2HTBA

Crystal structure of a putative mutarotase (yead) from salmonella typhimurium in monoclinic form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
296
structure length
296
Chain Sequence
b'SHMINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLWLSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFELQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGLGDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative enzyme related to aldose 1-epimerase
publication title Structure of the putative mutarotase YeaD from Salmonella typhimurium: structural comparison with galactose mutarotases.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 69
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.15: Glucose-6-phosphate 1-epimerase.
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 2htbA00
1MMXA 5A1AA 1JZ7A 3A24A 2CISA 1LXKA 4AQ0A 1JYXA 1LXMA 1K1XA 4BZHA 1RWHA 2JKEA 3VD4A 1UG9A 3T0BA 3SEPA 3MV11 1LURA 1HM2A 3VD9A 2XHNA 2ZXQA 3K25A 1JZ3A 3VD3A 1DP0A 2HTAA 3VDCA 3MWXA 4BZGA 1PX4A 2WDAA 1RWCA 1X1HA 1RW9A 4BZFA 1K1WA 1NSZA 3VD7A 2WVXB 1LOHA 1CB8A 3VDAA 4TTGA 4DUVA 1JYNA 1HMWA 3NJVA 1J0NA 2WW1A 1MMUA 1OJPA 3T2QA 1ULVA 1W3YA 3MV01 1TXKA 2BRPA 1F4HA 4BZEA 3T08A 2WVZA 3MUZ1 1K1YA 3IAQA 3I3DA 3T2PA 1X1IA 2JKAA 2CIRA 3T0DA 2E24A 2BRWA 1L7JA 1HMUA 1NS2A 1RWGA 3ECQA 1NS8A 3DYMA 1LF9A 1NSRA 1N7OA 1YQ2A 2HTBA 5E1QA 1OJNA 3IMHA 3DYOA 3I3EA 3OS7A 3E1F1 1HN1A 2D73A 1NSUA 1LF6A 1C82A 4RNLA 1NSXA 1NS7A 1NSSA 1JZ4A 1SO0A 1F4AA 1N7NA 3T0AA 2XSGA 3VDBA 1HM3A 3OB8A 1JYWA 2ZQ0A 1N7PA 1MMZA 3MUY1 2WW0A 2CIQA 3T09A 1Z45A 2WW3A 3NREA 1J0MA 1HN0A 2WVYA 2Q1FA 1N7QA 3WFAA 1JOVA 2WCOA 2JKPA 2WVXA 1F1SA 2WW2A 3T2OA 3CZJA 3DECA 1L7KA 1PX3A 1NSMA 3IAPA 3Q1NA 1JZ2A 1SNZA 2X03A 1RWFA 1JZ6A 1JZ8A 3NJXA 1JZ5A 1N7RA 3J7HA 1JYVA 1NS0A 1MMYA 1NSVA 3I3BA 1I8QA 1X1JA 2WZSA 4DUXA 3OBAA 1RWAA 2BRVX 1OJOA 1NS4A 2E22A 1F9GA 1YGAA 3BGAA 1OJMA 1EGUA 4DUWA 3DCDA 1NKGA 3VD5A 1MN0A 3DYPA
