1NSUA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLNGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsuA00
1MMUA 1NS7A 3VD9A 1J0MA 3I3EA 3T0DA 1NS8A 1HMUA 2WVYA 3VD7A 1PX4A 3VDBA 1K1WA 3E1F1 1F9GA 1F1SA 1HM3A 2E22A 1NKGA 2WDAA 1ULVA 1J0NA 3NREA 2WVXB 2XSGA 3K25A 3OBAA 3DYOA 2CIQA 3I3DA 1HN0A 1L7KA 1DP0A 1SNZA 3MWXA 2CISA 1JZ6A 1N7OA 1JZ5A 3IMHA 3DYMA 3ECQA 1LOHA 1PX3A 3VD3A 2E24A 2D73A 1SO0A 1MMZA 1JOVA 2HTAA 4BZFA 2WVXA 1RWCA 1LURA 1NS2A 3Q1NA 1NS4A 1HMWA 4AQ0A 5A1AA 2WZSA 2XHNA 1NSXA 1N7NA 3DECA 3MV11 3OB8A 2ZQ0A 1TXKA 1W3YA 4DUXA 1LF6A 3VDCA 5E1QA 3T2PA 2Q1FA 3NJXA 3MV01 1OJNA 1JYVA 1N7QA 3DYPA 1JZ3A 3J7HA 1RWFA 2WW1A 3VD4A 1MN0A 1CB8A 3MUZ1 3SEPA 1K1YA 3T2OA 1JYWA 1JYXA 1NSZA 1RW9A 2CIRA 4RNLA 1YQ2A 1F4AA 1I8QA 4BZGA 1F4HA 3T09A 4DUVA 2WW0A 1MMYA 1NSSA 1OJPA 3I3BA 1Z45A 1HM2A 1JZ2A 3IAQA 1JZ7A 4BZHA 1MMXA 3T0BA 2JKPA 2X03A 3T2QA 1JZ4A 1C82A 1N7PA 2BRWA 1YGAA 1L7JA 1RWGA 1X1IA 2WCOA 3DCDA 1NSMA 2WVZA 1K1XA 4TTGA 1OJMA 2JKEA 1LXKA 3VDAA 1UG9A 1LF9A 2WW2A 2ZXQA 3NJVA 3BGAA 1JZ8A 3OS7A 3CZJA 1X1HA 1NSRA 1NSUA 1NS0A 1HN1A 1LXMA 1N7RA 1EGUA 1OJOA 1X1JA 2BRVX 3WFAA 1RWAA 4DUWA 3T08A 3MUY1 1JYNA 3IAPA 2WW3A 2HTBA 2JKAA 3T0AA 1RWHA 3VD5A 2BRPA 4BZEA 3A24A 1NSVA
chains in the Genus database with same CATH superfamily
1NS7A 2XN2A 2EACA 5KBPA 3VDBA 1PU4A 1K1WA 3S4AA 1F1SA 1IVVA 1HM3A 2E22A 3LVTA 2WYIA 3D52A 3NREA 3W7XA 3K25A 3DYOA 2CIQA 2OQEA 1HN0A 2EADA 4KFDA 2CISA 1N7OA 4OJZA 3ECQA 1PX3A 3VD3A 2Y74A 2YX9A 2HTAA 1RWCA 3MPHA 1LURA 2E2VA 2WZSA 3X42A 3WIQA 3S4DA 1N7NA 2YFOA 2ZQ0A 1TXKA 1WMPA 3BLCA 1JYVA 5E1QA 1LF6A 3MV01 2CWVA 1N7QA 2CFWA 1JZ3A 3J7HA 1RWFA 3BVTA 1JYXA 1NSZA 3NBBA 2CIRA 2YFNA 1O7DD 1YQ2A 1I8QA 4FNUA 2WW0A 2F7RA 3D4ZA 2CQTA 1Z45A 1JZ2A 1C82A 2BRWA 1RWGA 1X1IA 3DCDA 3X40A 2JKEA 3N9HA 4FNVA 2WOHA 1D6UA 1OACA 2RDYA 1LF9A 3BGAA 4OK4A 1NSRA 1HTYA 1NS0A 1JRQA 1N7RA 2BRVX 1IVWA 2FUQA 2CG0A 1RWAA 2D1WA 3CZNA 3BVUA 1W7CA 3VD5A 1RKYA 3WA3A 1V7WA 2CFGA 3E7JA 1MMUA 2EAEA 3I3EA 3T0DA 2WOFA 3EJRA 2WO0A 2FYVA 1HXKA 3W7WA 1AVLA 3BUIA 4MMHA 3MI6A 3AMOB 1D6YA 1R33A 1IU7A 3CV5A 3W7TA 3I3DA 1W6GA 1JZ6A 3WVFA 1JZ5A 4FNRA 3RSYA 3W7SA 2EABA 