1NSSA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243a complexed with glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIAHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nssA00
1F1SA 2D73A 5A1AA 1JZ8A 1LF9A 3DCDA 2JKEA 1SNZA 3IMHA 3MV01 1NSXA 1OJOA 1MMYA 3T09A 3SEPA 2HTBA 2WW0A 3T2QA 1YQ2A 4BZFA 5E1QA 1F4HA 1N7PA 2JKAA 1NS4A 1X1HA 3NREA 3DYOA 3CZJA 3BGAA 3MUZ1 3T08A 1X1IA 4AQ0A 1NSZA 3NJXA 1HMWA 1OJMA 1L7JA 3VDBA 3A24A 3I3DA 2BRVX 2WCOA 3T0AA 2Q1FA 3MUY1 1HN1A 1K1WA 1N7RA 3IAQA 1Z45A 3DECA 1I8QA 1L7KA 4BZGA 4BZHA 4BZEA 3I3EA 1NKGA 1F9GA 1RWAA 2WDAA 1NSVA 1ULVA 1OJPA 2XHNA 3I3BA 1YGAA 1JZ4A 2WZSA 2BRWA 2WW3A 1LURA 1LF6A 1NS8A 1HM2A 1CB8A 1HN0A 2JKPA 3OB8A 1NSMA 4RNLA 3T0DA 1NSUA 1JOVA 1NS0A 3VD5A 1MMXA 1PX3A 1JZ5A 1N7OA 1J0MA 2WVXB 1JYXA 3IAPA 1JYNA 1HMUA 1N7NA 1NSSA 2X03A 1LXKA 1F4AA 1RWGA 1JZ2A 1LOHA 3VD3A 2E22A 1N7QA 3T2PA 3ECQA 2E24A 3E1F1 1W3YA 1PX4A 2WVZA 3K25A 2ZQ0A 3J7HA 2CIQA 2CISA 1K1XA 1C82A 2WW1A 3OS7A 1OJNA 1K1YA 1MMUA 1RW9A 1SO0A 1RWFA 3OBAA 2WVYA 2CIRA 1JZ7A 1UG9A 2WVXA 3MWXA 3VD9A 1JYVA 1RWCA 3NJVA 1J0NA 1JZ6A 1RWHA 3VDCA 2HTAA 3T2OA 1LXMA 4DUWA 1EGUA 2XSGA 1NS7A 2ZXQA 3MV11 4DUXA 3DYMA 1NS2A 2BRPA 4DUVA 1MN0A 3Q1NA 3VD4A 1HM3A 1NSRA 2WW2A 3VDAA 3WFAA 1JYWA 1DP0A 3DYPA 3VD7A 1TXKA 1MMZA 1JZ3A 3T0BA 1X1JA 4TTGA
chains in the Genus database with same CATH superfamily
4KTRA 2JKEA 3MV01 3AMOB 2WYIA 3T09A 3T2QA 3BVVA 1W2ZA 1US1A 3BGAA 4MMHA 1X1IA 3NJXA 3W7UA 3VDBA 3AFLA 2OQEC 1UI8A 2WCOA 3HIIA 3HIGA 1Z45A 3RSYA 1V7XA 2YX9A 1V7VA 1NSVA 3BLCA 1PS3A 2XHNA 3I3BA 2BRWA 2YFOA 2WW3A 1LURA 1TQWA 2CG0A 1HM2A 1HN0A 5JMFA 3DX2A 3DX4A 1MMXA 1N7OA 3IAPA 2OW7A 3WA2X 1JZ2A 3CZNA 3WIQA 1R34A 2XN0A 3EJRA 1TQTA 3BVXA 4BTWA 1W5ZA 2F1BA 3KN4A 2CWTA 5JMDA 3BUPA 1K1YA 3EJTA 1IVUA 4KTPA 1RWFA 1H54A 3OBAA 5KBPA 1UG9A 3MPHA 4J5TA 1RWCA 3NJVA 1D6UA 1RWHA 