2HTBA

Crystal structure of a putative mutarotase (yead) from salmonella typhimurium in monoclinic form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
296
structure length
296
Chain Sequence
SHMINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLWLSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFELQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGLGDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative enzyme related to aldose 1-epimerase
publication title Structure of the putative mutarotase YeaD from Salmonella typhimurium: structural comparison with galactose mutarotases.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 69
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.15: Glucose-6-phosphate 1-epimerase.
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 2htbA00
2WVZA 1CB8A 1HM3A 1Z45A 3Q1NA 5A1AA 1F9GA 1N7QA 2JKAA 1RW9A 1J0NA 1F4HA 1RWCA 1EGUA 1MN0A 1MMYA 3MUY1 3OBAA 1NSXA 1HMUA 1DP0A 4BZEA 3ECQA 1NS7A 3VDBA 3SEPA 2BRPA 1L7KA 1X1JA 2WW2A 2WDAA 1NSMA 1JZ4A 2E24A 1C82A 1LOHA 2BRVX 3DYMA 3J7HA 1LXMA 1JZ2A 3NJXA 4AQ0A 1L7JA 3MUZ1 3MV11 4RNLA 2ZXQA 1MMUA 1JZ5A 1MMXA 3CZJA 3VD4A 1ULVA 3IAPA 1SO0A 3T2QA 3VDAA 1JYNA 4TTGA 1RWHA 1JOVA 2WCOA 1YGAA 1NS4A 3T0AA 1JZ8A 1UG9A 3OB8A 3BGAA 1OJOA 2Q1FA 4BZHA 1F1SA 1YQ2A 3A24A 3T08A 3VD7A 2JKPA 3OS7A 3I3EA 2BRWA 1K1XA 1K1YA 1RWGA 2HTBA 2WVXA 1NSRA 1JYVA 1PX4A 1NSVA 1HM2A 1N7RA 2D73A 3DECA 3NJVA 1LF6A 3DCDA 1N7PA 2E22A 3VD3A 3I3DA 3IAQA 4DUWA 1J0MA 2WW3A 1OJNA 3T2OA 4BZFA 1F4AA 4BZGA 1W3YA 1NSZA 3MV01 1X1IA 3I3BA 3WFAA 3DYOA 1TXKA 3T09A 3VDCA 2CIQA 1K1WA 1NS8A 4DUXA 1LXKA 2ZQ0A 5E1QA 1MMZA 4DUVA 2CISA 1NS2A 2WW0A 3E1F1 1LURA 1JZ7A 2XHNA 1RWFA 2WW1A 3IMHA 1NSUA 1JYWA 1HN1A 3DYPA 2X03A 2WVXB 1OJMA 2WVYA 2JKEA 1RWAA 3NREA 1X1HA 2WZSA 1OJPA 3K25A 3T0DA 1I8QA 1N7OA 1PX3A 2XSGA 3VD5A 1NSSA 1HN0A 3MWXA 1JZ3A 1JYXA 1N7NA 1NKGA 1SNZA 1LF9A 3T2PA 2CIRA 2HTAA 3T0BA 1NS0A 1HMWA 1JZ6A 3VD9A
