW A;  1A2V A;  2BT3 A;  2WW3 A;  3DX1 A;  2WVY A;  2F7O A;  3VD3 A;  3WIR A;  3RRS A;  1QAF A;  3NBJ A;  2CIR A;  1MMX A;  2WW0 A;  1NSU A;  1RWF A;  1SO0 A;  2YFO A;  3WIQ A;  3D4Z A;  1QAK A;  1HTY A;  1Z45 A;  3W7W A;  3MWX A;  3CV5 A;  4FNR A;  1V7V A;  3CZN A;  1RWA A;  3QFY A;  4FNS A;  2HTB A;  3W7T A;  3WA2 X;  3DYM A;  3S4C A;  3DX0 A;  3QFZ A;  2YX9 A;  3DX2 A;  3DYO A;  3S4D A;  1NSZ A;  1V7W A;  2Y73 A;  1W5Z A;  3IAP A;  3OBA A;  4BTX A;  2CWV A;  3KN4 A;  2WW2 A;  1PU4 A;  3EJQ A;  1J0M A;  1YGA A;  4TTG A;  3DYP A;  1JYX A;  2WDA A;  1JZ6 A;  3BVV A;  3RSY A;  4FNV A;  1RJO A;  1IVU A;  4BTW A;  1C82 A;  3D52 A;  3BUB A;  1HM3 A;  5E1Q A;  3N9H A;  4FNP A;  4EV5 A;  1QAL A;  1IVW A;  3BUI A;  2F1B A;  3SEP A;  3KII A;  3MUY 1;  1US1 A;  2WGQ A;  3AFL A;  1N7P A;  1H54 A;  1JZ2 A;  1TQW A;  3BLB A;  2XN2 A;  1L7K A;  1PX4 A;  2BRV X;  2CQS A;  3BLC A;  3X3Y A;  2PNC A;  1N7Q A;  2OOV A;  1F1S A;  3QDE A;  1HN0 A;  1LXK A;  3VSN A;  2OW7 A;  3DDG A;  1F4A A;  3T0D A;  3LVT A;  3T2P A;  2CFD A;  2BRP A;  1ULV A;  2CWU A;  1W3Y A;  3W7X A;  1JZ5 A;  1J0N A;  3BVT A;  3DCD A;  1JYN A;  1RWC A;  2CIQ A;  3BUP A;  1K1Y A;  1MN0 A;  4AQ0 A;  3BVX A;  3MV1 1;  1QWU A;  1AV4 A;  3AFJ A;  3T0B A;  2E2V A;  4FNT A;  3K25 A;  2XN0 A;  2WOF A;  1HMU A;  1AVL A;  3A0O A;  1NSM A;  2FUT A;  1QWN A;  3I3E A;  3PGB A;  3D50 A;  2OQE C;  3DX3 A;  1SIH A;  2EAB A;  1NSS A;  2EAE A;  4KFE A;  3S4B A;  3BVW A;  1TQU A;  1WMN A;  2BRW A;  3IMH A;  3AMO A;  4DUW A;  3K5T A;  4EV2 A;  1IQX A;  3QG0 A;  1JOV A;  2Q1F A;  1O7D D;  3WVF A;  2WYI A;  2WVX A;  1OAC A;  2X03 A;  2F7P A;  1MMU A;  2C10 A;  2WCO A;  1R33 A;  3VDB A;  3BUD A;  4OK4 A;  1EGU A;  2CFW A;  3ACT A;  1V7X A;  1UG9 A;  3X41 A;  1HN1 A;  5KBP A;  3BGA A;  1QX1 A;  3LOY A;  3ECQ A;  4BZE A;  1JZ3 A;  1X1J A;  2HTA A;  3MPH A;  4K35 A;  1LUR A;  1LF6 A;  2D73 A;  1W6C A;  3T09 A;  3E7J A;  2Y74 A;  1PS3 A;  1WMP A;  1D6Z A;  2EAC A;  2JKA A;  3VSM A;  3MI6 A;  2WVZ A;  4KTR A;  1R34 A;  1RW9 A;  1DP0 A;  3HIG A;  5GW7 A;  2OOV C;  3E1F 1;  1JZ8 A;  1N7N A;  2CQT A;  1NSV A;  3E80 A;  1L7J A;  2XN1 A;  1SNZ A;  3SX1 A;  2WYH A;  3DDF A;  3EJU A;  1IU7 A;  1YQ2 A;  3X3X A;  3BUQ A;  1K1X A; 
