2HTBA

Crystal structure of a putative mutarotase (yead) from salmonella typhimurium in monoclinic form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
296
structure length
296
Chain Sequence
SHMINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLWLSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFELQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGLGDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative enzyme related to aldose 1-epimerase
publication title Structure of the putative mutarotase YeaD from Salmonella typhimurium: structural comparison with galactose mutarotases.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 69
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.15: Glucose-6-phosphate 1-epimerase.
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 2htbA00
4TTGA 3DYPA 1NSUA 1YQ2A 3MV01 2D73A 3VDCA 1MN0A 2Q1FA 1N7NA 1X1HA 2WDAA 4BZEA 1W3YA 2JKAA 3BGAA 3I3EA 1N7OA 2CIRA 1NSZA 4BZGA 1Z45A 2ZXQA 5A1AA 1UG9A 2WZSA 3IAQA 1LURA 1JZ3A 2WW3A 1NKGA 1CB8A 1SO0A 1NSRA 3ECQA 1RWFA 1F1SA 1N7RA 2BRPA 2JKPA 4DUVA 2E22A 1HM3A 1MMXA 1NS8A 3E1F1 3SEPA 1JYNA 3DCDA 1N7PA 1JZ5A 1JYVA 3WFAA 1LXMA 1NSVA 1JZ2A 2ZQ0A 3I3DA 1JZ4A 1JZ8A 3NJVA 1JYWA 2JKEA 1LXKA 3VDAA 1RWAA 1X1IA 2X03A 1NSSA 3OS7A 3T08A 3VD9A 3MV11 3T0BA 3K25A 3OB8A 3VD4A 2BRWA 1LF9A 3T0DA 2HTAA 1OJOA 2CIQA 2WVZA 1NS2A 1RW9A 1F4HA 1HN0A 2WW2A 1K1YA 1C82A 1LOHA 1X1JA 1JZ7A 1MMYA 2XHNA 2WCOA 1SNZA 3T2QA 3Q1NA 1OJMA 1J0MA 1ULVA 2CISA 3T0AA 1K1XA 3MUY1 3VD3A 4RNLA 3DYMA 3VD5A 3MUZ1 1F4AA 3NJXA 2WVXB 1MMZA 1PX3A 1HMWA 1NS4A 3MWXA 4BZFA 2XSGA 1L7JA 1OJNA 3DECA 1NSXA 1LF6A 2WVXA 1K1WA 3I3BA 1OJPA 3T09A 1N7QA 1JYXA 3DYOA 1NSMA 1MMUA 2WW1A 3VDBA 1RWCA 5E1QA 1HN1A 2E24A 3IMHA 1JZ6A 3T2PA 1J0NA 1I8QA 1RWGA 3J7HA 1YGAA 2HTBA 4DUWA 3CZJA 3OBAA 3A24A 4DUXA 1NS0A 3T2OA 1JOVA 2BRVX 1EGUA 3VD7A 1PX4A 2WVYA 1DP0A 3IAPA 1HMUA 4AQ0A 1TXKA 4BZHA 1HM2A 1L7KA 1NS7A 1F9GA 3NREA 2WW0A 1RWHA