chains in the Genus database with same CATH superfamily
2WVZA 1CB8A 1HM3A 5A1AA 1KSIA 2JKAA 2FUTA 3AFLA 1EGUA 1MMYA 3EJTA 3X40A 1HMUA 1V7WA 4BZEA 1NS7A 3SEPA 2BRPA 3QFZA 2FYVA 2CFDA 1IQYA 3BLBA 3RSYA 4OK4A 2Y74A 3ALAA 4K35A 2F7QA 4FNPA 1V7XA 3NBJA 3BVXA 1D6UA 3CZJA 3E80A 3DX1A 1N9EA 3BUIA 3K5TA 3EJSA 1OACA 3MI6A 1UG9A 3CV5A 3AFJA 2ZL8A 4FNRA 1QAFA 2PNCA 1IQXA 3DX2A 2HTBA 1NSRA 3KN4A 4UFCA 1IVXA 3AMOA 1N7RA 2D73A 3DECA 3DX0A 2D1WA 3DCDA 4KFDA 1N7PA 4FNQA 1EKMA 3VD3A 3WIRA 1PS3A 4DUWA 4FNVA 3T2OA 4FNSA 3D50A 1F4AA 4BZGA 3NBBA 2OQEC 3WFAA 1LVNA 1K1WA 1MMZA 1TQTA 2CISA 1NS2A 1DYUA 1TU5A 3WVFA 3D51A 3SXXA 2YFOA 1QX1A 2CFGA 2JKEA 1RWAA 1X1HA 2WZSA 4EV2A 2OW7A 3BUDA 3VD5A 3MWXA 1N7NA 3MPHA 1SNZA 2HTAA 3Q1NA 1D6YA 3DDFA 1RW9A 3BS6A 1HXKA 1RWCA 3MUY1 4FNTA 3S4DA 3W7SA 3QG0A 2CFKA 3ECQA 2C10A 2WO0A 1W6CA 3LOYA 3VDBA 3T0UA 1WMNA 1X1JA 1IU7A 3WA2X 2XN2A 1LOHA 1IVVA 1R34A 3EJPA 1LXMA 3S4AA 5CA3A 3MUZ1 2OQEA 4K3AA 4MMIA 1MMXA 1JZ5A 3TY1A 3VD4A 2BT3A 3IAPA 1SO0A 3BLCA 2CG1A 2Y73A 4KTRA 2F7RA 1RWHA 1W6GA 1YGAA 3EJQA 1NS4A 3D52A 3OB8A 3WIQA 3BGAA 3LVTA 1YQ2A 3A24A 3VD7A 3HIGA 3OS7A 2BRWA 1K1XA 1K1YA 3X41A 1IVUA 1NSVA 1US1A 3NJVA 1LF6A 4OK2A 3X3YA 2E22A 3I3DA 4BTWA 3IAQA 1J0MA 3KIIA 1JRQA 2CG0A 1NSZA 4NEIA 3N9HA 2CQTA 5E1QA 4DUVA 2CFLA 3BVVA 2F18A 2WW1A 1NSUA 1JYWA 2CQSA 1UI8A 3EJRA 2WVXB 2WVYA 3QFYA 2EACA 1W5ZA 3NREA 1AVKA 3K25A 3T0DA 3RRSA 1NSSA 1HN0A 3BVUA 1W7CA 1JYXA 1NKGA 5JMDA 3T2PA 1NS0A 3DX4A 4KTPA 1F9GA 1N7QA 1RJOA 2YX9A 3X3ZA 1MN0A 1QAKA 1HWWA 1DP0A 3DDGA 2CWTA 1L7KA 2FUQA 4FNUA 2WW2A 2WDAA 1NSMA 1JZ4A 3J7HA 1JZ2A 3NJXA 1HTYA 4AQ0A 1L7JA 4RNLA 1MMUA 3W7TA 3BVTA 2WGQA 1ULVA 4KFEA 1JYNA 4TTGA 1QALA 2WCOA 4BTXA 2EAEA 1AVLA 4BZHA 3CZNA 1F1SA 3SX1A 3WA3A 2JKPA 3I3EA 1RWGA 2WVXA 1HM2A 2E2TA 1V7VA 2OW6A 3QDEA 3W7XA 2F1BA 2OOVC 1QWNA 1OJNA 2ALWA 1AV4A 3VSMA 3DYOA 1QWUA 1TXKA 3VDCA 5JMFA 2CIQA 2WYHA 1NS8A 1TQWA 1LXKA 2ZQ0A 1SIIA 3D4YA 2WW0A 3X42A 