1NSSA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243a complexed with glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIAHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nssA00
1N7NA 2WVZA 3MWXA 2CIQA 2BRPA 3OB8A 3E1F1 2WW0A 1K1YA 3K25A 1OJMA 1NS8A 1X1HA 3I3BA 1N7RA 1LF9A 1NSXA 1F4HA 2Q1FA 1MMUA 1J0NA 3DYMA 4BZEA 1OJNA 1RWAA 3DCDA 3T2QA 2E22A 1HN0A 1JZ6A 1HM2A 1I8QA 2D73A 1HMWA 2WW3A 4TTGA 3VD5A 2ZQ0A 3NREA 1JZ4A 1JOVA 1NS0A 3MV11 3Q1NA 4RNLA 1JYXA 1HM3A 4DUWA 1W3YA 2WZSA 3DYPA 1TXKA 2WVXA 1NS4A 1NSZA 1JZ2A 1MMYA 1NSUA 3WFAA 1N7QA 2JKAA 2WVXB 1C82A 3I3DA 3VD7A 1OJOA 3CZJA 1Z45A 3VD9A 2WVYA 3T2OA 3IAPA 2ZXQA 1JZ3A 2JKEA 3T2PA 1JZ7A 1K1WA 4DUVA 1JZ5A 1ULVA 1MMZA 1K1XA 1LXKA 3MV01 1SNZA 3MUZ1 3OBAA 1X1IA 1YQ2A 1EGUA 1F1SA 3T08A 5A1AA 1F9GA 1PX3A 1X1JA 3MUY1 2BRVX 2HTBA 1L7JA 1RWCA 3T0AA 1RWHA 4BZHA 2X03A 1HMUA 3A24A 1NSRA 3I3EA 3T0BA 3VDAA 1NS7A 1RWGA 2WW1A 3ECQA 1JYWA 2WDAA 3J7HA 1SO0A 2WCOA 1MN0A 1YGAA 3IAQA 3BGAA 1L7KA 4AQ0A 1JYVA 1CB8A 2CIRA 5E1QA 1RW9A 2HTAA 1JZ8A 1HN1A 2WW2A 4BZGA 3VD4A 1NS2A 1RWFA 3VD3A 3VDBA 1NSSA 1LOHA 2E24A 1N7PA 1DP0A 1J0MA 3NJVA 1LXMA 3DYOA 2JKPA 1OJPA 3VDCA 2CISA 3IMHA 1LURA 3OS7A 1JYNA 2XHNA 3T09A 1NKGA 1NSVA 1PX4A 1NSMA 3T0DA 3DECA 3NJXA 4BZFA 2XSGA 1UG9A 1F4AA 1LF6A 1N7OA 3SEPA 1MMXA 4DUXA 2BRWA
chains in the Genus database with same CATH superfamily
1N7NA 2OOVC 2WVZA 5JMFA 4KFDA 3K25A 2Q1FA 2OQEA 2YFOA 1SIIA 1HMWA 4TTGA 3VD5A 1DYUA 3NREA 3HIIA 2F7RA 4FNSA 3VSMA 1R33A 2WO0A 2WYIA 3DYPA 1IQYA 1TXKA 2WVXA 3DX2A 1NS4A 3BVVA 3WFAA 4BTXA 3WIRA 3LVTA 2WOHA 3VD9A 2WOFA 2WVYA 1JZ5A 3W7WA 2EABA 3VSNA 3DDFA 3MV01 1SNZA 1UI7A 3MUZ1 3OBAA 3S4CA 3W7XA 2F1BA 1IU7A 4K3AA 1N9EA 3MUY1 2BRVX 2HTBA 3ACTA 1L7JA 2E2TA 1A2VA 3A24A 3D52A 3HI7A 3W7TA 1V7XA 2WYHA 3X42A 3J7HA 1WMOA 1KSIA 1YGAA 2C10A 4AQ0A 3WIQA 3DX0A 3DX3A 4EV5A 2CWUA 