1NSSA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243a complexed with glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIAHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nssA00
1RWHA 1NS4A 1J0NA 1RWFA 2X03A 1JYXA 4RNLA 3VD7A 3IMHA 1NKGA 1JYWA 2E22A 3E1F1 3VD5A 2HTBA 2ZXQA 1OJPA 2ZQ0A 1LURA 1N7QA 1F4AA 3OBAA 1N7NA 1EGUA 3VDBA 1OJOA 1MMXA 1LF9A 1RWCA 2WVYA 3J7HA 2WZSA 1HN0A 1NS7A 3T2OA 1F9GA 1NSVA 1F4HA 3IAPA 4BZHA 1NSUA 4BZFA 1UG9A 1F1SA 1PX4A 1HM2A 2XSGA 1L7JA 1X1HA 1YGAA 3BGAA 3MV01 1JZ6A 1JYNA 1MMUA 1JZ2A 3NJXA 2WW3A 3SEPA 1HMUA 1MMZA 1N7PA 1TXKA 2CIQA 2WCOA 1OJNA 4BZGA 1SO0A 2Q1FA 3VD4A 1W3YA 1JOVA 2WDAA 3DYPA 1LXMA 3VD9A 1ULVA 1J0MA 3WFAA 2JKPA 2JKEA 1NSMA 2CISA 3IAQA 1Z45A 1SNZA 3T0AA 1PX3A 3A24A 3MWXA 2WW0A 3K25A 2WW1A 2HTAA 1CB8A 3NREA 4AQ0A 3I3EA 2XHNA 1HN1A 3T08A 3ECQA 1NS0A 4DUWA 1I8QA 3T0BA 1X1IA 3MV11 1JZ5A 1LF6A 1NSSA 1LXKA 1NSXA 3OS7A 1LOHA 2WW2A 3DECA 1JZ8A 1OJMA 2WVXA 3T09A 2BRWA 3T2QA 1HM3A 5A1AA 3MUZ1 1C82A 2BRVX 1JZ4A 1L7KA 1K1WA 5E1QA 1NS8A 1RWAA 1DP0A 3T0DA 2D73A 2CIRA 3DCDA 3MUY1 1HMWA 3I3DA 3VD3A 4DUXA 3CZJA 1X1JA 3VDCA 3Q1NA 1NS2A 1N7OA 4TTGA 1NSZA 3I3BA 2WVZA 1MMYA 1MN0A 1N7RA 1RW9A 3T2PA 3DYOA 4BZEA 2BRPA 1JZ3A 2E24A 1JYVA 1RWGA 3OB8A 1YQ2A 4DUVA 1K1YA 1K1XA 3DYMA 3VDAA 2WVXB 3NJVA 1JZ7A 1NSRA 2JKAA
chains in the Genus database with same CATH superfamily
3RSYA 2C11A 1NS4A 2EABA 1J0NA 3WA2X 3WIRA 2CQTA 2FUQA 3K5TA 3BVWA 1IU7A 3VD5A 1W2ZA 3A0OA 1N7QA 1F4AA 1OACA 3EJTA 3X3XA 1QALA 1LF9A 4OK4A 1NS7A 3DDGA 3S4AA 3IAPA 1SPUA 1PX4A 1IVUA 1HM2A 2XSGA 1O7DD 2WYIA 1JZ2A 1HTYA 1WMOA 1IVVA 3X42A 2CIQA 2WCOA 3VD4A 1JOVA 2BT3A 2WOFA 1LXMA 3IAQA 3D4YA 1SNZA 4FNVA 2WGQA 4BTXA 3N9HA 2HTAA 3X3YA 3NREA 1AVLA 2E2VA 3W7WA 3I3EA 2XHNA 3BLCA 4FNPA 1H54A 4DUWA 3QFYA 3W7XA 3DX3A 3BVUA 1V7VA 1LXKA 1LVNA 1NSXA 4K35A 4KFEA 3WA3A 1LOHA 3DECA 