3E1F1 3IMHA 1HN1A 1WMOA 2RDYA 4EV5A 1OJPA 1I8QA 2XSGA 1PX3A 3ACTA 3S4BA 3CZSA 2WOFA 1LF9A 1TQSA 2CIRA 3T0BA 1HMWA 3VD9A 4J5TA 1Z45A 3BUBA 1J0NA 1SIHA 1SPUA 1F4HA 5KBPA 3X3XA 3OBAA 1NSXA 3HI7A 4MMHA 4OJZA 2XN1A 3W7WA 2E24A 1C82A 1TQVA 2BRVX 2OOVA 3DYMA 3D3IA 2WOHA 2CWVA 3MV11 3ACSA 2ZXQA 4BTYA 2F1AA 1WMPA 2E2UA 1IVWA 2CWUA 1O7DD 3T2QA 3VDAA 1JOVA 5GW7A 3T0AA 1JZ8A 1UI7A 1OJOA 2Q1FA 3S4CA 3T08A 2EADA 2CFWA 1JYVA 1PX4A 3EJUA 3BUPA 3DX3A 3HIIA 3A0OA 2F7OA 2WW3A 4BZFA 3PGBA 1R33A 1W3YA 2F7PA 3VSNA 3MV01 3W7UA 1X1IA 3I3BA 1TQUA 2W0QA 4KFFA 3E7JA 3T09A 4DUXA 2YFNA 1A2VA 2XN0A 1H54A 1LURA 1W2ZA 1JZ7A 2XHNA 1RWFA 3DYPA 2X03A 1RKYA 1OJMA 3AMOB 3BUQA 1PU4A 1D6ZA 2C11A 3BVWA 1N7OA 1JZ3A 2EABA 2WYIA 1W4NA 2E2VA 3D4ZA 1JZ6A
chains in the Genus database with same CATH topology
2WVZA 1CB8A 4J5TA 1HM3A 1Z45A 3Q1NA 5A1AA 1F9GA 1N7QA 2JKAA 1RW9A 1J0NA 2FUTA 3AFLA 3BS6A 1F4HA 1RWCA 1EGUA 1MN0A 1MMYA 3MUY1 3OBAA 1NSXA 1HMUA 1DP0A 4BZEA 3ECQA 1NS7A 4MMHA 4OJZA 3SEPA 2BRPA 3VDBA 1L7KA 1X1JA 2FUQA 2WW2A 2WDAA 1NSMA 1JZ4A 2E24A 1C82A 1LOHA 2BRVX 4OK4A 3DYMA 3J7HA 1LXMA 1JZ2A 3NJXA 4AQ0A 1L7JA 3MUZ1 3MV11 4RNLA 2ZXQA 1MMUA 4MMIA 1MMXA 1JZ5A 3CZJA 3E80A 3TY1A 3VD4A 1ULVA 3IAPA 1SO0A 3BLCA 3T2QA 3VDAA 1JYNA 4TTGA 1RWHA 1JOVA 2WCOA 1YGAA 1NS4A 3T0AA 1JZ8A 1UG9A 3OB8A 3BGAA 1OJOA 2Q1FA 4BZHA 1F1SA 1YQ2A 3A24A 3T08A 3VD7A 2JKPA 3OS7A 3I3EA 2BRWA 1K1XA 1K1YA 1RWGA 2HTBA 2WVXA 1NSRA 1JYVA 1PX4A 1NSVA 1HM2A 1N7RA 2D73A 3DECA 3NJVA 1LF6A 4OK2A 3DCDA 1N7PA 2E22A 3A0OA 3VD3A 3I3DA 3IAQA 4DUWA 4FNVA 1J0MA 2WW3A 1OJNA 3T2OA 4BZFA 1F4AA 4BZGA 3VSMA 1W3YA 1NSZA 3VSNA 3MV01 1X1IA 3I3BA 3WFAA 3DYOA 4NEIA 1TXKA 3E7JA 3T09A 2CIQA 1K1WA 1NS8A 3VDCA 4DUXA 1LXKA 2ZQ0A 5JMFA 5E1QA 1MMZA 4DUVA 2CISA 1NS2A 2WW0A 3E1F1 1LURA 1JZ7A 3WVFA 2XHNA 1RWFA 2WW1A 3IMHA 1NSUA 1JYWA 1HN1A 3DYPA 2X03A 2WVXB 1OJMA 2WVYA 2JKEA 1RWAA 3NREA 1X1HA 2WZSA 1OJPA 3K25A 3T0DA 1I8QA 1N7OA 1PX3A 2XSGA 3VD5A 1NSSA 1HN0A 