3KN4A 2F7QA 3E80A 1TU5A 3X41A 3VDBA 3EJTA 1J0MA 2EADA 1OJPA 1D6ZA 3BUPA 1QAFA 1PS3A 3X3YA 1QALA 3T09A 1IQXA 3T0DA 1QX1A 1LF6A 2CWTA 3D50A 4DUXA 2BRPA 3OB8A 3E1F1 3WVFA 1OACA 1W5ZA 1K1YA 1UI8A 1OJMA 1NS8A 2CG1A 1HXKA 3SX1A 1NSXA 1F4HA 1QWNA 1OJNA 1RWAA 3DCDA 2E22A 1HN0A 4BTYA 2D73A 3BUIA 4J5TA 2Y74A 1TQSA 1JOVA 3MV11 1JYXA 2CFKA 1H54A 3A0OA 1NSZA 1NSUA 2CQTA 3D3IA 3MPHA 3S4AA 2JKAA 1C82A 2D1WA 1V7WA 2XN1A 1HWWA 2Y73A 3E7JA 3IAPA 3T2PA 1ULVA 1K1XA 2CQSA 2OOVA 1IVVA 4MMHA 1YQ2A 1EGUA 1F1SA 3T08A 3EJSA 3ACSA 1F9GA 2BT3A 3S4BA 3T0AA 3DX1A 3WA3A 2X03A 1HMUA 1W2ZA 1NS7A 1RWGA 3QFYA 2F7PA 3SXXA 3AMOA 3AFLA 1SO0A 2WCOA 3BLCA 4NEIA 3IAQA 3BGAA 1CB8A 2CIRA 2WW2A 4OJZA 1RWFA 3CV5A 3MI6A 2E24A 1DP0A 3NJVA 2CFLA 1QWUA 2OQEC 3BVWA 2CISA 3W7SA 1LURA 2CFDA 4UFCA 4KTPA 1W6GA 2WGQA 1NKGA 1NSVA 3NJXA 3D4ZA 4BZFA 2YX9A 1F4AA 1UG9A 1N7OA 2C11A 2BRWA 1SIHA 2CIQA 1AVLA 4K35A 1X1HA 3I3BA 1LF9A 3AFJA 5CA3A 1AVKA 3EJPA 1MMUA 3BVTA 1J0NA 4BZEA 3EJUA 4FNTA 3T2QA 1JZ6A 4FNPA 1HM2A 2WW3A 2OW7A 2EACA 3X40A 2XN2A 3RRSA 1HTYA 4OK4A 2ZL8A 4DUWA 1W3YA 1JZ2A 3HIGA 3DDGA 3BS6A 1N7QA 3K5TA 3I3DA 3VD7A 4KFFA 2FUTA 1OJOA 3CZJA 1EKMA 2F7OA 1Z45A 4EV2A 1W4NA 1JZ3A 3N9HA 1JZ7A 3BUDA 1TQVA 1LXKA 4KFEA 1W7CA 1LVNA 1TQTA 1X1IA 5A1AA 2CG0A 2CFWA 1PX3A 3AMOB 1X1JA 4KTRA 1RWHA 3I3EA 3T0BA 3VDAA 3D51A 2WDAA 1D6YA 1MN0A 4OK2A 1RW9A 2EAEA 2FYVA 2HTAA 1JZ8A 1HN1A 4BZGA 3VD4A 3NBJA 1NS2A 3VD3A 2CFGA 1AV4A 3BUBA 1IVUA 2CWVA 1LXMA 3VDCA 1US1A 3OS7A 1JYNA 2XHNA 1TQUA 3ALAA 1PX4A 4BTWA 3DECA 4FNRA 1D6UA 1IVWA 3MWXA 3EJRA 2E2UA 1PU4A 2WW0A 2PNCA 3TY1A 1N7RA 1RJOA 2FUQA 1WMNA 3DYMA 1RKYA 2E2VA 1IVXA 1I8QA 2ZQ0A 1JZ4A 1NS0A 1O7DD 3Q1NA 4RNLA 1HM3A 3WA2X 2WZSA 3NBBA 3QG0A 1MMYA 2F1AA 2WVXB 3X3ZA 2YFNA 5GW7A 3BVXA 3T2OA 2ZXQA 3DX4A 3CZSA 3QDEA 2JKEA 1K1WA 4DUVA 2OW6A 1MMZA 3LOYA 3BLBA 1QAKA 1V7VA 4MMIA 1RWCA 1TQWA 