chains in the Genus database with same CATH superfamily
3A24A 2CISA 1R34A 3AMOA 3E7JA 2CFKA 4K35A 1UG9A 1AV4A 1LURA 1HM2A 3BLCA 1RJOA 3HIIA 1JZ3A 3VD3A 3HIGA 2F18A 4BZGA 2CFGA 4OK2A 1RW9A 2CFLA 3DX2A 1WMNA 2C11A 1W4NA 3NJVA 1DYUA 3EJQA 1MMUA 1OJPA 2E2UA 3ACTA 3MPHA 1IVXA 3KN4A 2CG0A 3AFLA 1QWUA 1X1IA 3A0OA 3CZNA 2EACA 4MMIA 2OOVA 2WO0A 2BRWA 1HMUA 1NS2A 1TQSA 1SPUA 1NS8A 1OACA 1YQ2A 3IMHA 3DYOA 3E1F1 4FNSA 2Y74A 1LF6A 1NSXA 1D6YA 1NS7A 5CA3A 1UI8A 2YFNA 3T0AA 3VDBA 1WMPA 2ZQ0A 2ALWA 2FUTA 2WW0A 2WOFA 3E80A 1W7CA 3NREA 1W2ZA 3HI7A 3LOYA 2CFDA 4FNPA 1H54A 3CZSA 3VSMA 3KIIA 3VSNA 1L7KA 2F7QA 3WVFA 1N9EA 1JZ2A 2CWVA 3BUDA 1JZ8A 3SX1A 3J7HA 3N9HA 1JYVA 3BVXA 3TY1A 3X42A 4MMHA 4DUXA 1QWNA 1YGAA 3DX1A 3S4AA 4FNTA 3BS6A 1D6ZA 4KFDA 3CV5A 4AQ0A 1JZ7A 1TQTA 1W6GA 3D4YA 1JYXA 1K1XA 3S4BA 3VD4A 1WMOA 2XHNA 2ZXQA 3RSYA 3VDCA 4FNRA 4KFEA 3LVTA 1PX4A 1HTYA 3VD7A 2WVXB 4TTGA 2RDYA 4DUVA 1HMWA 2FUQA 1J0NA 3BUIA 2WW1A 1AVKA 3MV01 3NBBA 2CG1A 4BZEA 1JRQA 3T08A 1US1A 3MUZ1 4KFFA 5JMFA 2OQEA 2E24A 2Y73A 4BTWA 3D51A 2XN1A 3DX3A 3ECQA 3K5TA 1IVWA 1LF9A 1NSRA 1N7OA 2HTBA 5E1QA 3EJRA 3OS7A 2E2VA 1HN1A 3ALAA 4EV2A 1C82A 1TQUA 1RKYA 1JZ4A 1F4AA 1IQYA 1HM3A 1JYWA 3D4ZA 1N7PA 1PU4A 1MMZA 2F7PA 3BVWA 3W7SA 1HXKA 2WVYA 3WIRA 3EJSA 1JOVA 2E2TA 1O7DD 5KBPA 2CQSA 2WVXA 1A2VA 3DECA 1IU7A 3WA2X 3IAPA 4FNQA 4J5TA 1SNZA 2X03A 3BLBA 1JZ6A 3NJXA 1N7RA 1NS0A 1I8QA 1W6CA 1X1JA 2WZSA 1NS4A 3EJTA 3DCDA 3QFYA 3VD5A 3D50A 4KTRA 5A1AA 2F7RA 3ACSA 1RWHA 3DX4A 3SEPA 3VD9A 2CWUA 2EABA 1DP0A 2WDAA 1X1HA 1K1WA 1NSZA 1LOHA 1CB8A 3VDAA 3D3IA 1IVUA 4EV5A 1JYNA 2CFWA 3QDEA 3T2QA 2F7OA 2BRPA 4K3AA 3S4DA 1K1YA 2EAEA 3S4CA 3BUBA 1TU5A 2C10A 2WGQA 2CIRA 3T0DA 2D1WA 1D6UA 2OW6A 1L7JA 3AFJA 3QFZA 1OJNA 1V7WA 3EJUA 2D73A 3DX0A 1NSUA 4RNLA 3D52A 4BTXA 3DDFA 2XSGA 3WIQA 3BVTA 1V7XA 2CIQA 1Z45A 3BUPA 2WYHA 3BVUA 1HN0A 2Q1FA 2F1BA 1N7QA 1QX1A 3T0UA 3X41A 2WCOA 3RRSA 3DDGA 1F1SA 2WW2A 3T2OA 3CZJA 