3MWXA 1JZ3A 1JYXA 1N7NA 1NKGA 1SNZA 1LF9A 5JMDA 3T2PA 2CIRA 2HTAA 3T0BA 1NS0A 1HMWA 1JZ6A 3VD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVZ A;  1CB8 A;  1HM3 A;  1Z45 A;  3Q1N A;  5A1A A;  1F9G A;  1N7Q A;  2JKA A;  1RW9 A;  1J0N A;  1F4H A;  1RWC A;  1EGU A;  1MN0 A;  1MMY A;  3MUY 1;  3OBA A;  1NSX A;  1HMU A;  1DP0 A;  4BZE A;  3ECQ A;  1NS7 A;  3VDB A;  3SEP A;  2BRP A;  1L7K A;  1X1J A;  2WW2 A;  2WDA A;  1NSM A;  1JZ4 A;  2E24 A;  1C82 A;  1LOH A;  2BRV X;  3DYM A;  3J7H A;  1LXM A;  1JZ2 A;  3NJX A;  4AQ0 A;  1L7J A;  3MUZ 1;  3MV1 1;  4RNL A;  2ZXQ A;  1MMU A;  1JZ5 A;  1MMX A;  3CZJ A;  3VD4 A;  1ULV A;  3IAP A;  1SO0 A;  3T2Q A;  3VDA A;  1JYN A;  4TTG A;  1RWH A;  1JOV A;  2WCO A;  1YGA A;  1NS4 A;  3T0A A;  1JZ8 A;  1UG9 A;  3OB8 A;  3BGA A;  1OJO A;  2Q1F A;  4BZH A;  1F1S A;  1YQ2 A;  3A24 A;  3T08 A;  3VD7 A;  2JKP A;  3OS7 A;  3I3E A;  2BRW A;  1K1X A;  1K1Y A;  1RWG A;  2HTB A;  2WVX A;  1NSR A;  1JYV A;  1PX4 A;  1NSV A;  1HM2 A;  1N7R A;  2D73 A;  3DEC A;  3NJV A;  1LF6 A;  3DCD A;  1N7P A;  2E22 A;  3VD3 A;  3I3D A;  3IAQ A;  4DUW A;  1J0M A;  2WW3 A;  1OJN A;  3T2O A;  4BZF A;  1F4A A;  4BZG A;  1W3Y A;  1NSZ A;  3MV0 1;  1X1I A;  3I3B A;  3WFA A;  3DYO A;  1TXK A;  3T09 A;  3VDC A;  2CIQ A;  1K1W A;  1NS8 A;  4DUX A;  1LXK A;  2ZQ0 A;  5E1Q A;  1MMZ A;  4DUV A;  2CIS A;  1NS2 A;  2WW0 A;  3E1F 1;  1LUR A;  1JZ7 A;  2XHN A;  1RWF A;  2WW1 A;  3IMH A;  1NSU A;  1JYW A;  1HN1 A;  3DYP A;  2X03 A;  2WVX B;  1OJM A;  2WVY A;  2JKE A;  1RWA A;  3NRE A;  1X1H A;  2WZS A;  1OJP A;  3K25 A;  3T0D A;  1I8Q A;  1N7O A;  1PX3 A;  2XSG A;  3VD5 A;  1NSS A;  1HN0 A;  3MWX A;  1JZ3 A;  1JYX A;  1N7N A;  1NKG A;  1SNZ A;  1LF9 A;  3T2P A;  2CIR A;  2HTA A;  3T0B A;  1NS0 A;  1HMW A;  1JZ6 A;  3VD9 A; 
#chains in the Genus database with same CATH topology