2HTAA 2EAEA 4DUWA 1EGUA 3DDGA 2ZXQA 1NS2A 2BRPA 2PNCA 4K35A 4FNQA 3X3ZA 1QWUA 3VSNA 2F7OA 2Y74A 3T0BA 1X1JA 4FNUA 1JZ8A 2EADA 1SNZA 3IMHA 2BT3A 3N9HA 3NBJA 2HTBA 2WW0A 1F4HA 2CWUA 1N7PA 2JKAA 1QAKA 3DYOA 3T08A 1HMWA 2XN2A 1L7JA 1TQUA 2CQTA 3S4DA 3RRSA 1K1WA 3BS6A 4MMIA 4BZGA 4BZHA 1L7KA 1IU7A 3I3EA 1NKGA 1TU5A 3DX1A 1ULVA 1JZ4A 4K3AA 2F18A 2WZSA 3DX3A 3E80A 1CB8A 3OB8A 4KFEA 1HXKA 4RNLA 1DYUA 2WYHA 1JZ5A 1RKYA 1HMUA 2CFLA 1LOHA 3EJUA 3T2PA 1AVKA 3KIIA 2WVZA 3E7JA 3BUDA 3WIRA 1OJNA 2C10A 3X3YA 1SPUA 1RW9A 3A0OA 3VD9A 2WVXA 1TQVA 3MWXA 4BTXA 1AVLA 3VDCA 3BVTA 2OOVC 1NS7A 4OJZA 1TQSA 3BUIA 3X40A 1MN0A 3Q1NA 1HM3A 1KSIA 1NSRA 1JYWA 1EKMA 3HI7A 2C11A 1JZ3A 3D3IA 1F1SA 5A1AA 4FNTA 1NSXA 1OJOA 2WO0A 2OW6A 1MMYA 3TY1A 1PU4A 3D50A 3X3XA 1O7DD 1YQ2A 4BZFA 4FNRA 1NS4A 1X1HA 1IVVA 3AMOA 3SX1A 3BUQA 3MUZ1 1NSZA 2ALWA 3SXXA 3ACSA 3S4AA 3T0AA 3D4ZA 3X41A 4NEIA 1N7RA 3IAQA 3DECA 1I8QA 2OQEA 4UFCA 3ALAA 2F7QA 2YFNA 1F9GA 1RWAA 2WDAA 2ZL8A 1OJPA 2RDYA 2WGQA 2EABA 1WMNA 3DX0A 1IVWA 4FNPA 1R33A 2JKPA 3LVTA 3QG0A 4KFDA 1NSUA 1A2VA 1JOVA 1NS0A 3VD5A 3T0UA 1J0MA 3X42A 2WVXB 3QFZA 2XN1A 3NBBA 3EJPA 2EACA 1WMOA 1NSSA 2WOFA 1LXKA 2F1AA 3LOYA 2FYVA 2E22A 1N7QA 1W4NA 1D6YA 1RJOA 1AV4A 2W0QA 1LVNA 1IQYA 3W7WA 2ZQ0A 3J7HA 2CIQA 2CISA 1K1XA 1C82A 4KFFA 4OK4A 3D52A 3VSMA 2E2VA 2F7RA 2WVYA 2CIRA 1HWWA 2CFWA 1LXMA 4EV2A 2CFDA 1V7WA 3DYMA 1QX1A 4DUVA 1SIIA 4FNSA 3VD4A 2WW2A 3VDAA 3WFAA 3MI6A 3DYPA 5GW7A 3VD7A 1TXKA 2FUTA 4TTGA 3BVUA 2D73A 1LF9A 3DCDA 3SEPA 5E1QA 1IQXA 3S4BA 3W7XA 3NREA 3CV5A 3QFYA 3CZJA 2D1WA 4AQ0A 1OJMA 3DDFA 3A24A 3I3DA 2BRVX 2Q1FA 1W6GA 3MUY1 1HN1A 1WMPA 3D51A 2WOHA 3WVFA 5CA3A 3S4CA 1JRQA 4BZEA 1YGAA 3WA3A 1LF6A 1NS8A 1HTYA 1NSMA 3CZSA 3BLBA 3T0DA 4OK2A 2CG1A 1PX3A 3BUBA 1JYXA 1JYNA 1D6ZA 1QAFA 1W7CA 3PGBA 3QDEA 3W7SA 1QALA 2F7PA 1N7NA 2X03A 1F4AA 1UI7A 1RWGA 1SIHA 