chains in the Genus database with same CATH superfamily
2F1AA 3DDFA 4MMIA 1TQWA 1W4NA 2EABA 2E2TA 3ACSA 3W7WA 1N7NA 2WDAA 1W3YA 1R34A 1N7OA 3D4ZA 2W0QA 2ZXQA 2OW6A 3S4CA 3IAQA 2FYVA 1CB8A 4EV2A 3ACTA 2E2UA 4FNTA 2CFWA 2JKPA 4DUVA 4OK4A 2E22A 1MMXA 3SEPA 1N7PA 1JZ5A 1JYVA 3X42A 3HIIA 3I3DA 2JKEA 3VDAA 1X1IA 1SIHA 2CWTA 4FNVA 1NSSA 3BVVA 3VD9A 3X41A 3AMOA 3T0DA 2CG0A 2HTAA 1NS2A 3BVTA 4BTWA 3HI7A 1C82A 3X40A 3TY1A 3Q1NA 3T0AA 2PNCA 1EKMA 4RNLA 3BUPA 2F1BA 2F7RA 1TQSA 2F7OA 4MMHA 1HMWA 3KIIA 1NS4A 1LVNA 1SIIA 1QX1A 3X3XA 3X3YA 4FNSA 2CG1A 1OJPA 2ZL8A 3WIQA 1RWCA 4OJZA 3CZNA 3T2PA 3QFZA 1RKYA 3A24A 4FNUA 2WO0A 2WVYA 1DP0A 1TXKA 1L7KA 1NS7A 1F9GA 4KFDA 3NREA 2OOVC 1RWHA 2CWVA 2YFOA 1NSUA 1YQ2A 1O7DD 3D52A 2D73A 1V7XA 3T0UA 1PS3A 4BZEA 2F18A 2JKAA 4K35A 3I3EA 2BT3A 3EJUA 4BZGA 3SX1A 5GW7A 1JZ3A 3AFJA 4UFCA 3VSMA 1NKGA 2XN2A 1RWFA 1QAKA 2BRPA 3DX0A 1NS8A 3S4BA 3WA2X 5CA3A 3DX2A 1IQXA 1AVKA 3AMOB 3BLBA 4KTPA 3NJVA 1JZ4A 3D4YA 3W7SA 2CQSA 3K25A 3AFLA 3VD4A 1OJOA 1SPUA 1F4HA 1LOHA 4KTRA 1X1JA 2D1WA 2CFKA 2WOFA 1TU5A 1QAFA 1J0MA 3BVUA 3MUY1 3DYMA 2CFDA 1F4AA 1N9EA 1IU7A 2XN1A 1IVXA 1W2ZA 2ALWA 3N9HA 3BUBA 3KN4A 4KFEA 3A0OA 1US1A 2FUQA 1N7QA 3VDBA 2Y73A 4FNPA 5KBPA 2E24A 3IMHA 1J0NA 2HTBA 2YX9A 1H54A 1JOVA 2CWUA 3BS6A 4AQ0A 3X3ZA 3W7XA 4J5TA 3CZSA 1DYUA 1QWUA 3BVWA 3MV01 1HWWA 3CV5A 3VDCA 1W5ZA 1MN0A 5JMFA 2OQEC 3BUIA 3QDEA 1V7VA 3NBJA 5JMDA 1NSZA 4BTYA 1AV4A 1Z45A 4NEIA 4KFFA 5A1AA 1UG9A 2WZSA 1IQYA 2FUTA 1W6GA 1NSRA 1SO0A 2CFLA 4BTXA 1WMPA 1N7RA 1JYNA 2OOVA 3DCDA 2E2VA 3WFAA 1LXMA 3DX1A 1JZ2A 1JYWA 3EJSA 3BUQA 1KSIA 3MV11 4FNRA 3E80A 1LF9A 3EJPA 3QFYA 1W7CA 3BUDA 2YFNA 1RW9A 2WW2A 1HXKA 1JZ7A 4FNQA 3MI6A 1ULVA 1TQVA 4EV5A 2CQTA 3MUZ1 3NJXA 1IVVA 1MMZA 3MWXA 2XSGA 3DECA 3LOYA 1R33A 2Y74A 2WVXA 1K1WA 3K5TA 3SXXA 1JYXA 3S4DA 3DYOA 1NSMA 1MMUA 2WW1A 4K3AA 3W7TA 5E1QA 1HN1A 3NBBA 1A2VA 1TQTA 1I8QA 4DUWA 1RJOA 1UI7A 2BRVX 3DX3A 1HMUA 2RDYA 4BZHA 