3QFZA 4BZHA 3T0UA 4FNQA 1WMPA 1NSRA 4FNUA 2WW1A 2ALWA 1JRQA 2W0QA 5KBPA 3ECQA 3RSYA 1JYWA 1JYVA 1L7KA 3PGBA 3CZNA 5E1QA 3D4YA 3KIIA 1W6CA 1NSSA 1LOHA 1N7PA 3BUQA 3X3XA 3DYOA 5JMDA 2JKPA 1SPUA 2XN0A 2F18A 3IMHA 3EJQA 3S4DA 3BVUA 2RDYA 4FNVA 3W7UA 1NSMA 1R34A 2XSGA 3SEPA 1MMXA
chains in the Genus database with same CATH topology
1N7NA 2WVZA 3MWXA 2CIQA 2BRPA 3OB8A 3E1F1 3WVFA 2WW0A 5JMFA 1K1YA 3K25A 3TY1A 1OJMA 1NS8A 1X1HA 3I3BA 1N7RA 1LF9A 2FUQA 1NSXA 1F4HA 2Q1FA 1MMUA 1J0NA 3DYMA 4BZEA 1OJNA 1RWAA 3DCDA 3T2QA 2E22A 1HN0A 1JZ6A 1HM2A 1I8QA 2D73A 1HMWA 2WW3A 4TTGA 3VD5A 2ZQ0A 3NREA 1JZ4A 4J5TA 1JOVA 1NS0A 3MV11 3Q1NA 4RNLA 4OK4A 1JYXA 3VSMA 1HM3A 4DUWA 1W3YA 2WZSA 3DYPA 3A0OA 1TXKA 2WVXA 1NS4A 1NSZA 1JZ2A 1MMYA 1NSUA 3WFAA 3BS6A 1N7QA 2JKAA 2WVXB 1C82A 3I3DA 3VD7A 2FUTA 1OJOA 3CZJA 1Z45A 3VD9A 2WVYA 3T2OA 3E7JA 3IAPA 2ZXQA 1JZ3A 2JKEA 3T2PA 1JZ7A 1K1WA 4DUVA 1JZ5A 1ULVA 1MMZA 1K1XA 1LXKA 3VSNA 3MV01 1SNZA 4MMHA 3MUZ1 3OBAA 1X1IA 1YQ2A 1EGUA 1F1SA 3T08A 5A1AA 1F9GA 1PX3A 1X1JA 3MUY1 2BRVX 2HTBA 4MMIA 1L7JA 1RWCA 3T0AA 1RWHA 4BZHA 2X03A 1HMUA 3A24A 1NSRA 3I3EA 3T0BA 3VDAA 1NS7A 1RWGA 2WW1A 3ECQA 1JYWA 2WDAA 3J7HA 3AFLA 1SO0A 2WCOA 3BLCA 4NEIA 1MN0A 1YGAA 3IAQA 3BGAA 1L7KA 4AQ0A 1JYVA 4OK2A 1CB8A 2CIRA 5E1QA 1RW9A 2HTAA 1JZ8A 1HN1A 2WW2A 3E80A 4OJZA 4BZGA 3VD4A 1NS2A 1RWFA 3VD3A 3VDBA 1NSSA 1LOHA 2E24A 1N7PA 1DP0A 1J0MA 3NJVA 1LXMA 3DYOA 5JMDA 2JKPA 1OJPA 3VDCA 2CISA 3IMHA 1LURA 3OS7A 1JYNA 2XHNA 4FNVA 3T09A 1NKGA 1NSVA 1PX4A 1NSMA 3T0DA 3DECA 3NJXA 4BZFA 2XSGA 1UG9A 1F4AA 1LF6A 1N7OA 3SEPA 1MMXA 4DUXA 2BRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7N A;  2WVZ A;  3MWX A;  2CIQ A;  2BRP A;  3OB8 A;  3E1F 1;  2WW0 A;  1K1Y A;  3K25 A;  1OJM A;  1NS8 A;  1X1H A;  3I3B A;  1N7R A;  1LF9 A;  1NSX A;  1F4H A;  2Q1F A;  1MMU A;  1J0N A;  3DYM A;  4BZE A;  