3VD3A 2E2UA 2CFKA 3ECQA 2E24A 3E1F1 1W3YA 2CFGA 1PX4A 2CWVA 3K25A 1N9EA 1W6CA 4EV5A 3K5TA 2Y73A 2E2TA 2WW1A 3OS7A 1MMUA 3D4YA 4BTYA 1SO0A 3W7TA 3EJQA 1JZ7A 3AFJA 4FNVA 1JYVA 1J0NA 1JZ6A 3T2OA 2XSGA 1IVXA 3MV11 4DUXA 1OACA 3ACTA 2OOVA 2CQSA 3EJSA 1DP0A 1MMZA 1QWNA 3BVWA 2FUQA
chains in the Genus database with same CATH topology
1F1SA 2D73A 5A1AA 1JZ8A 1LF9A 3DCDA 2JKEA 1SNZA 3IMHA 3MV01 1NSXA 1OJOA 1MMYA 3T09A 3TY1A 3SEPA 2HTBA 2WW0A 3T2QA 1YQ2A 4BZFA 5E1QA 1F4HA 1N7PA 2JKAA 1NS4A 1X1HA 3NREA 3DYOA 3CZJA 3BGAA 4MMHA 3MUZ1 3T08A 1X1IA 4AQ0A 1NSZA 3NJXA 1HMWA 1OJMA 1L7JA 3VDBA 3A24A 3I3DA 3AFLA 2BRVX 2WCOA 3T0AA 2Q1FA 3MUY1 1HN1A 1K1WA 3BS6A 4NEIA 1N7RA 3IAQA 1Z45A 4MMIA 3DECA 1I8QA 1L7KA 3WVFA 4BZGA 4BZHA 4BZEA 3I3EA 1NKGA 1F9GA 1RWAA 2WDAA 1NSVA 3BLCA 1ULVA 1OJPA 2XHNA 3I3BA 1YGAA 1JZ4A 2WZSA 2BRWA 2WW3A 1LURA 1LF6A 1NS8A 3E80A 1HM2A 1CB8A 1HN0A 2JKPA 3OB8A 1NSMA 5JMFA 4RNLA 3T0DA 1NSUA 4OK2A 1JOVA 1NS0A 3VD5A 1MMXA 1PX3A 1JZ5A 1N7OA 1J0MA 2WVXB 1JYXA 3IAPA 1JYNA 1HMUA 1N7NA 1NSSA 2X03A 1LXKA 1F4AA 1RWGA 1JZ2A 1LOHA 3VD3A 2E22A 1N7QA 3T2PA 3ECQA 2E24A 3E1F1 1W3YA 1PX4A 2WVZA 3K25A 3E7JA 2ZQ0A 3J7HA 2CIQA 5JMDA 2CISA 1K1XA 1C82A 2WW1A 3OS7A 1OJNA 1K1YA 4OK4A 1MMUA 1RW9A 3VSMA 3A0OA 1SO0A 1RWFA 3OBAA 2WVYA 2CIRA 1JZ7A 1UG9A 2WVXA 3MWXA 4FNVA 4J5TA 3VD9A 1JYVA 1RWCA 3NJVA 1J0NA 1JZ6A 1RWHA 3VDCA 2HTAA 3T2OA 1LXMA 4DUWA 1EGUA 2XSGA 1NS7A 4OJZA 2ZXQA 3MV11 4DUXA 3DYMA 1NS2A 2BRPA 4DUVA 1MN0A 3Q1NA 3VD4A 1HM3A 1NSRA 2WW2A 3VDAA 3WFAA 1JYWA 1DP0A 3VSNA 3DYPA 3VD7A 1TXKA 1MMZA 1JZ3A 2FUTA 3T0BA 1X1JA 4TTGA 2FUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1S A;  2D73 A;  5A1A A;  1JZ8 A;  1LF9 A;  3DCD A;  2JKE A;  1SNZ A;  3IMH A;  3MV0 1;  1NSX A;  1OJO A;  1MMY A;  3T09 A;  3SEP A;  2HTB A;  2WW0 A;  3T2Q A;  1YQ2 A;  4BZF A;  5E1Q A;  1F4H A;  1N7P A;  