1WMNA 3QFZA 3MUZ1 3S4CA 2F1AA 4FNTA 1V7XA 2BRVX 1K1WA 1RWAA 3D51A 2PNCA 2E2TA 2CIRA 1WMPA 3DCDA 1HMWA 3HIGA 4DUXA 4MMIA 1QAKA 4TTGA 3I3BA 3SXXA 3T2PA 2OQEC 1HWWA 1JZ3A 1TQUA 1RWGA 3OB8A 1K1YA 3VDAA 2WVXB 4OJZA 1RWHA 4FNSA 3EJRA 1IVWA 1RKYA 3DX2A 2X03A 5JMDA 3RRSA 4RNLA 2OQEA 2E22A 2HTBA 2ZXQA 3VSMA 2ZQ0A 3OBAA 1N7NA 1EGUA 2F7PA 3VDBA 2WO0A 1MMXA 2OW7A 2EACA 3X41A 1DYUA 3T0UA 1JRQA 3T2OA 2YFNA 2CQSA 2CFDA 3WVFA 3AFJA 3EJQA 2XN0A 1IQYA 3TY1A 1NSUA 2EADA 3D52A 4BZFA 1UG9A 1F1SA 1L7JA 3BGAA 1JZ6A 3MV01 3HIIA 2CWUA 1JYNA 2F1BA 1MMUA 2WW3A 1TXKA 4BZGA 2Q1FA 3BVTA 1N9EA 3DYPA 1ULVA 3LOYA 3WFAA 1Z45A 4KTPA 1PX3A 2WW0A 3K25A 1QX1A 2WW1A 2CFLA 1UI8A 4KFDA 4AQ0A 1HN1A 3MI6A 2CFGA 3ECQA 3X40A 1NS0A 1I8QA 2ALWA 4MMHA 3W7SA 1R34A 3ACSA 3T0BA 1A2VA 3W7UA 1JZ5A 1LF6A 1NSSA 3AFLA 2WW2A 3BS6A 1SIHA 2FYVA 1OJMA 2WVXA 3T09A 2BRWA 3CZNA 5A1AA 1JZ4A 3EJUA 1AV4A 3I3DA 3QG0A 3VD3A 3CZJA 4KTRA 1AVKA 1N7OA 1NSZA 2WVZA 1N7RA 4FNQA 4BZEA 2BRPA 5GW7A 2D1WA 1JYVA 1IQXA 4NEIA 2OW6A 3NJVA 3VSNA 4FNRA 3NBBA 3QDEA 2RDYA 3NBJA 3VD7A 3IMHA 1NKGA 1W7CA 1OJPA 1LURA 4OK2A 3BUDA 1SIIA 1QWNA 2OOVC 2WVYA 2F7QA 2Y74A 1NSVA 3LVTA 3BUPA 1F4HA 3KN4A 2WOHA 1TQWA 1YGAA 3D4ZA 1HXKA 1D6YA 1PS3A 3SEPA 3HI7A 1HMUA 1OJNA 1W3YA 3CZSA 4BTYA 2CG0A 1UI7A 3VD9A 2JKPA 3DX0A 3T0AA 3A24A 1TQVA 1W6CA 1TU5A 1KSIA 2YX9A 3T08A 3BLBA 2CFWA 3DX1A 1X1IA 2C10A 3CV5A 3BUBA 4EV5A 4BTWA 4K3AA 3KIIA 4J5TA 2W0QA 1QAFA 1V7WA 1D6UA 1L7KA 1D6ZA 2ZL8A 2XN1A 3DX4A 1TQSA 3MUY1 2YFOA 3WIQA 3VDCA 3Q1NA 1NS2A 4KFFA 1PU4A 1MMYA 1R33A 1RJOA 4DUVA 1K1XA 4FNUA 1JZ7A 1NSRA 2JKAA 1RWFA 2CWVA 3D3IA 2EAEA 3BVXA 1JYXA 1W4NA 2FUTA 3ALAA 3E80A 1JYWA 3E1F1 2CG1A 2F7RA 1OJOA 1RWCA 3J7HA 2WZSA 1HN0A 2E2UA 1F9GA 5KBPA 3EJPA 4BZHA 1IVXA 5CA3A 1W5ZA 2CWTA 1X1HA 3AMOB 3NJXA 1MMZA 1N7PA 2WYHA 2Y73A 3BUQA 3BVVA 1SO0A 1US1A 2WDAA 1EKMA 1J0MA 2JKEA 1NSMA 