1OJN A;  1RWA A;  3DCD A;  3T2Q A;  2E22 A;  1HN0 A;  1JZ6 A;  1HM2 A;  1I8Q A;  2D73 A;  1HMW A;  2WW3 A;  4TTG A;  3VD5 A;  2ZQ0 A;  3NRE A;  1JZ4 A;  1JOV A;  1NS0 A;  3MV1 1;  3Q1N A;  4RNL A;  1JYX A;  1HM3 A;  4DUW A;  1W3Y A;  2WZS A;  3DYP A;  1TXK A;  2WVX A;  1NS4 A;  1NSZ A;  1JZ2 A;  1MMY A;  1NSU A;  3WFA A;  1N7Q A;  2JKA A;  2WVX B;  1C82 A;  3I3D A;  3VD7 A;  1OJO A;  3CZJ A;  1Z45 A;  3VD9 A;  2WVY A;  3T2O A;  3IAP A;  2ZXQ A;  1JZ3 A;  2JKE A;  3T2P A;  1JZ7 A;  1K1W A;  4DUV A;  1JZ5 A;  1ULV A;  1MMZ A;  1K1X A;  1LXK A;  3MV0 1;  1SNZ A;  3MUZ 1;  3OBA A;  1X1I A;  1YQ2 A;  1EGU A;  1F1S A;  3T08 A;  5A1A A;  1F9G A;  1PX3 A;  1X1J A;  3MUY 1;  2BRV X;  2HTB A;  1L7J A;  1RWC A;  3T0A A;  1RWH A;  4BZH A;  2X03 A;  1HMU A;  3A24 A;  1NSR A;  3I3E A;  3T0B A;  3VDA A;  1NS7 A;  1RWG A;  2WW1 A;  3ECQ A;  1JYW A;  2WDA A;  3J7H A;  1SO0 A;  2WCO A;  1MN0 A;  1YGA A;  3IAQ A;  3BGA A;  1L7K A;  4AQ0 A;  1JYV A;  1CB8 A;  2CIR A;  5E1Q A;  1RW9 A;  2HTA A;  1JZ8 A;  1HN1 A;  2WW2 A;  4BZG A;  3VD4 A;  1NS2 A;  1RWF A;  3VD3 A;  3VDB A;  1NSS A;  1LOH A;  2E24 A;  1N7P A;  1DP0 A;  1J0M A;  3NJV A;  1LXM A;  3DYO A;  2JKP A;  1OJP A;  3VDC A;  2CIS A;  3IMH A;  1LUR A;  3OS7 A;  1JYN A;  2XHN A;  3T09 A;  1NKG A;  1NSV A;  1PX4 A;  1NSM A;  3T0D A;  3DEC A;  3NJX A;  4BZF A;  2XSG A;  1UG9 A;  1F4A A;  1LF6 A;  1N7O A;  3SEP A;  1MMX A;  4DUX A;  2BRW A; 
#chains in the Genus database with same CATH topology
 1N7N A;  2OOV C;  2WVZ A;  5JMF A;  4KFD A;  3K25 A;  2Q1F A;  2OQE A;  2YFO A;  1SII A;  1HMW A;  4TTG A;  3VD5 A;  1DYU A;  3NRE A;  3HII A;  2F7R A;  4FNS A;  3VSM A;  1R33 A;  2WO0 A;  2WYI A;  3DYP A;  1IQY A;  1TXK A;  2WVX A;  3DX2 A;  1NS4 A;  3BVV A;  3WFA A;  4BTX A;  3WIR A;  3LVT A;  2WOH A;  3VD9 A;  2WOF A;  2WVY A;  1JZ5 