2JKA A;  1NS4 A;  1X1H A;  3NRE A;  3DYO A;  3CZJ A;  3BGA A;  3MUZ 1;  3T08 A;  1X1I A;  4AQ0 A;  1NSZ A;  3NJX A;  1HMW A;  1OJM A;  1L7J A;  3VDB A;  3A24 A;  3I3D A;  2BRV X;  2WCO A;  3T0A A;  2Q1F A;  3MUY 1;  1HN1 A;  1K1W A;  1N7R A;  3IAQ A;  1Z45 A;  3DEC A;  1I8Q A;  1L7K A;  4BZG A;  4BZH A;  4BZE A;  3I3E A;  1NKG A;  1F9G A;  1RWA A;  2WDA A;  1NSV A;  1ULV A;  1OJP A;  2XHN A;  3I3B A;  1YGA A;  1JZ4 A;  2WZS A;  2BRW A;  2WW3 A;  1LUR A;  1LF6 A;  1NS8 A;  1HM2 A;  1CB8 A;  1HN0 A;  2JKP A;  3OB8 A;  1NSM A;  4RNL A;  3T0D A;  1NSU A;  1JOV A;  1NS0 A;  3VD5 A;  1MMX A;  1PX3 A;  1JZ5 A;  1N7O A;  1J0M A;  2WVX B;  1JYX A;  3IAP A;  1JYN A;  1HMU A;  1N7N A;  1NSS A;  2X03 A;  1LXK A;  1F4A A;  1RWG A;  1JZ2 A;  1LOH A;  3VD3 A;  2E22 A;  1N7Q A;  3T2P A;  3ECQ A;  2E24 A;  3E1F 1;  1W3Y A;  1PX4 A;  2WVZ A;  3K25 A;  2ZQ0 A;  3J7H A;  2CIQ A;  2CIS A;  1K1X A;  1C82 A;  2WW1 A;  3OS7 A;  1OJN A;  1K1Y A;  1MMU A;  1RW9 A;  1SO0 A;  1RWF A;  3OBA A;  2WVY A;  2CIR A;  1JZ7 A;  1UG9 A;  2WVX A;  3MWX A;  3VD9 A;  1JYV A;  1RWC A;  3NJV A;  1J0N A;  1JZ6 A;  1RWH A;  3VDC A;  2HTA A;  3T2O A;  1LXM A;  4DUW A;  1EGU A;  2XSG A;  1NS7 A;  2ZXQ A;  3MV1 1;  4DUX A;  3DYM A;  1NS2 A;  2BRP A;  4DUV A;  1MN0 A;  3Q1N A;  3VD4 A;  1HM3 A;  1NSR A;  2WW2 A;  3VDA A;  3WFA A;  1JYW A;  1DP0 A;  3DYP A;  3VD7 A;  1TXK A;  1MMZ A;  1JZ3 A;  3T0B A;  1X1J A;  4TTG A; 
#chains in the Genus database with same CATH topology
 4KTR A;  2JKE A;  3MV0 1;  3AMO B;  2WYI A;  3T09 A;  3T2Q A;  3BVV A;  1W2Z A;  1US1 A;  3BGA A;  4MMH A;  1X1I A;  3NJX A;  3W7U A;  3VDB A;  3AFL A;  2OQE C;  1UI8 A;  2WCO A;  3HII A;  3HIG A;  1Z45 A;  3RSY A;  1V7X A;  2YX9 A;  1V7V A;  1NSV A;  3BLC A;  1PS3 A;  2XHN A;  3I3B A;  2BRW A;  2YFO A;  2WW3 A;  1LUR A;  1TQW A;  2CG0 