2CISA 3MWXA 3EJSA 3X3ZA 1CB8A 3ACTA 3W7TA 1QWUA 2OOVA 1TQTA 4EV2A 3MPHA 3MV11 5JMFA 3OS7A 1JZ8A 2F7OA 3T2QA 1HM3A 1C82A 4UFCA 3DDFA 5E1QA 3S4DA 1NS8A 1DP0A 3D50A 3SX1A 3BUIA 3T0DA 2D73A 1X1JA 1MN0A 1RW9A 3DYOA 2F18A 2E24A 2CFKA 1YQ2A 2XN2A 3E7JA 3DYMA 1W6GA 3PGBA 3AMOA 3S4BA
chains in the Genus database with same CATH topology
1RWHA 1NS4A 1J0NA 1RWFA 2X03A 5JMDA 1JYXA 2FUTA 4RNLA 2FUQA 3E80A 3IMHA 3VD7A 1NKGA 1JYWA 2E22A 3E1F1 3VD5A 2HTBA 2ZXQA 3VSMA 1OJPA 2ZQ0A 3A0OA 1LURA 1N7QA 1F4AA 3OBAA 1N7NA 4OJZA 4OK2A 1EGUA 3VDBA 1OJOA 1MMXA 1LF9A 1RWCA 2WVYA 3J7HA 4OK4A 2WZSA 1HN0A 1NS7A 3T2OA 1F9GA 1NSVA 1F4HA 3WVFA 3IAPA 4BZHA 3TY1A 1NSUA 4BZFA 1UG9A 1F1SA 1PX4A 1HM2A 2XSGA 1L7JA 1X1HA 1YGAA 3BGAA 3MV01 1JZ6A 1JYNA 1MMUA 1JZ2A 3NJXA 2WW3A 3SEPA 1HMUA 1MMZA 1N7PA 1TXKA 2CIQA 2WCOA 1OJNA 4BZGA 1SO0A 2Q1FA 3VD4A 1W3YA 1JOVA 2WDAA 3DYPA 1LXMA 3VD9A 1ULVA 1J0MA 3WFAA 2JKPA 2JKEA 1NSMA 2CISA 3IAQA 1Z45A 1SNZA 3T0AA 1PX3A 3A24A 3MWXA 2WW0A 3K25A 4FNVA 2WW1A 2HTAA 1CB8A 3NREA 4AQ0A 3I3EA 2XHNA 1HN1A 3BLCA 3T08A 3ECQA 1NS0A 4DUWA 1I8QA 4MMHA 3T0BA 1X1IA 3MV11 1JZ5A 1LF6A 1NSSA 5JMFA 1LXKA 1NSXA 3OS7A 3AFLA 1LOHA 2WW2A 3BS6A 3DECA 1JZ8A 1OJMA 2WVXA 3T09A 2BRWA 3T2QA 1HM3A 4J5TA 3MUZ1 5A1AA 1C82A 2BRVX 1JZ4A 1L7KA 1K1WA 5E1QA 1NS8A 1RWAA 1DP0A 3T0DA 2D73A 2CIRA 3DCDA 3MUY1 1HMWA 3I3DA 3VD3A 4DUXA 3CZJA 1X1JA 4MMIA 3VDCA 3Q1NA 1NS2A 1N7OA 4TTGA 1NSZA 3I3BA 2WVZA 1MMYA 1MN0A 1N7RA 1RW9A 3T2PA 3DYOA 4BZEA 2BRPA 1JZ3A 2E24A 1JYVA 1RWGA 3OB8A 1YQ2A 3E7JA 4DUVA 1K1YA 1K1XA 3DYMA 4NEIA 3VDAA 2WVXB 3NJVA 1JZ7A 1NSRA 2JKAA 3VSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWH A;  1NS4 A;  1J0N A;  1RWF A;  2X03 A;  1JYX A;  4RNL A;  3VD7 A;  3IMH A;  1NKG A;  1JYW A;  2E22 A;  3E1F 1;  3VD5 A;  2HTB A;  2ZXQ A;  1OJP A;  2ZQ0 A;  1LUR A;  1N7Q A;  1F4A A;  3OBA A;  1N7N A;  