1HM2A 1QALA 4TTGA 1W6CA 2F7PA 3DYPA 1PU4A 1OACA 3PGBA 1V7WA 2WYIA 2Q1FA 2CFGA 1X1HA 3BGAA 2CIRA 1TQUA 2C11A 3QG0A 3E7JA 2F7QA 1LURA 3VSNA 2WW3A 3DDGA 3DX4A 3ECQA 1F1SA 3MPHA 1HM3A 1WMOA 3E1F1 3RRSA 3S4AA 1NSVA 1JZ8A 2ZQ0A 1LXKA 2OQEA 1RWAA 2XN0A 2X03A 1AVLA 3OS7A 3T08A 2WOHA 3OB8A 2BRWA 2WYHA 3D50A 2CIQA 2WVZA 2EACA 1HN0A 1D6ZA 1QWNA 1K1YA 2WGQA 1D6UA 1MMYA 2XHNA 3WA3A 2WCOA 1JRQA 4OK2A 1SNZA 3RSYA 3WVFA 3T2QA 1OJMA 2CISA 1K1XA 3VD3A 3WIRA 3EJRA 1UI8A 3VD5A 2WVXB 1PX3A 3LVTA 3BLCA 4BZFA 3EJQA 1L7JA 1OJNA 1NSXA 1LF6A 1IVUA 1IVWA 3I3BA 2EADA 3T09A 3HIGA 3BVXA 1WMNA 2OW7A 3D3IA 3ALAA 1JZ6A 3W7UA 2C10A 3J7HA 1RWGA 1YGAA 3CZJA 1D6YA 3OBAA 2EAEA 4DUXA 1NS0A 3EJTA 3T2OA 3VD7A 1EGUA 1PX4A 1HTYA 3D51A 3IAPA 3T0BA 2WW0A
chains in the Genus database with same CATH topology
4TTGA 4MMIA 4J5TA 3DYPA 1NSUA 1YQ2A 3MV01 2D73A 3VDCA 1MN0A 5JMFA 2Q1FA 1N7NA 1X1HA 2WDAA 4BZEA 1W3YA 2JKAA 3BGAA 3I3EA 1N7OA 2CIRA 5JMDA 1NSZA 4BZGA 1Z45A 2ZXQA 4NEIA 3E7JA 1UG9A 2WZSA 5A1AA 2FUTA 3IAQA 1LURA 1JZ3A 3VSNA 2WW3A 3VSMA 1NKGA 1CB8A 1SO0A 1NSRA 3ECQA 1RWFA 1F1SA 1N7RA 2BRPA 2JKPA 4DUVA 4OK4A 2E22A 1HM3A 1MMXA 1NS8A 3E1F1 3SEPA 1JYNA 3DCDA 1N7PA 1JZ5A 1JYVA 3WFAA 1LXMA 1NSVA 1JZ2A 2ZQ0A 3I3DA 1JZ4A 1JZ8A 3NJVA 1JYWA 2JKEA 1LXKA 3VDAA 1RWAA 1X1IA 2X03A 4FNVA 1NSSA 3OS7A 3T08A 3VD9A 3MV11 3T0BA 3K25A 3E80A 3OB8A 3AFLA 2BRWA 1LF9A 3VD4A 3T0DA 2HTAA 1OJOA 2CIQA 2WVZA 1NS2A 1RW9A 1F4HA 1HN0A 2WW2A 1K1YA 1C82A 1LOHA 1X1JA 1JZ7A 1MMYA 3TY1A 2XHNA 2WCOA 4OK2A 3WVFA 1SNZA 3T2QA 3Q1NA 1OJMA 1J0MA 1ULVA 2CISA 3T0AA 1K1XA 3MUY1 3VD3A 4RNLA 3DYMA 3VD5A 3MUZ1 1F4AA 3NJXA 2WVXB 1MMZA 1PX3A 4MMHA 1HMWA 1NS4A 3BLCA 3MWXA 4BZFA 2XSGA 1L7JA 1OJNA 3DECA 3A0OA 1NSXA 1LF6A 2WVXA 1K1WA 3I3BA 1OJPA 2FUQA 3T09A 1N7QA 1JYXA 3DYOA 1NSMA 1MMUA 2WW1A 3VDBA 1RWCA 4OJZA 1HN1A 5E1QA 2E24A 3IMHA 1JZ6A 3T2PA 1J0NA 1I8QA 1RWGA 3J7HA 1YGAA 2HTBA 4DUWA 3CZJA 3OBAA 3A24A 4DUXA 1NS0A 3T2OA 1JOVA 2BRVX 1EGUA 3VD7A 