4OJZA 2OOVC 1KSIA 3SXXA 3Q1NA 1UI7A 4KTPA 3W7XA 1RWFA 2XN0A 3PGBA 3X40A 1NSVA 3I3BA 3OBAA 1RWAA 2BRVX 1OJOA 2E22A 1F9GA 3BUQA 3BVVA 1EGUA 1AVLA 1SIIA 1MN0A 1MMXA 5GW7A 1LXKA 1LXMA 2WYIA 4BZHA 2JKEA 1V7VA 1PS3A 1QAKA 3T0BA 3MV11 1TQVA 3K25A 3X3XA 3X3ZA 2HTAA 2W0QA 3MWXA 1RWCA 3X3YA 4BZFA 2BT3A 2YX9A 1ULVA 1W3YA 1TXKA 1F4HA 2WVZA 3IAQA 3I3DA 3QG0A 3T2PA 2JKAA 4BTYA 3W7WA 4UFCA 1RWGA 3W7UA 1SIHA 3WA3A 2ZL8A 1LVNA 2F1AA 3DYMA 3I3EA 3MI6A 1QAFA 1EKMA 3AMOB 2XN2A 1QALA 1NSSA 2PNCA 1IQXA 1SO0A 1N7NA 3W7TA 3OB8A 4FNUA 1HWWA 2FYVA 3MUY1 1IVVA 2OW7A 3T09A 2WW3A 2CQTA 1J0MA 5JMDA 3EJPA 1W5ZA 4FNVA 3WFAA 2JKPA 4NEIA 1TQWA 2OQEC 2WOHA 1PX3A 1NSMA 4OK4A 3NBJA 1JZ5A 2CWTA 1MMYA 2YFOA 3BGAA 1OJMA 1R33A 4DUWA 2EADA 1NKGA 3DYPA
chains in the Genus database with same CATH topology
1MMXA 5A1AA 1JZ7A 3A24A 2CISA 1LXKA 4AQ0A 1JYXA 1LXMA 1K1XA 3E7JA 4BZHA 1RWHA 2JKEA 3VD4A 1UG9A 3T0BA 3SEPA 3MV11 1LURA 1HM2A 3VD9A 2XHNA 3BLCA 2ZXQA 3K25A 1JZ3A 3VD3A 1DP0A 2HTAA 3VDCA 3MWXA 4BZGA 1PX4A 2WDAA 1RWCA 1X1HA 4OK2A 1RW9A 4BZFA 1K1WA 1NSZA 3VD7A 2WVXB 1LOHA 1CB8A 3VDAA 4TTGA 4DUVA 1JYNA 1HMWA 3NJVA 2FUQA 1J0NA 2WW1A 1MMUA 1OJPA 3T2QA 1ULVA 1W3YA 3MV01 1TXKA 2BRPA 1F4HA 4BZEA 3T08A 2WVZA 3MUZ1 3AFLA 1K1YA 5JMFA 3IAQA 3I3DA 3T2PA 1X1IA 2JKAA 3A0OA 2CIRA 4MMIA 3T0DA 2E24A 2BRWA 1L7JA 1HMUA 1NS2A 1RWGA 3ECQA 1NS8A 3DYMA 1LF9A 1NSRA 1N7OA 1YQ2A 2HTBA 5E1QA 1OJNA 3IMHA 3DYOA 3I3EA 3OS7A 3E1F1 1HN1A 2D73A 1NSUA 1LF6A 1C82A 4RNLA 1NSXA 1NS7A 1NSSA 1JZ4A 1SO0A 1F4AA 1N7NA 3T0AA 2XSGA 3VDBA 1HM3A 3OB8A 1JYWA 2ZQ0A 1N7PA 2FUTA 1MMZA 3MUY1 2WW0A 2CIQA 3T09A 1Z45A 3E80A 2WW3A 3NREA 1J0MA 5JMDA 1HN0A 2WVYA 2Q1FA 3VSMA 1N7QA 4FNVA 3VSNA 1JOVA 2WCOA 2JKPA 3WFAA 4NEIA 2WVXA 1F1SA 2WW2A 3T2OA 3CZJA 4OJZA 3DECA 1L7KA 1PX3A 1NSMA 3IAPA 4OK4A 3Q1NA 3WVFA 4J5TA 1JZ2A 1SNZA 2X03A 1RWFA 1JZ6A 1JZ8A 3NJXA 1JZ5A 1N7RA 3J7HA 1JYVA 1NS0A 3TY1A 1MMYA 1NSVA 3I3BA 1I8QA 1X1JA 2WZSA 4MMHA 4DUXA 3OBAA 1RWAA 