1EGU A;  3VDB A;  1OJO A;  1MMX A;  1LF9 A;  1RWC A;  2WVY A;  3J7H A;  2WZS A;  1HN0 A;  1NS7 A;  3T2O A;  1F9G A;  1NSV A;  1F4H A;  3IAP A;  4BZH A;  1NSU A;  4BZF A;  1UG9 A;  1F1S A;  1PX4 A;  1HM2 A;  2XSG A;  1L7J A;  1X1H A;  1YGA A;  3BGA A;  3MV0 1;  1JZ6 A;  1JYN A;  1MMU A;  1JZ2 A;  3NJX A;  2WW3 A;  3SEP A;  1HMU A;  1MMZ A;  1N7P A;  1TXK A;  2CIQ A;  2WCO A;  1OJN A;  4BZG A;  1SO0 A;  2Q1F A;  3VD4 A;  1W3Y A;  1JOV A;  2WDA A;  3DYP A;  1LXM A;  3VD9 A;  1ULV A;  1J0M A;  3WFA A;  2JKP A;  2JKE A;  1NSM A;  2CIS A;  3IAQ A;  1Z45 A;  1SNZ A;  3T0A A;  1PX3 A;  3A24 A;  3MWX A;  2WW0 A;  3K25 A;  2WW1 A;  2HTA A;  1CB8 A;  3NRE A;  4AQ0 A;  3I3E A;  2XHN A;  1HN1 A;  3T08 A;  3ECQ A;  1NS0 A;  4DUW A;  1I8Q A;  3T0B A;  1X1I A;  3MV1 1;  1JZ5 A;  1LF6 A;  1NSS A;  1LXK A;  1NSX A;  3OS7 A;  1LOH A;  2WW2 A;  3DEC A;  1JZ8 A;  1OJM A;  2WVX A;  3T09 A;  2BRW A;  3T2Q A;  1HM3 A;  5A1A A;  3MUZ 1;  1C82 A;  2BRV X;  1JZ4 A;  1L7K A;  1K1W A;  5E1Q A;  1NS8 A;  1RWA A;  1DP0 A;  3T0D A;  2D73 A;  2CIR A;  3DCD A;  3MUY 1;  1HMW A;  3I3D A;  3VD3 A;  4DUX A;  3CZJ A;  1X1J A;  3VDC A;  3Q1N A;  1NS2 A;  1N7O A;  4TTG A;  1NSZ A;  3I3B A;  2WVZ A;  1MMY A;  1MN0 A;  1N7R A;  1RW9 A;  3T2P A;  3DYO A;  4BZE A;  2BRP A;  1JZ3 A;  2E24 A;  1JYV A;  1RWG A;  3OB8 A;  1YQ2 A;  4DUV A;  1K1Y A;  1K1X A;  3DYM A;  3VDA A;  2WVX B;  3NJV A;  1JZ7 A;  1NSR A;  2JKA A; 
#chains in the Genus database with same CATH topology
 3RSY A;  2C11 A;  1NS4 A;  2EAB A;  1J0N A;  3WA2 X;  3WIR A;  2CQT A;  2FUQ A;  3K5T A;  3BVW A;  1IU7 A;  3VD5 A;  1W2Z A;  3A0O A;  1N7Q A;  1F4A A;  1OAC A;  3EJT A;  3X3X A;  1QAL A;  1LF9 A;  4OK4 A;  1NS7 A;  3DDG A;  3S4A A;  3IAP A;  1SPU A;  1PX4 A;  1IVU A;  1HM2 A;  2XSG A;  1O7D D;  2WYI A;  1JZ2 A;  1HTY A;  1WMO A;  1IVV