A;  1HM2 A;  1HN0 A;  5JMF A;  3DX2 A;  3DX4 A;  1MMX A;  1N7O A;  3IAP A;  2OW7 A;  3WA2 X;  1JZ2 A;  3CZN A;  3WIQ A;  1R34 A;  2XN0 A;  3EJR A;  1TQT A;  3BVX A;  4BTW A;  1W5Z A;  2F1B A;  3KN4 A;  2CWT A;  5JMD A;  3BUP A;  1K1Y A;  3EJT A;  1IVU A;  4KTP A;  1RWF A;  1H54 A;  3OBA A;  5KBP A;  1UG9 A;  3MPH A;  4J5T A;  1RWC A;  3NJV A;  1D6U A;  1RWH A;  2HTA A;  2EAE A;  4DUW A;  1EGU A;  3DDG A;  2ZXQ A;  1NS2 A;  2BRP A;  2PNC A;  4K35 A;  4FNQ A;  3X3Z A;  1QWU A;  3VSN A;  2F7O A;  2Y74 A;  3T0B A;  1X1J A;  4FNU A;  1JZ8 A;  2EAD A;  1SNZ A;  3IMH A;  2BT3 A;  3N9H A;  3NBJ A;  2HTB A;  2WW0 A;  1F4H A;  2CWU A;  1N7P A;  2JKA A;  1QAK A;  3DYO A;  3T08 A;  1HMW A;  2XN2 A;  1L7J A;  1TQU A;  2CQT A;  3S4D A;  3RRS A;  1K1W A;  3BS6 A;  4MMI A;  4BZG A;  4BZH A;  1L7K A;  1IU7 A;  3I3E A;  1NKG A;  1TU5 A;  3DX1 A;  1ULV A;  1JZ4 A;  4K3A A;  2F18 A;  2WZS A;  3DX3 A;  3E80 A;  1CB8 A;  3OB8 A;  4KFE A;  1HXK A;  4RNL A;  1DYU A;  2WYH A;  1JZ5 A;  1RKY A;  1HMU A;  2CFL A;  1LOH A;  3EJU A;  3T2P A;  1AVK A;  3KII A;  2WVZ A;  3E7J A;  3BUD A;  3WIR A;  1OJN A;  2C10 A;  3X3Y A;  1SPU A;  1RW9 A;  3A0O A;  3VD9 A;  2WVX A;  1TQV A;  3MWX A;  4BTX A;  1AVL A;  3VDC A;  3BVT A;  2OOV C;  1NS7 A;  4OJZ A;  1TQS A;  3BUI A;  3X40 A;  1MN0 A;  3Q1N A;  1HM3 A;  1KSI A;  1NSR A;  1JYW A;  1EKM A;  3HI7 A;  2C11 A;  1JZ3 A;  3D3I A;  1F1S A;  5A1A A;  4FNT A;  1NSX A;  1OJO A;  2WO0 A;  2OW6 A;  1MMY A;  3TY1 A;  1PU4 A;  3D50 A;  3X3X A;  1O7D D;  1YQ2 A;  4BZF A;  4FNR A;  1NS4 A;  1X1H A;  1IVV A;  3AMO A;  3SX1 A;  3BUQ A;  3MUZ 1;  1NSZ A;  2ALW A;  3SXX A;  3ACS A;  3S4A A;  3T0A A;  3D4Z A;  3X41 A;  4NEI A;  1N7R A;  3IAQ A;  3DEC A;  1I8Q A;  2OQE A;  4UFC A;  3ALA A;  2F7Q A;  2YFN A;  1F9G A;  1RWA A;  2WDA A;  2ZL8 A;  1OJP A;  2RDY A;  