 2WVZ A;  1CB8 A;  1HM3 A;  5A1A A;  1KSI A;  2JKA A;  2FUT A;  3AFL A;  1EGU A;  1MMY A;  3EJT A;  3X40 A;  1HMU A;  1V7W A;  4BZE A;  1NS7 A;  3SEP A;  2BRP A;  3QFZ A;  2FYV A;  2CFD A;  1IQY A;  3BLB A;  3RSY A;  4OK4 A;  2Y74 A;  3ALA A;  4K35 A;  2F7Q A;  4FNP A;  1V7X A;  3NBJ A;  3BVX A;  1D6U A;  3CZJ A;  3E80 A;  3DX1 A;  1N9E A;  3BUI A;  3K5T A;  3EJS A;  1OAC A;  3MI6 A;  1UG9 A;  3CV5 A;  3AFJ A;  2ZL8 A;  4FNR A;  1QAF A;  2PNC A;  1IQX A;  3DX2 A;  2HTB A;  1NSR A;  3KN4 A;  4UFC A;  1IVX A;  3AMO A;  1N7R A;  2D73 A;  3DEC A;  3DX0 A;  2D1W A;  3DCD A;  4KFD A;  1N7P A;  4FNQ A;  1EKM A;  3VD3 A;  3WIR A;  1PS3 A;  4DUW A;  4FNV A;  3T2O A;  4FNS A;  3D50 A;  1F4A A;  4BZG A;  3NBB A;  2OQE C;  3WFA A;  1LVN A;  1K1W A;  1MMZ A;  1TQT A;  2CIS A;  1NS2 A;  1DYU A;  1TU5 A;  3WVF A;  3D51 A;  3SXX A;  2YFO A;  1QX1 A;  2CFG A;  2JKE A;  1RWA A;  1X1H A;  2WZS A;  4EV2 A;  2OW7 A;  3BUD A;  3VD5 A;  3MWX A;  1N7N A;  3MPH A;  1SNZ A;  2HTA A;  3Q1N A;  1D6Y A;  3DDF A;  1RW9 A;  3BS6 A;  1HXK A;  1RWC A;  3MUY 1;  4FNT A;  3S4D A;  3W7S A;  3QG0 A;  2CFK A;  3ECQ A;  2C10 A;  2WO0 A;  1W6C A;  3LOY A;  3VDB A;  3T0U A;  1WMN A;  1X1J A;  1IU7 A;  3WA2 X;  2XN2 A;  1LOH A;  1IVV A;  1R34 A;  3EJP A;  1LXM A;  3S4A A;  5CA3 A;  3MUZ 1;  2OQE A;  4K3A A;  4MMI A;  1MMX A;  1JZ5 A;  3TY1 A;  3VD4 A;  2BT3 A;  3IAP A;  1SO0 A;  3BLC A;  2CG1 A;  2Y73 A;  4KTR A;  2F7R A;  1RWH A;  1W6G A;  1YGA A;  3EJQ A;  1NS4 A;  3D52 A;  3OB8 A;  3WIQ A;  3BGA A;  3LVT A;  1YQ2 A;  3A24 A;  3VD7 A;  3HIG A;  3OS7 A;  2BRW A;  1K1X A;  1K1Y A;  3X41 A;  1IVU A;  1NSV A;  1US1 A;  3NJV A;  1LF6 A;  4OK2 A;  3X3Y A;  2E22 A;  3I3D A;  4BTW A;  3IAQ A;  1J0M A;  3KII A;  1JRQ A;  2CG0 A;  1NSZ A;  4NEI A;  3N9H A;  2CQT A;  5E1Q A;  4DUV A;  2CFL A;  3BVV A;  2F18 A;  2WW1 A;  1NSU A;  1JYW A;  2CQS A;  1UI8 A;  3EJR A;  2WVX B;  2WVY A;  3QFY A;  2EAC A;  1W5Z A;  3NRE A;  1AVK A;  3K25 A;  3T0D A;  3RRS A;  1NSS A;  