#chains in the Genus database with same CATH homology
 1OJP A;  3T0B A;  1JYV A;  1NS7 A;  2HTB A;  3IAQ A;  3DYM A;  3T08 A;  3T2Q A;  3NJX A;  3VD7 A;  3VDC A;  1JZ4 A;  1MMZ A;  1HM2 A;  3K25 A;  2WW1 A;  3DYO A;  1N7R A;  3VDA A;  1NSZ A;  1JZ7 A;  3J7H A;  3IAP A;  1OJO A;  1HMU A;  3OBA A;  3OB8 A;  1F4H A;  1OJM A;  3MV0 1;  1NS4 A;  1X1H A;  3A0O A;  3Q1N A;  2WW2 A;  1NSM A;  2FUT A;  3TY1 A;  1NS8 A;  1X1I A;  3I3E A;  1J0M A;  1YGA A;  1NKG A;  1NSS A;  2E24 A;  1NS0 A;  2WVX B;  4TTG A;  1LF9 A;  3DYP A;  1JYX A;  3I3B A;  4J5T A;  2BRW A;  4BZH A;  3IMH A;  2WDA A;  1JZ6 A;  4DUW A;  4FNV A;  3I3D A;  4OK2 A;  1C82 A;  1JOV A;  2E22 A;  2Q1F A;  1N7O A;  1RWH A;  1HM3 A;  2ZQ0 A;  3BS6 A;  3MUZ 1;  5E1Q A;  1NSR A;  3WVF A;  2JKP A;  1TXK A;  2WVX A;  3T2O A;  4MMI A;  2X03 A;  1MMU A;  1MMY A;  3WFA A;  2WCO A;  1RWG A;  1PX3 A;  3SEP A;  3VDB A;  4MMH A;  1K1W A;  4OK4 A;  1I8Q A;  3MUY 1;  4BZG A;  4DUX A;  3VD9 A;  3NRE A;  1EGU A;  1F9G A;  3T0A A;  3VD5 A;  5A1A A;  3AFL A;  1NS2 A;  1N7P A;  2CIS A;  1JZ2 A;  1UG9 A;  4DUV A;  4NEI A;  2WZS A;  1L7K A;  1HN1 A;  1JYW A;  1PX4 A;  3BGA A;  3VD4 A;  2BRV X;  2JKE A;  2XSG A;  3ECQ A;  3BLC A;  4BZE A;  5JMF A;  2ZXQ A;  1N7Q A;  1JZ3 A;  1X1J A;  2HTA A;  3OS7 A;  1F1S A;  2FUQ A;  1HMW A;  1HN0 A;  1LUR A;  1LF6 A;  1LXK A;  2D73 A;  4RNL A;  2WW3 A;  3T09 A;  1NSX A;  1OJN A;  3E7J A;  3VSN A;  3CZJ A;  1F4A A;  3T0D A;  3NJV A;  3T2P A;  2WVY A;  1CB8 A;  1LXM A;  2BRP A;  1ULV A;  2JKA A;  3VSM A;  3VD3 A;  2WVZ A;  1RW9 A;  1W3Y A;  1DP0 A;  3DEC A;  5JMD A;  2CIR A;  1MMX A;  1JZ5 A;  2XHN A;  1J0N A;  2WW0 A;  3DCD A;  1NSU A;  1RWF A;  3E1F 1;  1LOH A;  1SO0 A;  4BZF A;  1JZ8 A;  1JYN A;  1RWC A;  1N7N A;  2CIQ A;  1NSV A;  1K1Y A;  1MN0 A;  3A24 A;  1L7J A;  3E80 A;  1Z45 A;  4AQ0 A;  3MWX A;  1SNZ A;  3MV1 1;  1RWA A;  1YQ2 A;  4OJZ A;  1K1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...