1MMZA 1JOVA 4BZFA 2WVXA 1NS2A 3Q1NA 1NS4A 2CFLA 1QX1A 3VSNA 4AQ0A 3X3YA 1NSXA 3HIGA 1V7VA 3D51A 3BS6A 2F1AA 3QFZA 3VDCA 3NJXA 3BUBA 2F7OA 5JMFA 3QFYA 1MN0A 3T2OA 1TQVA 1W6CA 1SPUA 4KTPA 1QALA 5CA3A 1OJPA 4FNPA 3IAQA 4BZHA 2BT3A 4J5TA 1N7PA 2CWTA 1NSMA 2WGQA 3QG0A 2FUTA 3DX2A 1LXKA 1UG9A 1TU5A 2ZXQA 3T0UA 1QWNA 1V7XA 3W7UA 3OS7A 1X1HA 4NEIA 1LXMA 1EGUA 1OJOA 1QWUA 1X1JA 1US1A 3MUY1 1AVKA 3T0AA 1RWHA 2BRPA 3HIIA 1W5ZA 4BZEA 2Y73A 3A24A 1NSVA 4K35A 1QAFA 1W2ZA 2OW6A 1J0MA 3VD9A 2F7PA 1NS8A 1HMUA 2F1BA 3VD7A 1PX4A 2XN1A 2WDAA 1ULVA 1J0NA 3X3XA 3WA2X 1HWWA 1L7KA 2E2TA 3IMHA 3DYMA 1LOHA 2E24A 1SO0A 2W0QA 1IQYA 4K3AA 4FNTA 2CWUA 3BUPA 4OK2A 4KFEA 5A1AA 2XHNA 2CFDA 1LVNA 2OOVC 3OB8A 3DDGA 2E2UA 1W3YA 3ACTA 1IVUA 4BTXA 4DUXA 2F18A 4KTRA 1OJNA 3DYPA 1TQTA 2WW1A 4RNLA 1RW9A 1WMOA 3KIIA 3EJTA 2OW7A 1AV4A 1F4AA 1WMNA 4BZGA 1F4HA 1MMYA 1NSSA 3I3BA 3EJQA 1HM2A 1TQSA 4EV2A 3T2QA 1JZ4A 1PS3A 1L7JA 2WCOA 2OOVA 3HI7A 3BLBA 3WIRA 3X3ZA 2WW2A 2C11A 3BVWA 1JZ8A 3CZJA 1NSUA 1KSIA 3KN4A 1SIHA 4DUWA 3PGBA 3T08A 1JYNA 3ALAA 3IAPA 1W4NA 2CFKA 2XN0A 3AFJA 2HTBA 2JKAA 2ALWA 4FNQA 4UFCA 1RJOA 3AFLA 3SXXA 2WVYA 3E1F1 1F9GA 3LOYA 3X41A 4MMIA 1NKGA 3VSMA 3EJUA 3E80A 2WVXB 2XSGA 3OBAA 3DX0A 1DP0A 1SNZA 3MWXA 3D50A 2D73A 3TY1A 3AMOA 3ACSA 4KFFA 1TQWA 4BTWA 3SX1A 1D6ZA 3EJSA 3DX4A 1IQXA 4FNSA 1HMWA 3BUQA 1IVXA 3DECA 1H54A 3MV11 3S4BA 3BUDA 2CG1A 3CZSA 2Q1FA 3T2PA 1R34A 3VD4A 1CB8A 3MUZ1 3SEPA 1K1YA 1JYWA 2ZL8A 1QAKA 3NBJA 3DDFA 4BTYA 3T09A 4DUVA 5GW7A 1JZ7A 3D4YA 1SIIA 2PNCA 1UI7A 2WYHA 1MMXA 2F7QA 3BVVA 3T0BA 2JKPA 2X03A 1YGAA 3DX3A 2CQSA 2WVZA 1TQUA 1K1XA 4TTGA 1OJMA 1N9EA 3RRSA 3DX1A 3VDAA 5JMDA 1UI8A 3BVXA 3NJVA 1DYUA 2C10A 1HN1A 3EJPA 3D3IA 3A0OA 3WFAA 4EV5A 3S4CA 3K5TA 2WW3A 2OQEC 3QDEA 1A2VA 1EKMA
chains in the Genus database with same CATH topology
3AFLA 1MMUA 1LF6A 1NS7A 3VD9A 1J0MA 3I3EA 3T0DA 1NS8A 1HMUA 2WVYA 3VD7A 1PX4A 3VDBA 1K1WA 3E1F1 1F9GA 1F1SA 1HM3A 4MMIA 2E22A 1NKGA 2WDAA 4MMHA 1ULVA 3VSMA 1J0NA 3E80A 3NREA 2WVXB 2XSGA 3K25A 3OBAA 3DYOA 2CIQA 3I3DA 1HN0A 1L7KA 1DP0A 1SNZA 3MWXA 2CISA 1JZ6A 3WVFA 1N7OA 4OJZA 1JZ5A 3IMHA 3DYMA 3ECQA 1LOHA 1PX3A 3VD3A 