2BRVX 1OJOA 1NS4A 2E22A 1F9GA 1YGAA 3BGAA 1OJMA 1EGUA 4DUWA 3DCDA 3BS6A 1NKGA 3VD5A 1MN0A 3DYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMX A;  5A1A A;  1JZ7 A;  3A24 A;  2CIS A;  1LXK A;  4AQ0 A;  1JYX A;  1LXM A;  1K1X A;  4BZH A;  1RWH A;  2JKE A;  3VD4 A;  1UG9 A;  3T0B A;  3SEP A;  3MV1 1;  1LUR A;  1HM2 A;  3VD9 A;  2XHN A;  2ZXQ A;  3K25 A;  1JZ3 A;  3VD3 A;  1DP0 A;  2HTA A;  3VDC A;  3MWX A;  4BZG A;  1PX4 A;  2WDA A;  1RWC A;  1X1H A;  1RW9 A;  4BZF A;  1K1W A;  1NSZ A;  3VD7 A;  2WVX B;  1LOH A;  1CB8 A;  3VDA A;  4TTG A;  4DUV A;  1JYN A;  1HMW A;  3NJV A;  1J0N A;  2WW1 A;  1MMU A;  1OJP A;  3T2Q A;  1ULV A;  1W3Y A;  3MV0 1;  1TXK A;  2BRP A;  1F4H A;  4BZE A;  3T08 A;  2WVZ A;  3MUZ 1;  1K1Y A;  3IAQ A;  3I3D A;  3T2P A;  1X1I A;  2JKA A;  2CIR A;  3T0D A;  2E24 A;  2BRW A;  1L7J A;  1HMU A;  1NS2 A;  1RWG A;  3ECQ A;  1NS8 A;  3DYM A;  1LF9 A;  1NSR A;  1N7O A;  1YQ2 A;  2HTB A;  5E1Q A;  1OJN A;  3IMH A;  3DYO A;  3I3E A;  3OS7 A;  3E1F 1;  1HN1 A;  2D73 A;  1NSU A;  1LF6 A;  1C82 A;  4RNL A;  1NSX A;  1NS7 A;  1NSS A;  1JZ4 A;  1SO0 A;  1F4A A;  1N7N A;  3T0A A;  2XSG A;  3VDB A;  1HM3 A;  3OB8 A;  1JYW A;  2ZQ0 A;  1N7P A;  1MMZ A;  3MUY 1;  2WW0 A;  2CIQ A;  3T09 A;  1Z45 A;  2WW3 A;  3NRE A;  1J0M A;  1HN0 A;  2WVY A;  2Q1F A;  1N7Q A;  3WFA A;  1JOV A;  2WCO A;  2JKP A;  2WVX A;  1F1S A;  2WW2 A;  3T2O A;  3CZJ A;  3DEC A;  1L7K A;  1PX3 A;  1NSM A;  3IAP A;  3Q1N A;  1JZ2 A;  1SNZ A;  2X03 A;  1RWF A;  1JZ6 A;  1JZ8 A;  3NJX A;  1JZ5 A;  1N7R A;  3J7H A;  1JYV A;  1NS0 A;  1MMY A;  1NSV A;  3I3B A;  1I8Q A;  1X1J A;  2WZS A;  4DUX A;  3OBA A;  1RWA A;  2BRV X;  1OJO A;  1NS4 A;  2E22 A;  1F9G A;  1YGA A;  3BGA A;  1OJM A;  1EGU A;  4DUW A;  3DCD A;  1NKG A;  3VD5 A;  1MN0 A;  3DYP A; 
#chains in the Genus database with same CATH topology