1PX4A 3BS6A 2WVYA 1DP0A 3IAPA 1HMUA 4AQ0A 1TXKA 4BZHA 1HM2A 1L7KA 1NS7A 1F9GA 3NREA 2WW0A 1RWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TTG A;  3DYP A;  1NSU A;  1YQ2 A;  3MV0 1;  2D73 A;  3VDC A;  1MN0 A;  2Q1F A;  1N7N A;  1X1H A;  2WDA A;  4BZE A;  1W3Y A;  2JKA A;  3BGA A;  3I3E A;  1N7O A;  2CIR A;  1NSZ A;  4BZG A;  1Z45 A;  2ZXQ A;  5A1A A;  1UG9 A;  2WZS A;  3IAQ A;  1LUR A;  1JZ3 A;  2WW3 A;  1NKG A;  1CB8 A;  1SO0 A;  1NSR A;  3ECQ A;  1RWF A;  1F1S A;  1N7R A;  2BRP A;  2JKP A;  4DUV A;  2E22 A;  1HM3 A;  1MMX A;  1NS8 A;  3E1F 1;  3SEP A;  1JYN A;  3DCD A;  1N7P A;  1JZ5 A;  1JYV A;  3WFA A;  1LXM A;  1NSV A;  1JZ2 A;  2ZQ0 A;  3I3D A;  1JZ4 A;  1JZ8 A;  3NJV A;  1JYW A;  2JKE A;  1LXK A;  3VDA A;  1RWA A;  1X1I A;  2X03 A;  1NSS A;  3OS7 A;  3T08 A;  3VD9 A;  3MV1 1;  3T0B A;  3K25 A;  3OB8 A;  3VD4 A;  2BRW A;  1LF9 A;  3T0D A;  2HTA A;  1OJO A;  2CIQ A;  2WVZ A;  1NS2 A;  1RW9 A;  1F4H A;  1HN0 A;  2WW2 A;  1K1Y A;  1C82 A;  1LOH A;  1X1J A;  1JZ7 A;  1MMY A;  2XHN A;  2WCO A;  1SNZ A;  3T2Q A;  3Q1N A;  1OJM A;  1J0M A;  1ULV A;  2CIS A;  3T0A A;  1K1X A;  3MUY 1;  3VD3 A;  4RNL A;  3DYM A;  3VD5 A;  3MUZ 1;  1F4A A;  3NJX A;  2WVX B;  1MMZ A;  1PX3 A;  1HMW A;  1NS4 A;  3MWX A;  4BZF A;  2XSG A;  1L7J A;  1OJN A;  3DEC A;  1NSX A;  1LF6 A;  2WVX A;  1K1W A;  3I3B A;  1OJP A;  3T09 A;  1N7Q A;  1JYX A;  3DYO A;  1NSM A;  1MMU A;  2WW1 A;  3VDB A;  1RWC A;  5E1Q A;  1HN1 A;  2E24 A;  3IMH A;  1JZ6 A;  3T2P A;  1J0N A;  1I8Q A;  1RWG A;  3J7H A;  1YGA A;  2HTB A;  4DUW A;  3CZJ A;  3OBA A;  3A24 A;  4DUX A;  1NS0 A;  3T2O A;  1JOV A;  2BRV X;  1EGU A;  3VD7 A;  1PX4 A;  2WVY A;  1DP0 A;  3IAP A;  1HMU A;  4AQ0 A;  1TXK A;  4BZH A;  1HM2 A;  1L7K A;  1NS7 A;  1F9G A;  3NRE A;  2WW0 A;  1RWH A; 
#chains in the Genus database with same CATH topology