2E24A 2D73A 3TY1A 1SO0A 1MMZA 1JOVA 2HTAA 4BZFA 2WVXA 1RWCA 1LURA 1NS2A 3Q1NA 1NS4A 4OK2A 3VSNA 1HMWA 4AQ0A 5A1AA 2WZSA 2XHNA 1NSXA 1N7NA 3DECA 3MV11 3OB8A 2ZQ0A 1TXKA 1W3YA 3BS6A 4DUXA 3BLCA 3VDCA 5E1QA 3T2PA 2Q1FA 3NJXA 3MV01 1OJNA 1JYVA 1N7QA 3DYPA 1JZ3A 5JMFA 3J7HA 1RWFA 2WW1A 3VD4A 1MN0A 1CB8A 3MUZ1 3SEPA 1K1YA 3T2OA 1JYWA 1JYXA 1NSZA 1RW9A 2CIRA 4RNLA 1YQ2A 1F4AA 1I8QA 4BZGA 1F4HA 3T09A 4DUVA 2WW0A 1MMYA 1NSSA 1OJPA 3I3BA 1Z45A 1HM2A 1JZ2A 3IAQA 1JZ7A 4BZHA 1MMXA 3T0BA 2JKPA 2X03A 3T2QA 4J5TA 1C82A 1N7PA 2BRWA 1JZ4A 1YGAA 1L7JA 1RWGA 1X1IA 2WCOA 3DCDA 1NSMA 2WVZA 1K1XA 4TTGA 1OJMA 2JKEA 4FNVA 2FUTA 1LXKA 3VDAA 1UG9A 1LF9A 2WW2A 2ZXQA 5JMDA 3NJVA 3BGAA 4OK4A 1JZ8A 3OS7A 3CZJA 1X1HA 1NSRA 1NSUA 4NEIA 1NS0A 1HN1A 1LXMA 1N7RA 1EGUA 1OJOA 1X1JA 2BRVX 2FUQA 3A0OA 3WFAA 1RWAA 4DUWA 3T08A 3MUY1 1JYNA 3IAPA 2WW3A 2HTBA 2JKAA 3T0AA 1RWHA 3VD5A 2BRPA 4BZEA 3A24A 3E7JA 1NSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMU A;  1NS7 A;  3VD9 A;  1J0M A;  3I3E A;  3T0D A;  1NS8 A;  1HMU A;  2WVY A;  3VD7 A;  1PX4 A;  3VDB A;  1K1W A;  3E1F 1;  1F9G A;  1F1S A;  1HM3 A;  2E22 A;  1NKG A;  2WDA A;  1ULV A;  1J0N A;  3NRE A;  2WVX B;  2XSG A;  3K25 A;  3OBA A;  3DYO A;  2CIQ A;  3I3D A;  1HN0 A;  1L7K A;  1DP0 A;  1SNZ A;  3MWX A;  2CIS A;  1JZ6 A;  1N7O A;  1JZ5 A;  3IMH A;  3DYM A;  3ECQ A;  1LOH A;  1PX3 A;  3VD3 A;  2E24 A;  2D73 A;  1SO0 A;  1MMZ A;  1JOV A;  2HTA A;  4BZF A;  2WVX A;  1RWC A;  1LUR A;  1NS2 A;  3Q1N A;  1NS4 A;  1HMW A;  4AQ0 A;  5A1A A;  2WZS A;  2XHN A;  1NSX A;  1N7N A;  3DEC A;  3MV1 1;  3OB8 A;  2ZQ0 A;  1TXK A;  1W3Y A;  4DUX A;  1LF6 A;  3VDC A;  5E1Q A;  3T2P A;  2Q1F A;  3NJX A;  3MV0 1;  1OJN A;  1JYV A;  1N7Q A;  3DYP A;  1JZ3 A;  3J7H A;  1RWF A;  2WW1 A;  3VD4 A;  1MN0 A;  1CB8 A;  3MUZ 1;  3SEP A;  1K1Y A;  3T2O A;  1JYW A;  1JYX A;  1NSZ A;  1RW9 A;  2CIR A;  4RNL A;  1YQ2 A;  1F4A A;  1I8Q A;  4BZG A;  1F4H A;  3T09 A;  4DUV A;  2WW0 A;  1MMY A;  1NSS A;  1OJP A;  3I3B A;  1Z45 A;  1HM2 A;  1JZ2 A;  3IAQ A;  1JZ7 A;  4BZH A;  1MMX A;  3T0B A;  2JKP A;  2X03 A;  3T2Q A;  1JZ4 A;  1C82 A;  1N7P A;  2BRW