 3A24 A;  2CIS A;  1R34 A;  3AMO A;  3E7J A;  2CFK A;  4K35 A;  1UG9 A;  1AV4 A;  1LUR A;  1HM2 A;  3BLC A;  1RJO A;  3HII A;  1JZ3 A;  3VD3 A;  3HIG A;  2F18 A;  4BZG A;  2CFG A;  4OK2 A;  1RW9 A;  2CFL A;  3DX2 A;  1WMN A;  2C11 A;  1W4N A;  3NJV A;  1DYU A;  3EJQ A;  1MMU A;  1OJP A;  2E2U A;  3ACT A;  3MPH A;  1IVX A;  3KN4 A;  2CG0 A;  3AFL A;  1QWU A;  1X1I A;  3A0O A;  3CZN A;  2EAC A;  4MMI A;  2OOV A;  2WO0 A;  2BRW A;  1HMU A;  1NS2 A;  1TQS A;  1SPU A;  1NS8 A;  1OAC A;  1YQ2 A;  3IMH A;  3DYO A;  3E1F 1;  4FNS A;  2Y74 A;  1LF6 A;  1NSX A;  1D6Y A;  1NS7 A;  5CA3 A;  1UI8 A;  2YFN A;  3T0A A;  3VDB A;  1WMP A;  2ZQ0 A;  2ALW A;  2FUT A;  2WW0 A;  2WOF A;  3E80 A;  1W7C A;  3NRE A;  1W2Z A;  3HI7 A;  3LOY A;  2CFD A;  4FNP A;  1H54 A;  3CZS A;  3VSM A;  3KII A;  3VSN A;  1L7K A;  2F7Q A;  3WVF A;  1N9E A;  1JZ2 A;  2CWV A;  3BUD A;  1JZ8 A;  3SX1 A;  3J7H A;  3N9H A;  1JYV A;  3BVX A;  3TY1 A;  3X42 A;  4MMH A;  4DUX A;  1QWN A;  1YGA A;  3DX1 A;  3S4A A;  4FNT A;  3BS6 A;  1D6Z A;  4KFD A;  3CV5 A;  4AQ0 A;  1JZ7 A;  1TQT A;  1W6G A;  3D4Y A;  1JYX A;  1K1X A;  3S4B A;  3VD4 A;  1WMO A;  2XHN A;  2ZXQ A;  3RSY A;  3VDC A;  4FNR A;  4KFE A;  3LVT A;  1PX4 A;  1HTY A;  3VD7 A;  2WVX B;  4TTG A;  2RDY A;  4DUV A;  1HMW A;  2FUQ A;  1J0N A;  3BUI A;  2WW1 A;  1AVK A;  3MV0 1;  3NBB A;  2CG1 A;  4BZE A;  1JRQ A;  3T08 A;  1US1 A;  3MUZ 1;  4KFF A;  5JMF A;  2OQE A;  2E24 A;  2Y73 A;  4BTW A;  3D51 A;  2XN1 A;  3DX3 A;  3ECQ A;  3K5T A;  1IVW A;  1LF9 A;  1NSR A;  1N7O A;  2HTB A;  5E1Q A;  3EJR A;  3OS7 A;  2E2V A;  1HN1 A;  3ALA A;  4EV2 A;  1C82 A;  1TQU A;  1RKY A;  1JZ4 A;  1F4A A;  1IQY A;  1HM3 A;  1JYW A;  3D4Z A;  1N7P A;  1PU4 A;  1MMZ A;  2F7P A;  3BVW A;  3W7S A;  1HXK A;  2WVY A;  3WIR A;  3EJS A;  1JOV A;  2E2T A;  1O7D D;  5KBP A;  2CQS A;  2WVX A;  1A2V A;  3DEC A;  1IU7 A;  3WA2 X;  3IAP A;  4FNQ A;  4J5T A;  1SNZ A;  2X03 A;  3BLB A;  1JZ6 A;  3NJX A;  1N7R A;  1NS0 A;  1I8Q A;  1W6C A;  