A;  3W7W A;  2EAB A;  3VSN A;  3DDF A;  3MV0 1;  1SNZ A;  1UI7 A;  3MUZ 1;  3OBA A;  3S4C A;  3W7X A;  2F1B A;  1IU7 A;  4K3A A;  1N9E A;  3MUY 1;  2BRV X;  2HTB A;  3ACT A;  1L7J A;  2E2T A;  1A2V A;  3A24 A;  3D52 A;  3HI7 A;  3W7T A;  1V7X A;  2WYH A;  3X42 A;  3J7H A;  1WMO A;  1KSI A;  1YGA A;  2C10 A;  4AQ0 A;  3WIQ A;  3DX0 A;  3DX3 A;  4EV5 A;  2CWU A;  3KN4 A;  2F7Q A;  3E80 A;  1TU5 A;  3X41 A;  3VDB A;  3EJT A;  1J0M A;  2EAD A;  1OJP A;  1D6Z A;  3BUP A;  1QAF A;  1PS3 A;  3X3Y A;  1QAL A;  3T09 A;  1IQX A;  3T0D A;  1QX1 A;  1LF6 A;  2CWT A;  3D50 A;  4DUX A;  2BRP A;  3OB8 A;  3E1F 1;  3WVF A;  1OAC A;  1W5Z A;  1K1Y A;  1UI8 A;  1OJM A;  1NS8 A;  2CG1 A;  1HXK A;  3SX1 A;  1NSX A;  1F4H A;  1QWN A;  1OJN A;  1RWA A;  3DCD A;  2E22 A;  1HN0 A;  4BTY A;  2D73 A;  3BUI A;  4J5T A;  2Y74 A;  1TQS A;  1JOV A;  3MV1 1;  1JYX A;  2CFK A;  1H54 A;  3A0O A;  1NSZ A;  1NSU A;  2CQT A;  3D3I A;  3MPH A;  3S4A A;  2JKA A;  1C82 A;  2D1W A;  1V7W A;  2XN1 A;  1HWW A;  2Y73 A;  3E7J A;  3IAP A;  3T2P A;  1ULV A;  1K1X A;  2CQS A;  2OOV A;  1IVV A;  4MMH A;  1YQ2 A;  1EGU A;  1F1S A;  3T08 A;  3EJS A;  3ACS A;  1F9G A;  2BT3 A;  3S4B A;  3T0A A;  3DX1 A;  3WA3 A;  2X03 A;  1HMU A;  1W2Z A;  1NS7 A;  1RWG A;  3QFY A;  2F7P A;  3SXX A;  3AMO A;  3AFL A;  1SO0 A;  2WCO A;  3BLC A;  4NEI A;  3IAQ A;  3BGA A;  1CB8 A;  2CIR A;  2WW2 A;  4OJZ A;  1RWF A;  3CV5 A;  3MI6 A;  2E24 A;  1DP0 A;  3NJV A;  2CFL A;  1QWU A;  2OQE C;  3BVW A;  2CIS A;  3W7S A;  1LUR A;  2CFD A;  4UFC A;  4KTP A;  1W6G A;  2WGQ A;  1NKG A;  1NSV A;  3NJX A;  3D4Z A;  4BZF A;  2YX9 A;  1F4A A;  1UG9 A;  1N7O A;  2C11 A;  2BRW A;  1SIH A;  2CIQ A;  1AVL A;  4K35 A;  1X1H A;  3I3B A;  1LF9 A;  3AFJ A;  5CA3 A;  1AVK A;  3EJP A;  1MMU A;  3BVT A;  1J0N A;  4BZE A;  3EJU A;  4FNT A;  3T2Q A;  