A;  3X42 A;  2CIQ A;  2WCO A;  3VD4 A;  1JOV A;  2BT3 A;  2WOF A;  1LXM A;  3IAQ A;  3D4Y A;  1SNZ A;  4FNV A;  2WGQ A;  4BTX A;  3N9H A;  2HTA A;  3X3Y A;  3NRE A;  1AVL A;  2E2V A;  3W7W A;  3I3E A;  2XHN A;  3BLC A;  4FNP A;  1H54 A;  4DUW A;  3QFY A;  3W7X A;  3DX3 A;  3BVU A;  1V7V A;  1LXK A;  1LVN A;  1NSX A;  4K35 A;  4KFE A;  3WA3 A;  1LOH A;  3DEC A;  1WMN A;  3QFZ A;  3MUZ 1;  3S4C A;  2F1A A;  4FNT A;  1V7X A;  2BRV X;  1K1W A;  1RWA A;  3D51 A;  2PNC A;  2E2T A;  2CIR A;  1WMP A;  3DCD A;  1HMW A;  3HIG A;  4DUX A;  4MMI A;  1QAK A;  4TTG A;  3I3B A;  3SXX A;  3T2P A;  2OQE C;  1HWW A;  1JZ3 A;  1TQU A;  1RWG A;  3OB8 A;  1K1Y A;  3VDA A;  2WVX B;  4OJZ A;  1RWH A;  4FNS A;  3EJR A;  1IVW A;  1RKY A;  3DX2 A;  2X03 A;  5JMD A;  3RRS A;  4RNL A;  2OQE A;  2E22 A;  2HTB A;  2ZXQ A;  3VSM A;  2ZQ0 A;  3OBA A;  1N7N A;  1EGU A;  2F7P A;  3VDB A;  2WO0 A;  1MMX A;  2OW7 A;  2EAC A;  3X41 A;  1DYU A;  3T0U A;  1JRQ A;  3T2O A;  2YFN A;  2CQS A;  2CFD A;  3WVF A;  3AFJ A;  3EJQ A;  2XN0 A;  1IQY A;  3TY1 A;  1NSU A;  2EAD A;  3D52 A;  4BZF A;  1UG9 A;  1F1S A;  1L7J A;  3BGA A;  1JZ6 A;  3MV0 1;  3HII A;  2CWU A;  1JYN A;  2F1B A;  1MMU A;  2WW3 A;  1TXK A;  4BZG A;  2Q1F A;  3BVT A;  1N9E A;  3DYP A;  1ULV A;  3LOY A;  3WFA A;  1Z45 A;  4KTP A;  1PX3 A;  2WW0 A;  3K25 A;  1QX1 A;  2WW1 A;  2CFL A;  1UI8 A;  4KFD A;  4AQ0 A;  1HN1 A;  3MI6 A;  2CFG A;  3ECQ A;  3X40 A;  1NS0 A;  1I8Q A;  2ALW A;  4MMH A;  3W7S A;  1R34 A;  3ACS A;  3T0B A;  1A2V A;  3W7U A;  1JZ5 A;  1LF6 A;  1NSS A;  3AFL A;  2WW2 A;  3BS6 A;  1SIH A;  2FYV A;  1OJM A;  2WVX A;  3T09 A;  2BRW A;  3CZN A;  5A1A A;  1JZ4 A;  3EJU A;  1AV4 A;  3I3D A;  3QG0 A;  3VD3 A;  3CZJ A;  4KTR A;  1AVK A;  1N7O A;  1NSZ A;  2WVZ A;  1N7R A;  4FNQ A;  4BZE A;  2BRP A;  5GW7 A;  2D1W A;  1JYV A;  