1X1J A;  2WZS A;  1NS4 A;  3EJT A;  3DCD A;  3QFY A;  3VD5 A;  3D50 A;  4KTR A;  5A1A A;  2F7R A;  3ACS A;  1RWH A;  3DX4 A;  3SEP A;  3VD9 A;  2CWU A;  2EAB A;  1DP0 A;  2WDA A;  1X1H A;  1K1W A;  1NSZ A;  1LOH A;  1CB8 A;  3VDA A;  3D3I A;  1IVU A;  4EV5 A;  1JYN A;  2CFW A;  3QDE A;  3T2Q A;  2F7O A;  2BRP A;  4K3A A;  3S4D A;  1K1Y A;  2EAE A;  3S4C A;  3BUB A;  1TU5 A;  2C10 A;  2WGQ A;  2CIR A;  3T0D A;  2D1W A;  1D6U A;  2OW6 A;  1L7J A;  3AFJ A;  3QFZ A;  1OJN A;  1V7W A;  3EJU A;  2D73 A;  3DX0 A;  1NSU A;  4RNL A;  3D52 A;  4BTX A;  3DDF A;  2XSG A;  3WIQ A;  3BVT A;  1V7X A;  2CIQ A;  1Z45 A;  3BUP A;  2WYH A;  3BVU A;  1HN0 A;  2Q1F A;  2F1B A;  1N7Q A;  1QX1 A;  3T0U A;  3X41 A;  2WCO A;  3RRS A;  3DDG A;  1F1S A;  2WW2 A;  3T2O A;  3CZJ A;  4OJZ A;  2OOV C;  1KSI A;  3SXX A;  3Q1N A;  1UI7 A;  4KTP A;  3W7X A;  1RWF A;  2XN0 A;  3PGB A;  3X40 A;  1NSV A;  3I3B A;  3OBA A;  1RWA A;  2BRV X;  1OJO A;  2E22 A;  1F9G A;  3BUQ A;  3BVV A;  1EGU A;  1AVL A;  1SII A;  1MN0 A;  1MMX A;  5GW7 A;  1LXK A;  1LXM A;  2WYI A;  4BZH A;  2JKE A;  1V7V A;  1PS3 A;  1QAK A;  3T0B A;  3MV1 1;  1TQV A;  3K25 A;  3X3X A;  3X3Z A;  2HTA A;  2W0Q A;  3MWX A;  1RWC A;  3X3Y A;  4BZF A;  2BT3 A;  2YX9 A;  1ULV A;  1W3Y A;  1TXK A;  1F4H A;  2WVZ A;  3IAQ A;  3I3D A;  3QG0 A;  3T2P A;  2JKA A;  4BTY A;  3W7W A;  4UFC A;  1RWG A;  3W7U A;  1SIH A;  3WA3 A;  2ZL8 A;  1LVN A;  2F1A A;  3DYM A;  3I3E A;  3MI6 A;  1QAF A;  1EKM A;  3AMO B;  2XN2 A;  1QAL A;  1NSS A;  2PNC A;  1IQX A;  1SO0 A;  1N7N A;  3W7T A;  3OB8 A;  4FNU A;  1HWW A;  2FYV A;  3MUY 1;  1IVV A;  2OW7 A;  3T09 A;  2WW3 A;  2CQT A;  1J0M A;  5JMD A;  3EJP A;  1W5Z A;  4FNV A;  3WFA A;  2JKP A;  4NEI A;  1TQW A;  2OQE C;  2WOH A;  1PX3 A;  1NSM A;  4OK4 A;  3NBJ A;  1JZ5 A;  2CWT A;  1MMY A;  2YFO A;  3BGA A;  1OJM A;  1R33 A;  4DUW A;  2EAD A;  1NKG A;  3DYP A; 
#chains in the Genus database with same CATH homology