1JZ6 A;  4FNP A;  1HM2 A;  2WW3 A;  2OW7 A;  2EAC A;  3X40 A;  2XN2 A;  3RRS A;  1HTY A;  4OK4 A;  2ZL8 A;  4DUW A;  1W3Y A;  1JZ2 A;  3HIG A;  3DDG A;  3BS6 A;  1N7Q A;  3K5T A;  3I3D A;  3VD7 A;  4KFF A;  2FUT A;  1OJO A;  3CZJ A;  1EKM A;  2F7O A;  1Z45 A;  4EV2 A;  1W4N A;  1JZ3 A;  3N9H A;  1JZ7 A;  3BUD A;  1TQV A;  1LXK A;  4KFE A;  1W7C A;  1LVN A;  1TQT A;  1X1I A;  5A1A A;  2CG0 A;  2CFW A;  1PX3 A;  3AMO B;  1X1J A;  4KTR A;  1RWH A;  3I3E A;  3T0B A;  3VDA A;  3D51 A;  2WDA A;  1D6Y A;  1MN0 A;  4OK2 A;  1RW9 A;  2EAE A;  2FYV A;  2HTA A;  1JZ8 A;  1HN1 A;  4BZG A;  3VD4 A;  3NBJ A;  1NS2 A;  3VD3 A;  2CFG A;  1AV4 A;  3BUB A;  1IVU A;  2CWV A;  1LXM A;  3VDC A;  1US1 A;  3OS7 A;  1JYN A;  2XHN A;  1TQU A;  3ALA A;  1PX4 A;  4BTW A;  3DEC A;  4FNR A;  1D6U A;  1IVW A;  3MWX A;  3EJR A;  2E2U A;  1PU4 A;  2WW0 A;  2PNC A;  3TY1 A;  1N7R A;  1RJO A;  2FUQ A;  1WMN A;  3DYM A;  1RKY A;  2E2V A;  1IVX A;  1I8Q A;  2ZQ0 A;  1JZ4 A;  1NS0 A;  1O7D D;  3Q1N A;  4RNL A;  1HM3 A;  3WA2 X;  2WZS A;  3NBB A;  3QG0 A;  1MMY A;  2F1A A;  2WVX B;  3X3Z A;  2YFN A;  5GW7 A;  3BVX A;  3T2O A;  2ZXQ A;  3DX4 A;  3CZS A;  3QDE A;  2JKE A;  1K1W A;  4DUV A;  2OW6 A;  1MMZ A;  3LOY A;  3BLB A;  1QAK A;  1V7V A;  4MMI A;  1RWC A;  1TQW A;  3QFZ A;  4BZH A;  3T0U A;  4FNQ A;  1WMP A;  1NSR A;  4FNU A;  2WW1 A;  2ALW A;  1JRQ A;  2W0Q A;  5KBP A;  3ECQ A;  3RSY A;  1JYW A;  1JYV A;  1L7K A;  3PGB A;  3CZN A;  5E1Q A;  3D4Y A;  3KII A;  1W6C A;  1NSS A;  1LOH A;  1N7P A;  3BUQ A;  3X3X A;  3DYO A;  5JMD A;  2JKP A;  1SPU A;  2XN0 A;  2F18 A;  3IMH A;  3EJQ A;  3S4D A;  3BVU A;  2RDY A;  4FNV A;  3W7U A;  1NSM A;  1R34 A;  2XSG A;  3SEP A;  1MMX A; 
#chains in the Genus database with same CATH homology