2WGQ A;  2EAB A;  1WMN A;  3DX0 A;  1IVW A;  4FNP A;  1R33 A;  2JKP A;  3LVT A;  3QG0 A;  4KFD A;  1NSU A;  1A2V A;  1JOV A;  1NS0 A;  3VD5 A;  3T0U A;  1J0M A;  3X42 A;  2WVX B;  3QFZ A;  2XN1 A;  3NBB A;  3EJP A;  2EAC A;  1WMO A;  1NSS A;  2WOF A;  1LXK A;  2F1A A;  3LOY A;  2FYV A;  2E22 A;  1N7Q A;  1W4N A;  1D6Y A;  1RJO A;  1AV4 A;  2W0Q A;  1LVN A;  1IQY A;  3W7W A;  2ZQ0 A;  3J7H A;  2CIQ A;  2CIS A;  1K1X A;  1C82 A;  4KFF A;  4OK4 A;  3D52 A;  3VSM A;  2E2V A;  2F7R A;  2WVY A;  2CIR A;  1HWW A;  2CFW A;  1LXM A;  4EV2 A;  2CFD A;  1V7W A;  3DYM A;  1QX1 A;  4DUV A;  1SII A;  4FNS A;  3VD4 A;  2WW2 A;  3VDA A;  3WFA A;  3MI6 A;  3DYP A;  5GW7 A;  3VD7 A;  1TXK A;  2FUT A;  4TTG A;  3BVU A;  2D73 A;  1LF9 A;  3DCD A;  3SEP A;  5E1Q A;  1IQX A;  3S4B A;  3W7X A;  3NRE A;  3CV5 A;  3QFY A;  3CZJ A;  2D1W A;  4AQ0 A;  1OJM A;  3DDF A;  3A24 A;  3I3D A;  2BRV X;  2Q1F A;  1W6G A;  3MUY 1;  1HN1 A;  1WMP A;  3D51 A;  2WOH A;  3WVF A;  5CA3 A;  3S4C A;  1JRQ A;  4BZE A;  1YGA A;  3WA3 A;  1LF6 A;  1NS8 A;  1HTY A;  1NSM A;  3CZS A;  3BLB A;  3T0D A;  4OK2 A;  2CG1 A;  1PX3 A;  3BUB A;  1JYX A;  1JYN A;  1D6Z A;  1QAF A;  1W7C A;  3PGB A;  3QDE A;  3W7S A;  1QAL A;  2F7P A;  1N7N A;  2X03 A;  1F4A A;  1UI7 A;  1RWG A;  1SIH A;  3VD3 A;  2E2U A;  2CFK A;  3ECQ A;  2E24 A;  3E1F 1;  1W3Y A;  2CFG A;  1PX4 A;  2CWV A;  3K25 A;  1N9E A;  1W6C A;  4EV5 A;  3K5T A;  2Y73 A;  2E2T A;  2WW1 A;  3OS7 A;  1MMU A;  3D4Y A;  4BTY A;  1SO0 A;  3W7T A;  3EJQ A;  1JZ7 A;  3AFJ A;  4FNV A;  1JYV A;  1J0N A;  1JZ6 A;  3T2O A;  2XSG A;  1IVX A;  3MV1 1;  4DUX A;  1OAC A;  3ACT A;  2OOV A;  2CQS A;  3EJS A;  1DP0 A;  1MMZ A;  1QWN A;  3BVW A;  2FUQ A; 
#chains in the Genus database with same CATH homology