 2F1A A;  3DDF A;  4MMI A;  1TQW A;  1W4N A;  2EAB A;  2E2T A;  3ACS A;  3W7W A;  1N7N A;  2WDA A;  1W3Y A;  1R34 A;  1N7O A;  3D4Z A;  2W0Q A;  2ZXQ A;  2OW6 A;  3S4C A;  3IAQ A;  2FYV A;  1CB8 A;  4EV2 A;  3ACT A;  2E2U A;  4FNT A;  2CFW A;  2JKP A;  4DUV A;  4OK4 A;  2E22 A;  1MMX A;  3SEP A;  1N7P A;  1JZ5 A;  1JYV A;  3X42 A;  3HII A;  3I3D A;  2JKE A;  3VDA A;  1X1I A;  1SIH A;  2CWT A;  4FNV A;  1NSS A;  3BVV A;  3VD9 A;  3X41 A;  3AMO A;  3T0D A;  2CG0 A;  2HTA A;  1NS2 A;  3BVT A;  4BTW A;  3HI7 A;  1C82 A;  3X40 A;  3TY1 A;  3Q1N A;  3T0A A;  2PNC A;  1EKM A;  4RNL A;  3BUP A;  2F1B A;  2F7R A;  1TQS A;  2F7O A;  4MMH A;  1HMW A;  3KII A;  1NS4 A;  1LVN A;  1SII A;  1QX1 A;  3X3X A;  3X3Y A;  4FNS A;  2CG1 A;  1OJP A;  2ZL8 A;  3WIQ A;  1RWC A;  4OJZ A;  3CZN A;  3T2P A;  3QFZ A;  1RKY A;  3A24 A;  4FNU A;  2WO0 A;  2WVY A;  1DP0 A;  1TXK A;  1L7K A;  1NS7 A;  1F9G A;  4KFD A;  3NRE A;  2OOV C;  1RWH A;  2CWV A;  2YFO A;  1NSU A;  1YQ2 A;  1O7D D;  3D52 A;  2D73 A;  1V7X A;  3T0U A;  1PS3 A;  4BZE A;  2F18 A;  2JKA A;  4K35 A;  3I3E A;  2BT3 A;  3EJU A;  4BZG A;  3SX1 A;  5GW7 A;  1JZ3 A;  3AFJ A;  4UFC A;  3VSM A;  1NKG A;  2XN2 A;  1RWF A;  1QAK A;  2BRP A;  3DX0 A;  1NS8 A;  3S4B A;  3WA2 X;  5CA3 A;  3DX2 A;  1IQX A;  1AVK A;  3AMO B;  3BLB A;  4KTP A;  3NJV A;  1JZ4 A;  3D4Y A;  3W7S A;  2CQS A;  3K25 A;  3AFL A;  3VD4 A;  1OJO A;  1SPU A;  1F4H A;  1LOH A;  4KTR A;  1X1J A;  2D1W A;  2CFK A;  2WOF A;  1TU5 A;  1QAF A;  1J0M A;  3BVU A;  3MUY 1;  3DYM A;  2CFD A;  1F4A A;  1N9E A;  1IU7 A;  2XN1 A;  1IVX A;  1W2Z A;  2ALW A;  3N9H A;  3BUB A;  3KN4 A;  4KFE A;  3A0O A;  1US1 A;  2FUQ A;  1N7Q A;  3VDB A;  2Y73 A;  4FNP A;  5KBP A;  2E24 A;  3IMH A;  1J0N A;  2HTB A;  2YX9 A;  1H54 A;  1JOV A;  2CWU A;  3BS6 A;  4AQ0 A;  3X3Z A;  3W7X A;  4J5T A;  3CZS A;  1DYU A;  1QWU A;  3BVW A;  3MV0 1;  1HWW A;  3CV5 A;  3VDC A;  1W5Z A;  1MN0 A;  5JMF A;  2OQE C;  3BUI A;  3QDE A;  1V7V A;  3NBJ A;  5JMD A;  