A;  1YGA A;  1L7J A;  1RWG A;  1X1I A;  2WCO A;  3DCD A;  1NSM A;  2WVZ A;  1K1X A;  4TTG A;  1OJM A;  2JKE A;  1LXK A;  3VDA A;  1UG9 A;  1LF9 A;  2WW2 A;  2ZXQ A;  3NJV A;  3BGA A;  1JZ8 A;  3OS7 A;  3CZJ A;  1X1H A;  1NSR A;  1NSU A;  1NS0 A;  1HN1 A;  1LXM A;  1N7R A;  1EGU A;  1OJO A;  1X1J A;  2BRV X;  3WFA A;  1RWA A;  4DUW A;  3T08 A;  3MUY 1;  1JYN A;  3IAP A;  2WW3 A;  2HTB A;  2JKA A;  3T0A A;  1RWH A;  3VD5 A;  2BRP A;  4BZE A;  3A24 A;  1NSV A; 
#chains in the Genus database with same CATH topology
 1NS7 A;  2XN2 A;  2EAC A;  5KBP A;  3VDB A;  1PU4 A;  1K1W A;  3S4A A;  1F1S A;  1IVV A;  1HM3 A;  2E22 A;  3LVT A;  2WYI A;  3D52 A;  3NRE A;  3W7X A;  3K25 A;  3DYO A;  2CIQ A;  2OQE A;  1HN0 A;  2EAD A;  4KFD A;  2CIS A;  1N7O A;  4OJZ A;  3ECQ A;  1PX3 A;  3VD3 A;  2Y74 A;  2YX9 A;  2HTA A;  1RWC A;  3MPH A;  1LUR A;  2E2V A;  2WZS A;  3X42 A;  3WIQ A;  3S4D A;  1N7N A;  2YFO A;  2ZQ0 A;  1TXK A;  1WMP A;  3BLC A;  1JYV A;  5E1Q A;  1LF6 A;  3MV0 1;  2CWV A;  1N7Q A;  2CFW A;  1JZ3 A;  3J7H A;  1RWF A;  3BVT A;  1JYX A;  1NSZ A;  3NBB A;  2CIR A;  2YFN A;  1O7D D;  1YQ2 A;  1I8Q A;  4FNU A;  2WW0 A;  2F7R A;  3D4Z A;  2CQT A;  1Z45 A;  1JZ2 A;  1C82 A;  2BRW A;  1RWG A;  1X1I A;  3DCD A;  3X40 A;  2JKE A;  3N9H A;  4FNV A;  2WOH A;  1D6U A;  1OAC A;  2RDY A;  1LF9 A;  3BGA A;  4OK4 A;  1NSR A;  1HTY A;  1NS0 A;  1JRQ A;  1N7R A;  2BRV X;  1IVW A;  2FUQ A;  2CG0 A;  1RWA A;  2D1W A;  3CZN A;  3BVU A;  1W7C A;  3VD5 A;  1RKY A;  3WA3 A;  1V7W A;  2CFG A;  3E7J A;  1MMU A;  2EAE A;  3I3E A;  3T0D A;  2WOF A;  3EJR A;  2WO0 A;  2FYV A;  1HXK A;  3W7W A;  1AVL A;  3BUI A;  4MMH A;  3MI6 A;  3AMO B;  1D6Y A;  1R33 A;  1IU7 A;  3CV5 A;  3W7T A;  3I3D A;  1W6G A;  1JZ6 A;  3WVF A;  1JZ5 A;  4FNR A;  3RSY A;  3W7S A;  2EAB A;  1MMZ A;  1JOV A;  4BZF A;  2WVX A;  1NS2 A;  3Q1N A;  1NS4 A;  2CFL A;  1QX1 A;  3VSN A;  4AQ0 A;  3X3Y A;  1NSX A;  3HIG A;  1V7V A;  3D51 A;  3BS6 A;  2F1A A;  3QFZ A;  3VDC A;  3NJX A;  3BUB A;  2F7O A;  5JMF A;  3QFY A;  1MN0 A;  3T2O A;  1TQV A;  1W6C A;  1SPU A;  4KTP A;  1QAL A;  5CA3 A;  1OJP A;  4FNP