 1F1S A;  2D73 A;  5A1A A;  1JZ8 A;  1LF9 A;  3DCD A;  2JKE A;  1SNZ A;  3IMH A;  3MV0 1;  1NSX A;  1OJO A;  1MMY A;  3T09 A;  3TY1 A;  3SEP A;  2HTB A;  2WW0 A;  3T2Q A;  1YQ2 A;  4BZF A;  5E1Q A;  1F4H A;  1N7P A;  2JKA A;  1NS4 A;  1X1H A;  3NRE A;  3DYO A;  3CZJ A;  3BGA A;  4MMH A;  3MUZ 1;  3T08 A;  1X1I A;  4AQ0 A;  1NSZ A;  3NJX A;  1HMW A;  1OJM A;  1L7J A;  3VDB A;  3A24 A;  3I3D A;  3AFL A;  2BRV X;  2WCO A;  3T0A A;  2Q1F A;  3MUY 1;  1HN1 A;  1K1W A;  3BS6 A;  4NEI A;  1N7R A;  3IAQ A;  1Z45 A;  4MMI A;  3DEC A;  1I8Q A;  1L7K A;  3WVF A;  4BZG A;  4BZH A;  4BZE A;  3I3E A;  1NKG A;  1F9G A;  1RWA A;  2WDA A;  1NSV A;  3BLC A;  1ULV A;  1OJP A;  2XHN A;  3I3B A;  1YGA A;  1JZ4 A;  2WZS A;  2BRW A;  2WW3 A;  1LUR A;  1LF6 A;  1NS8 A;  3E80 A;  1HM2 A;  1CB8 A;  1HN0 A;  2JKP A;  3OB8 A;  1NSM A;  5JMF A;  4RNL A;  3T0D A;  1NSU A;  4OK2 A;  1JOV A;  1NS0 A;  3VD5 A;  1MMX A;  1PX3 A;  1JZ5 A;  1N7O A;  1J0M A;  2WVX B;  1JYX A;  3IAP A;  1JYN A;  1HMU A;  1N7N A;  1NSS A;  2X03 A;  1LXK A;  1F4A A;  1RWG A;  1JZ2 A;  1LOH A;  3VD3 A;  2E22 A;  1N7Q A;  3T2P A;  3ECQ A;  2E24 A;  3E1F 1;  1W3Y A;  1PX4 A;  2WVZ A;  3K25 A;  3E7J A;  2ZQ0 A;  3J7H A;  2CIQ A;  5JMD A;  2CIS A;  1K1X A;  1C82 A;  2WW1 A;  3OS7 A;  1OJN A;  1K1Y A;  4OK4 A;  1MMU A;  1RW9 A;  3VSM A;  3A0O A;  1SO0 A;  1RWF A;  3OBA A;  2WVY A;  2CIR A;  1JZ7 A;  1UG9 A;  2WVX A;  3MWX A;  4FNV A;  4J5T A;  3VD9 A;  1JYV A;  1RWC A;  3NJV A;  1J0N A;  1JZ6 A;  1RWH A;  3VDC A;  2HTA A;  3T2O A;  1LXM A;  4DUW A;  1EGU A;  2XSG A;  1NS7 A;  4OJZ A;  2ZXQ A;  3MV1 1;  4DUX A;  3DYM A;  1NS2 A;  2BRP A;  4DUV A;  1MN0 A;  3Q1N A;  3VD4 A;  1HM3 A;  1NSR A;  2WW2 A;  3VDA A;  3WFA A;  1JYW A;  1DP0 A;  3VSN A;  3DYP A;  3VD7 A;  1TXK A;  1MMZ A;  1JZ3 A;  2FUT A;  3T0B A;  1X1J A;  4TTG A;  2FUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...