1NSZ A;  4BTY A;  1AV4 A;  1Z45 A;  4NEI A;  4KFF A;  5A1A A;  1UG9 A;  2WZS A;  1IQY A;  2FUT A;  1W6G A;  1NSR A;  1SO0 A;  2CFL A;  4BTX A;  1WMP A;  1N7R A;  1JYN A;  2OOV A;  3DCD A;  2E2V A;  3WFA A;  1LXM A;  3DX1 A;  1JZ2 A;  1JYW A;  3EJS A;  3BUQ A;  1KSI A;  3MV1 1;  4FNR A;  3E80 A;  1LF9 A;  3EJP A;  3QFY A;  1W7C A;  3BUD A;  2YFN A;  1RW9 A;  2WW2 A;  1HXK A;  1JZ7 A;  4FNQ A;  3MI6 A;  1ULV A;  1TQV A;  4EV5 A;  2CQT A;  3MUZ 1;  3NJX A;  1IVV A;  1MMZ A;  3MWX A;  2XSG A;  3DEC A;  3LOY A;  1R33 A;  2Y74 A;  2WVX A;  1K1W A;  3K5T A;  3SXX A;  1JYX A;  3S4D A;  3DYO A;  1NSM A;  1MMU A;  2WW1 A;  4K3A A;  3W7T A;  5E1Q A;  1HN1 A;  3NBB A;  1A2V A;  1TQT A;  1I8Q A;  4DUW A;  1RJO A;  1UI7 A;  2BRV X;  3DX3 A;  1HMU A;  2RDY A;  4BZH A;  1HM2 A;  1QAL A;  4TTG A;  1W6C A;  2F7P A;  3DYP A;  1PU4 A;  1OAC A;  3PGB A;  1V7W A;  2WYI A;  2Q1F A;  2CFG A;  1X1H A;  3BGA A;  2CIR A;  1TQU A;  2C11 A;  3QG0 A;  3E7J A;  2F7Q A;  1LUR A;  3VSN A;  2WW3 A;  3DDG A;  3DX4 A;  3ECQ A;  1F1S A;  3MPH A;  1HM3 A;  1WMO A;  3E1F 1;  3RRS A;  3S4A A;  1NSV A;  1JZ8 A;  2ZQ0 A;  1LXK A;  2OQE A;  1RWA A;  2XN0 A;  2X03 A;  1AVL A;  3OS7 A;  3T08 A;  2WOH A;  3OB8 A;  2BRW A;  2WYH A;  3D50 A;  2CIQ A;  2WVZ A;  2EAC A;  1HN0 A;  1D6Z A;  1QWN A;  1K1Y A;  2WGQ A;  1D6U A;  1MMY A;  2XHN A;  3WA3 A;  2WCO A;  1JRQ A;  4OK2 A;  1SNZ A;  3RSY A;  3WVF A;  3T2Q A;  1OJM A;  2CIS A;  1K1X A;  3VD3 A;  3WIR A;  3EJR A;  1UI8 A;  3VD5 A;  2WVX B;  1PX3 A;  3LVT A;  3BLC A;  4BZF A;  3EJQ A;  1L7J A;  1OJN A;  1NSX A;  1LF6 A;  1IVU A;  1IVW A;  3I3B A;  2EAD A;  3T09 A;  3HIG A;  3BVX A;  1WMN A;  2OW7 A;  3D3I A;  3ALA A;  1JZ6 A;  3W7U A;  2C10 A;  3J7H A;  1RWG A;  1YGA A;  3CZJ A;  1D6Y A;  3OBA A;  2EAE A;  4DUX A;  1NS0 A;  3EJT A;  3T2O A;  3VD7 A;  1EGU A;  1PX4 A;  1HTY A;  3D51 A;  3IAP A;  3T0B A;  2WW0 A; 
#chains in the Genus database with same CATH homology