1IQX A;  4NEI A;  2OW6 A;  3NJV A;  3VSN A;  4FNR A;  3NBB A;  3QDE A;  2RDY A;  3NBJ A;  3VD7 A;  3IMH A;  1NKG A;  1W7C A;  1OJP A;  1LUR A;  4OK2 A;  3BUD A;  1SII A;  1QWN A;  2OOV C;  2WVY A;  2F7Q A;  2Y74 A;  1NSV A;  3LVT A;  3BUP A;  1F4H A;  3KN4 A;  2WOH A;  1TQW A;  1YGA A;  3D4Z A;  1HXK A;  1D6Y A;  1PS3 A;  3SEP A;  3HI7 A;  1HMU A;  1OJN A;  1W3Y A;  3CZS A;  4BTY A;  2CG0 A;  1UI7 A;  3VD9 A;  2JKP A;  3DX0 A;  3T0A A;  3A24 A;  1TQV A;  1W6C A;  1TU5 A;  1KSI A;  2YX9 A;  3T08 A;  3BLB A;  2CFW A;  3DX1 A;  1X1I A;  2C10 A;  3CV5 A;  3BUB A;  4EV5 A;  4BTW A;  4K3A A;  3KII A;  4J5T A;  2W0Q A;  1QAF A;  1V7W A;  1D6U A;  1L7K A;  1D6Z A;  2ZL8 A;  2XN1 A;  3DX4 A;  1TQS A;  3MUY 1;  2YFO A;  3WIQ A;  3VDC A;  3Q1N A;  1NS2 A;  4KFF A;  1PU4 A;  1MMY A;  1R33 A;  1RJO A;  4DUV A;  1K1X A;  4FNU A;  1JZ7 A;  1NSR A;  2JKA A;  1RWF A;  2CWV A;  3D3I A;  2EAE A;  3BVX A;  1JYX A;  1W4N A;  2FUT A;  3ALA A;  3E80 A;  1JYW A;  3E1F 1;  2CG1 A;  2F7R A;  1OJO A;  1RWC A;  3J7H A;  2WZS A;  1HN0 A;  2E2U A;  1F9G A;  5KBP A;  3EJP A;  4BZH A;  1IVX A;  5CA3 A;  1W5Z A;  2CWT A;  1X1H A;  3AMO B;  3NJX A;  1MMZ A;  1N7P A;  2WYH A;  2Y73 A;  3BUQ A;  3BVV A;  1SO0 A;  1US1 A;  2WDA A;  1EKM A;  1J0M A;  2JKE A;  1NSM A;  2CIS A;  3MWX A;  3EJS A;  3X3Z A;  1CB8 A;  3ACT A;  3W7T A;  1QWU A;  2OOV A;  1TQT A;  4EV2 A;  3MPH A;  3MV1 1;  5JMF A;  3OS7 A;  1JZ8 A;  2F7O A;  3T2Q A;  1HM3 A;  1C82 A;  4UFC A;  3DDF A;  5E1Q A;  3S4D A;  1NS8 A;  1DP0 A;  3D50 A;  3SX1 A;  3BUI A;  3T0D A;  2D73 A;  1X1J A;  1MN0 A;  1RW9 A;  3DYO A;  2F18 A;  2E24 A;  2CFK A;  1YQ2 A;  2XN2 A;  3E7J A;  3DYM A;  1W6G A;  3PGB A;  3AMO A;  3S4B A; 
#chains in the Genus database with same CATH homology