A;  3IAQ A;  4BZH A;  2BT3 A;  4J5T A;  1N7P A;  2CWT A;  1NSM A;  2WGQ A;  3QG0 A;  2FUT A;  3DX2 A;  1LXK A;  1UG9 A;  1TU5 A;  2ZXQ A;  3T0U A;  1QWN A;  1V7X A;  3W7U A;  3OS7 A;  1X1H A;  4NEI A;  1LXM A;  1EGU A;  1OJO A;  1QWU A;  1X1J A;  1US1 A;  3MUY 1;  1AVK A;  3T0A A;  1RWH A;  2BRP A;  3HII A;  1W5Z A;  4BZE A;  2Y73 A;  3A24 A;  1NSV A;  4K35 A;  1QAF A;  1W2Z A;  2OW6 A;  1J0M A;  3VD9 A;  2F7P A;  1NS8 A;  1HMU A;  2F1B A;  3VD7 A;  1PX4 A;  2XN1 A;  2WDA A;  1ULV A;  1J0N A;  3X3X A;  3WA2 X;  1HWW A;  1L7K A;  2E2T A;  3IMH A;  3DYM A;  1LOH A;  2E24 A;  1SO0 A;  2W0Q A;  1IQY A;  4K3A A;  4FNT A;  2CWU A;  3BUP A;  4OK2 A;  4KFE A;  5A1A A;  2XHN A;  2CFD A;  1LVN A;  2OOV C;  3OB8 A;  3DDG A;  2E2U A;  1W3Y A;  3ACT A;  1IVU A;  4BTX A;  4DUX A;  2F18 A;  4KTR A;  1OJN A;  3DYP A;  1TQT A;  2WW1 A;  4RNL A;  1RW9 A;  1WMO A;  3KII A;  3EJT A;  2OW7 A;  1AV4 A;  1F4A A;  1WMN A;  4BZG A;  1F4H A;  1MMY A;  1NSS A;  3I3B A;  3EJQ A;  1HM2 A;  1TQS A;  4EV2 A;  3T2Q A;  1JZ4 A;  1PS3 A;  1L7J A;  2WCO A;  2OOV A;  3HI7 A;  3BLB A;  3WIR A;  3X3Z A;  2WW2 A;  2C11 A;  3BVW A;  1JZ8 A;  3CZJ A;  1NSU A;  1KSI A;  3KN4 A;  1SIH A;  4DUW A;  3PGB A;  3T08 A;  1JYN A;  3ALA A;  3IAP A;  1W4N A;  2CFK A;  2XN0 A;  3AFJ A;  2HTB A;  2JKA A;  2ALW A;  4FNQ A;  4UFC A;  1RJO A;  3AFL A;  3SXX A;  2WVY A;  3E1F 1;  1F9G A;  3LOY A;  3X41 A;  4MMI A;  1NKG A;  3VSM A;  3EJU A;  3E80 A;  2WVX B;  2XSG A;  3OBA A;  3DX0 A;  1DP0 A;  1SNZ A;  3MWX A;  3D50 A;  2D73 A;  3TY1 A;  3AMO A;  3ACS A;  4KFF A;  1TQW A;  4BTW A;  3SX1 A;  1D6Z A;  3EJS A;  3DX4 A;  1IQX A;  4FNS A;  1HMW A;  3BUQ A;  1IVX A;  3DEC A;  1H54 A;  3MV1 1;  3S4B A;  3BUD A;  2CG1 A;  3CZS A;  2Q1F A;  3T2P A;  1R34 A;  3VD4 A;  1CB8 A;  3MUZ 1;  3SEP A;  1K1Y A;  1JYW A;  2ZL8 A;  1QAK A;  3NBJ A;  3DDF A;  4BTY A;  3T09 A;  4DUV A;  5GW7 A;  1JZ7 A;  3D4Y A;  1SII A;  2PNC A;  1UI7 A;  2WYH A;  1MMX A;  2F7Q A;  3BVV A;  3T0B A;  2JKP A;  2X03 A;  1YGA A;  3DX3 A;  2CQS A;  2WVZ A;  1TQU A;  1K1X A;  4TTG A;  1OJM A;  1N9E A;  3RRS A;  3DX1 A;  3VDA A;  5JMD A;  1UI8 A;  3BVX A;  3NJV A;  1DYU A;  2C10 A;  1HN1 A;  3EJP A;  3D3I A;  3A0O A;  3WFA A;  4EV5 A;  3S4C A;  3K5T A;  2WW3 A;  2OQE C;  3QDE A;  1A2V A;  1EKM A; 