 4TTG A;  4MMI A;  4J5T A;  3DYP A;  1NSU A;  1YQ2 A;  3MV0 1;  2D73 A;  3VDC A;  1MN0 A;  5JMF A;  2Q1F A;  1N7N A;  1X1H A;  2WDA A;  4BZE A;  1W3Y A;  2JKA A;  3BGA A;  3I3E A;  1N7O A;  2CIR A;  5JMD A;  1NSZ A;  4BZG A;  1Z45 A;  2ZXQ A;  4NEI A;  3E7J A;  1UG9 A;  2WZS A;  5A1A A;  2FUT A;  3IAQ A;  1LUR A;  1JZ3 A;  3VSN A;  2WW3 A;  3VSM A;  1NKG A;  1CB8 A;  1SO0 A;  1NSR A;  3ECQ A;  1RWF A;  1F1S A;  1N7R A;  2BRP A;  2JKP A;  4DUV A;  4OK4 A;  2E22 A;  1HM3 A;  1MMX A;  1NS8 A;  3E1F 1;  3SEP A;  1JYN A;  3DCD A;  1N7P A;  1JZ5 A;  1JYV A;  3WFA A;  1LXM A;  1NSV A;  1JZ2 A;  2ZQ0 A;  3I3D A;  1JZ4 A;  1JZ8 A;  3NJV A;  1JYW A;  2JKE A;  1LXK A;  3VDA A;  1RWA A;  1X1I A;  2X03 A;  4FNV A;  1NSS A;  3OS7 A;  3T08 A;  3VD9 A;  3MV1 1;  3T0B A;  3K25 A;  3E80 A;  3OB8 A;  3AFL A;  2BRW A;  1LF9 A;  3VD4 A;  3T0D A;  2HTA A;  1OJO A;  2CIQ A;  2WVZ A;  1NS2 A;  1RW9 A;  1F4H A;  1HN0 A;  2WW2 A;  1K1Y A;  1C82 A;  1LOH A;  1X1J A;  1JZ7 A;  1MMY A;  3TY1 A;  2XHN A;  2WCO A;  4OK2 A;  3WVF A;  1SNZ A;  3T2Q A;  3Q1N A;  1OJM A;  1J0M A;  1ULV A;  2CIS A;  3T0A A;  1K1X A;  3MUY 1;  3VD3 A;  4RNL A;  3DYM A;  3VD5 A;  3MUZ 1;  1F4A A;  3NJX A;  2WVX B;  1MMZ A;  1PX3 A;  4MMH A;  1HMW A;  1NS4 A;  3BLC A;  3MWX A;  4BZF A;  2XSG A;  1L7J A;  1OJN A;  3DEC A;  3A0O A;  1NSX A;  1LF6 A;  2WVX A;  1K1W A;  3I3B A;  1OJP A;  2FUQ A;  3T09 A;  1N7Q A;  1JYX A;  3DYO A;  1NSM A;  1MMU A;  2WW1 A;  3VDB A;  1RWC A;  4OJZ A;  1HN1 A;  5E1Q A;  2E24 A;  3IMH A;  1JZ6 A;  3T2P A;  1J0N A;  1I8Q A;  1RWG A;  3J7H A;  1YGA A;  2HTB A;  4DUW A;  3CZJ A;  3OBA A;  3A24 A;  4DUX A;  1NS0 A;  3T2O A;  1JOV A;  2BRV X;  1EGU A;  3VD7 A;  1PX4 A;  3BS6 A;  2WVY A;  1DP0 A;  3IAP A;  1HMU A;  4AQ0 A;  1TXK A;  4BZH A;  1HM2 A;  1L7K A;  1NS7 A;  1F9G A;  3NRE A;  2WW0 A;  1RWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...