 1N7N A;  2WVZ A;  3MWX A;  2CIQ A;  2BRP A;  3OB8 A;  3E1F 1;  3WVF A;  2WW0 A;  5JMF A;  1K1Y A;  3K25 A;  3TY1 A;  1OJM A;  1NS8 A;  1X1H A;  3I3B A;  1N7R A;  1LF9 A;  2FUQ A;  1NSX A;  1F4H A;  2Q1F A;  1MMU A;  1J0N A;  3DYM A;  4BZE A;  1OJN A;  1RWA A;  3DCD A;  3T2Q A;  2E22 A;  1HN0 A;  1JZ6 A;  1HM2 A;  1I8Q A;  2D73 A;  1HMW A;  2WW3 A;  4TTG A;  3VD5 A;  2ZQ0 A;  3NRE A;  1JZ4 A;  4J5T A;  1JOV A;  1NS0 A;  3MV1 1;  3Q1N A;  4RNL A;  4OK4 A;  1JYX A;  3VSM A;  1HM3 A;  4DUW A;  1W3Y A;  2WZS A;  3DYP A;  3A0O A;  1TXK A;  2WVX A;  1NS4 A;  1NSZ A;  1JZ2 A;  1MMY A;  1NSU A;  3WFA A;  3BS6 A;  1N7Q A;  2JKA A;  2WVX B;  1C82 A;  3I3D A;  3VD7 A;  2FUT A;  1OJO A;  3CZJ A;  1Z45 A;  3VD9 A;  2WVY A;  3T2O A;  3E7J A;  3IAP A;  2ZXQ A;  1JZ3 A;  2JKE A;  3T2P A;  1JZ7 A;  1K1W A;  4DUV A;  1JZ5 A;  1ULV A;  1MMZ A;  1K1X A;  1LXK A;  3VSN A;  3MV0 1;  1SNZ A;  4MMH A;  3MUZ 1;  3OBA A;  1X1I A;  1YQ2 A;  1EGU A;  1F1S A;  3T08 A;  5A1A A;  1F9G A;  1PX3 A;  1X1J A;  3MUY 1;  2BRV X;  2HTB A;  4MMI A;  1L7J A;  1RWC A;  3T0A A;  1RWH A;  4BZH A;  2X03 A;  1HMU A;  3A24 A;  1NSR A;  3I3E A;  3T0B A;  3VDA A;  1NS7 A;  1RWG A;  2WW1 A;  3ECQ A;  1JYW A;  2WDA A;  3J7H A;  3AFL A;  1SO0 A;  2WCO A;  3BLC A;  4NEI A;  1MN0 A;  1YGA A;  3IAQ A;  3BGA A;  1L7K A;  4AQ0 A;  1JYV A;  4OK2 A;  1CB8 A;  2CIR A;  5E1Q A;  1RW9 A;  2HTA A;  1JZ8 A;  1HN1 A;  2WW2 A;  3E80 A;  4OJZ A;  4BZG A;  3VD4 A;  1NS2 A;  1RWF A;  3VD3 A;  3VDB A;  1NSS A;  1LOH A;  2E24 A;  1N7P A;  1DP0 A;  1J0M A;  3NJV A;  1LXM A;  3DYO A;  5JMD A;  2JKP A;  1OJP A;  3VDC A;  2CIS A;  3IMH A;  1LUR A;  3OS7 A;  1JYN A;  2XHN A;  4FNV A;  3T09 A;  1NKG A;  1NSV A;  1PX4 A;  1NSM A;  3T0D A;  3DEC A;  3NJX A;  4BZF A;  2XSG A;  1UG9 A;  1F4A A;  1LF6 A;  1N7O A;  3SEP A;  1MMX A;  4DUX A;  2BRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...