#chains in the Genus database with same CATH homology
 3AFL A;  1MMU A;  1LF6 A;  1NS7 A;  3VD9 A;  1J0M A;  3I3E A;  3T0D A;  1NS8 A;  1HMU A;  2WVY A;  3VD7 A;  1PX4 A;  3VDB A;  1K1W A;  3E1F 1;  1F9G A;  1F1S A;  1HM3 A;  4MMI A;  2E22 A;  1NKG A;  2WDA A;  4MMH A;  1ULV A;  3VSM A;  1J0N A;  3E80 A;  3NRE A;  2WVX B;  2XSG A;  3K25 A;  3OBA A;  3DYO A;  2CIQ A;  3I3D A;  1HN0 A;  1L7K A;  1DP0 A;  1SNZ A;  3MWX A;  2CIS A;  1JZ6 A;  3WVF A;  1N7O A;  4OJZ A;  1JZ5 A;  3IMH A;  3DYM A;  3ECQ A;  1LOH A;  1PX3 A;  3VD3 A;  2E24 A;  2D73 A;  3TY1 A;  1SO0 A;  1MMZ A;  1JOV A;  2HTA A;  4BZF A;  2WVX A;  1RWC A;  1LUR A;  1NS2 A;  3Q1N A;  1NS4 A;  4OK2 A;  3VSN A;  1HMW A;  4AQ0 A;  5A1A A;  2WZS A;  2XHN A;  1NSX A;  1N7N A;  3DEC A;  3MV1 1;  3OB8 A;  2ZQ0 A;  1TXK A;  1W3Y A;  3BS6 A;  4DUX A;  3BLC A;  3VDC A;  5E1Q A;  3T2P A;  2Q1F A;  3NJX A;  3MV0 1;  1OJN A;  1JYV A;  1N7Q A;  3DYP A;  1JZ3 A;  5JMF A;  3J7H A;  1RWF A;  2WW1 A;  3VD4 A;  1MN0 A;  1CB8 A;  3MUZ 1;  3SEP A;  1K1Y A;  3T2O A;  1JYW A;  1JYX A;  1NSZ A;  1RW9 A;  2CIR A;  4RNL A;  1YQ2 A;  1F4A A;  1I8Q A;  4BZG A;  1F4H A;  3T09 A;  4DUV A;  2WW0 A;  1MMY A;  1NSS A;  1OJP A;  3I3B A;  1Z45 A;  1HM2 A;  1JZ2 A;  3IAQ A;  1JZ7 A;  4BZH A;  1MMX A;  3T0B A;  2JKP A;  2X03 A;  3T2Q A;  4J5T A;  1C82 A;  1N7P A;  2BRW A;  1JZ4 A;  1YGA A;  1L7J A;  1RWG A;  1X1I A;  2WCO A;  3DCD A;  1NSM A;  2WVZ A;  1K1X A;  4TTG A;  1OJM A;  2JKE A;  4FNV A;  2FUT A;  1LXK A;  3VDA A;  1UG9 A;  1LF9 A;  2WW2 A;  2ZXQ A;  5JMD A;  3NJV A;  3BGA A;  4OK4 A;  1JZ8 A;  3OS7 A;  3CZJ A;  1X1H A;  1NSR A;  1NSU A;  4NEI A;  1NS0 A;  1HN1 A;  1LXM A;  1N7R A;  1EGU A;  1OJO A;  1X1J A;  2BRV X;  2FUQ A;  3A0O A;  3WFA A;  1RWA A;  4DUW A;  3T08 A;  3MUY 1;  1JYN A;  3IAP A;  2WW3 A;  2HTB A;  2JKA A;  3T0A A;  1RWH A;  3VD5 A;  2BRP A;  4BZE A;  3A24 A;  3E7J A;  1NSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...