1HN0 A;  3BVU A;  1W7C A;  1JYX A;  1NKG A;  5JMD A;  3T2P A;  1NS0 A;  3DX4 A;  4KTP A;  1F9G A;  1N7Q A;  1RJO A;  2YX9 A;  3X3Z A;  1MN0 A;  1QAK A;  1HWW A;  1DP0 A;  3DDG A;  2CWT A;  1L7K A;  2FUQ A;  4FNU A;  2WW2 A;  2WDA A;  1NSM A;  1JZ4 A;  3J7H A;  1JZ2 A;  3NJX A;  1HTY A;  4AQ0 A;  1L7J A;  4RNL A;  1MMU A;  3W7T A;  3BVT A;  2WGQ A;  1ULV A;  4KFE A;  1JYN A;  4TTG A;  1QAL A;  2WCO A;  4BTX A;  2EAE A;  1AVL A;  4BZH A;  3CZN A;  1F1S A;  3SX1 A;  3WA3 A;  2JKP A;  3I3E A;  1RWG A;  2WVX A;  1HM2 A;  2E2T A;  1V7V A;  2OW6 A;  3QDE A;  3W7X A;  2F1B A;  2OOV C;  1QWN A;  1OJN A;  2ALW A;  1AV4 A;  3VSM A;  3DYO A;  1QWU A;  1TXK A;  3VDC A;  5JMF A;  2CIQ A;  2WYH A;  1NS8 A;  1TQW A;  1LXK A;  2ZQ0 A;  1SII A;  3D4Y A;  2WW0 A;  3X42 A;  3E1F 1;  3IMH A;  1HN1 A;  1WMO A;  2RDY A;  4EV5 A;  1OJP A;  1I8Q A;  2XSG A;  1PX3 A;  3ACT A;  3S4B A;  3CZS A;  2WOF A;  1LF9 A;  1TQS A;  2CIR A;  3T0B A;  1HMW A;  3VD9 A;  4J5T A;  1Z45 A;  3BUB A;  1J0N A;  1SIH A;  1SPU A;  1F4H A;  5KBP A;  3X3X A;  3OBA A;  1NSX A;  3HI7 A;  4MMH A;  4OJZ A;  2XN1 A;  3W7W A;  2E24 A;  1C82 A;  1TQV A;  2BRV X;  2OOV A;  3DYM A;  3D3I A;  2WOH A;  2CWV A;  3MV1 1;  3ACS A;  2ZXQ A;  4BTY A;  2F1A A;  1WMP A;  2E2U A;  1IVW A;  2CWU A;  1O7D D;  3T2Q A;  3VDA A;  1JOV A;  5GW7 A;  3T0A A;  1JZ8 A;  1UI7 A;  1OJO A;  2Q1F A;  3S4C A;  3T08 A;  2EAD A;  2CFW A;  1JYV A;  1PX4 A;  3EJU A;  3BUP A;  3DX3 A;  3HII A;  3A0O A;  2F7O A;  2WW3 A;  4BZF A;  3PGB A;  1R33 A;  1W3Y A;  2F7P A;  3VSN A;  3MV0 1;  3W7U A;  1X1I A;  3I3B A;  1TQU A;  2W0Q A;  4KFF A;  3E7J A;  3T09 A;  4DUX A;  2YFN A;  1A2V A;  2XN0 A;  1H54 A;  1LUR A;  1W2Z A;  1JZ7 A;  2XHN A;  1RWF A;  3DYP A;  2X03 A;  1RKY A;  1OJM A;  3AMO B;  3BUQ A;  1PU4 A;  1D6Z A;  2C11 A;  3BVW A;  1N7O A;  1JZ3 A;  2EAB A;  2WYI A;  1W4N A;  2E2V A;  3D4Z A;  1JZ6 A; 
#chains in the Genus database with same CATH homology