 1RWH A;  1NS4 A;  1J0N A;  1RWF A;  2X03 A;  5JMD A;  1JYX A;  2FUT A;  4RNL A;  2FUQ A;  3E80 A;  3IMH A;  3VD7 A;  1NKG A;  1JYW A;  2E22 A;  3E1F 1;  3VD5 A;  2HTB A;  2ZXQ A;  3VSM A;  1OJP A;  2ZQ0 A;  3A0O A;  1LUR A;  1N7Q A;  1F4A A;  3OBA A;  1N7N A;  4OJZ A;  4OK2 A;  1EGU A;  3VDB A;  1OJO A;  1MMX A;  1LF9 A;  1RWC A;  2WVY A;  3J7H A;  4OK4 A;  2WZS A;  1HN0 A;  1NS7 A;  3T2O A;  1F9G A;  1NSV A;  1F4H A;  3WVF A;  3IAP A;  4BZH A;  3TY1 A;  1NSU A;  4BZF A;  1UG9 A;  1F1S A;  1PX4 A;  1HM2 A;  2XSG A;  1L7J A;  1X1H A;  1YGA A;  3BGA A;  3MV0 1;  1JZ6 A;  1JYN A;  1MMU A;  1JZ2 A;  3NJX A;  2WW3 A;  3SEP A;  1HMU A;  1MMZ A;  1N7P A;  1TXK A;  2CIQ A;  2WCO A;  1OJN A;  4BZG A;  1SO0 A;  2Q1F A;  3VD4 A;  1W3Y A;  1JOV A;  2WDA A;  3DYP A;  1LXM A;  3VD9 A;  1ULV A;  1J0M A;  3WFA A;  2JKP A;  2JKE A;  1NSM A;  2CIS A;  3IAQ A;  1Z45 A;  1SNZ A;  3T0A A;  1PX3 A;  3A24 A;  3MWX A;  2WW0 A;  3K25 A;  4FNV A;  2WW1 A;  2HTA A;  1CB8 A;  3NRE A;  4AQ0 A;  3I3E A;  2XHN A;  1HN1 A;  3BLC A;  3T08 A;  3ECQ A;  1NS0 A;  4DUW A;  1I8Q A;  4MMH A;  3T0B A;  1X1I A;  3MV1 1;  1JZ5 A;  1LF6 A;  1NSS A;  5JMF A;  1LXK A;  1NSX A;  3OS7 A;  3AFL A;  1LOH A;  2WW2 A;  3BS6 A;  3DEC A;  1JZ8 A;  1OJM A;  2WVX A;  3T09 A;  2BRW A;  3T2Q A;  1HM3 A;  4J5T A;  3MUZ 1;  5A1A A;  1C82 A;  2BRV X;  1JZ4 A;  1L7K A;  1K1W A;  5E1Q A;  1NS8 A;  1RWA A;  1DP0 A;  3T0D A;  2D73 A;  2CIR A;  3DCD A;  3MUY 1;  1HMW A;  3I3D A;  3VD3 A;  4DUX A;  3CZJ A;  1X1J A;  4MMI A;  3VDC A;  3Q1N A;  1NS2 A;  1N7O A;  4TTG A;  1NSZ A;  3I3B A;  2WVZ A;  1MMY A;  1MN0 A;  1N7R A;  1RW9 A;  3T2P A;  3DYO A;  4BZE A;  2BRP A;  1JZ3 A;  2E24 A;  1JYV A;  1RWG A;  3OB8 A;  1YQ2 A;  3E7J A;  4DUV A;  1K1Y A;  1K1X A;  3DYM A;  4NEI A;  3VDA A;  2WVX B;  3NJV A;  1JZ7 A;  1NSR A;  2JKA A;  3VSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...