 1MMX A;  5A1A A;  1JZ7 A;  3A24 A;  2CIS A;  1LXK A;  4AQ0 A;  1JYX A;  1LXM A;  1K1X A;  3E7J A;  4BZH A;  1RWH A;  2JKE A;  3VD4 A;  1UG9 A;  3T0B A;  3SEP A;  3MV1 1;  1LUR A;  1HM2 A;  3VD9 A;  2XHN A;  3BLC A;  2ZXQ A;  3K25 A;  1JZ3 A;  3VD3 A;  1DP0 A;  2HTA A;  3VDC A;  3MWX A;  4BZG A;  1PX4 A;  2WDA A;  1RWC A;  1X1H A;  4OK2 A;  1RW9 A;  4BZF A;  1K1W A;  1NSZ A;  3VD7 A;  2WVX B;  1LOH A;  1CB8 A;  3VDA A;  4TTG A;  4DUV A;  1JYN A;  1HMW A;  3NJV A;  2FUQ A;  1J0N A;  2WW1 A;  1MMU A;  1OJP A;  3T2Q A;  1ULV A;  1W3Y A;  3MV0 1;  1TXK A;  2BRP A;  1F4H A;  4BZE A;  3T08 A;  2WVZ A;  3MUZ 1;  3AFL A;  1K1Y A;  5JMF A;  3IAQ A;  3I3D A;  3T2P A;  1X1I A;  2JKA A;  3A0O A;  2CIR A;  4MMI A;  3T0D A;  2E24 A;  2BRW A;  1L7J A;  1HMU A;  1NS2 A;  1RWG A;  3ECQ A;  1NS8 A;  3DYM A;  1LF9 A;  1NSR A;  1N7O A;  1YQ2 A;  2HTB A;  5E1Q A;  1OJN A;  3IMH A;  3DYO A;  3I3E A;  3OS7 A;  3E1F 1;  1HN1 A;  2D73 A;  1NSU A;  1LF6 A;  1C82 A;  4RNL A;  1NSX A;  1NS7 A;  1NSS A;  1JZ4 A;  1SO0 A;  1F4A A;  1N7N A;  3T0A A;  2XSG A;  3VDB A;  1HM3 A;  3OB8 A;  1JYW A;  2ZQ0 A;  1N7P A;  2FUT A;  1MMZ A;  3MUY 1;  2WW0 A;  2CIQ A;  3T09 A;  1Z45 A;  3E80 A;  2WW3 A;  3NRE A;  1J0M A;  5JMD A;  1HN0 A;  2WVY A;  2Q1F A;  3VSM A;  1N7Q A;  4FNV A;  3VSN A;  1JOV A;  2WCO A;  2JKP A;  3WFA A;  4NEI A;  2WVX A;  1F1S A;  2WW2 A;  3T2O A;  3CZJ A;  4OJZ A;  3DEC A;  1L7K A;  1PX3 A;  1NSM A;  3IAP A;  4OK4 A;  3Q1N A;  3WVF A;  4J5T A;  1JZ2 A;  1SNZ A;  2X03 A;  1RWF A;  1JZ6 A;  1JZ8 A;  3NJX A;  1JZ5 A;  1N7R A;  3J7H A;  1JYV A;  1NS0 A;  3TY1 A;  1MMY A;  1NSV A;  3I3B A;  1I8Q A;  1X1J A;  2WZS A;  4MMH A;  4DUX A;  3OBA A;  1RWA A;  2BRV X;  1OJO A;  1NS4 A;  2E22 A;  1F9G A;  1YGA A;  3BGA A;  1OJM A;  1EGU A;  4DUW A;  3DCD A;  3BS6 A;  1NKG A;  3VD5 A;  1MN0 A;  3DYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...