 2WVZ A;  1CB8 A;  4J5T A;  1HM3 A;  1Z45 A;  3Q1N A;  5A1A A;  1F9G A;  1N7Q A;  2JKA A;  1RW9 A;  1J0N A;  2FUT A;  3AFL A;  3BS6 A;  1F4H A;  1RWC A;  1EGU A;  1MN0 A;  1MMY A;  3MUY 1;  3OBA A;  1NSX A;  1HMU A;  1DP0 A;  4BZE A;  3ECQ A;  1NS7 A;  4MMH A;  4OJZ A;  3SEP A;  2BRP A;  3VDB A;  1L7K A;  1X1J A;  2FUQ A;  2WW2 A;  2WDA A;  1NSM A;  1JZ4 A;  2E24 A;  1C82 A;  1LOH A;  2BRV X;  4OK4 A;  3DYM A;  3J7H A;  1LXM A;  1JZ2 A;  3NJX A;  4AQ0 A;  1L7J A;  3MUZ 1;  3MV1 1;  4RNL A;  2ZXQ A;  1MMU A;  4MMI A;  1MMX A;  1JZ5 A;  3CZJ A;  3E80 A;  3TY1 A;  3VD4 A;  1ULV A;  3IAP A;  1SO0 A;  3BLC A;  3T2Q A;  3VDA A;  1JYN A;  4TTG A;  1RWH A;  1JOV A;  2WCO A;  1YGA A;  1NS4 A;  3T0A A;  1JZ8 A;  1UG9 A;  3OB8 A;  3BGA A;  1OJO A;  2Q1F A;  4BZH A;  1F1S A;  1YQ2 A;  3A24 A;  3T08 A;  3VD7 A;  2JKP A;  3OS7 A;  3I3E A;  2BRW A;  1K1X A;  1K1Y A;  1RWG A;  2HTB A;  2WVX A;  1NSR A;  1JYV A;  1PX4 A;  1NSV A;  1HM2 A;  1N7R A;  2D73 A;  3DEC A;  3NJV A;  1LF6 A;  4OK2 A;  3DCD A;  1N7P A;  2E22 A;  3A0O A;  3VD3 A;  3I3D A;  3IAQ A;  4DUW A;  4FNV A;  1J0M A;  2WW3 A;  1OJN A;  3T2O A;  4BZF A;  1F4A A;  4BZG A;  3VSM A;  1W3Y A;  1NSZ A;  3VSN A;  3MV0 1;  1X1I A;  3I3B A;  3WFA A;  3DYO A;  4NEI A;  1TXK A;  3E7J A;  3T09 A;  2CIQ A;  1K1W A;  1NS8 A;  3VDC A;  4DUX A;  1LXK A;  2ZQ0 A;  5JMF A;  5E1Q A;  1MMZ A;  4DUV A;  2CIS A;  1NS2 A;  2WW0 A;  3E1F 1;  1LUR A;  1JZ7 A;  3WVF A;  2XHN A;  1RWF A;  2WW1 A;  3IMH A;  1NSU A;  1JYW A;  1HN1 A;  3DYP A;  2X03 A;  2WVX B;  1OJM A;  2WVY A;  2JKE A;  1RWA A;  3NRE A;  1X1H A;  2WZS A;  1OJP A;  3K25 A;  3T0D A;  1I8Q A;  1N7O A;  1PX3 A;  2XSG A;  3VD5 A;  1NSS A;  1HN0 A;  3MWX A;  1JZ3 A;  1JYX A;  1N7N A;  1NKG A;  1SNZ A;  1LF9 A;  5JMD A;  3T2P A;  2CIR A;  2HTA A;  3T0B A;  1NS0 A;  1HMW A;  1JZ6 A;  3VD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...