1NSUA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLNGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsuA00
4BZGA 1JZ8A 1NSSA 1JYWA 3OS7A 2HTAA 3VD7A 1LF6A 1NSZA 1RWFA 1X1HA 3I3EA 3WFAA 3OB8A 1MMXA 3VD4A 1LXMA 3T2PA 1ULVA 2BRPA 2CIQA 1N7QA 1N7RA 1C82A 2WDAA 1F1SA 3DYPA 1X1JA 3DCDA 2BRWA 3T2OA 1NS7A 2WW3A 1OJPA 2WVZA 1HMUA 1F4HA 3I3BA 1SNZA 1NS0A 4DUWA 1JZ7A 3I3DA 1RWGA 4BZFA 1NSMA 3NJVA 1N7PA 3DECA 1K1XA 1Z45A 1EGUA 3OBAA 4TTGA 1N7OA 2HTBA 1MMYA 1RWAA 1SO0A 1L7KA 3T08A 2WW1A 2WW0A 3MV11 1HN0A 3NJXA 3A24A 1YGAA 1HMWA 3IAPA 3K25A 1NSXA 4BZEA 3VD3A 1JZ2A 1N7NA 3Q1NA 2XSGA 2E22A 1DP0A 2WCOA 1F4AA 1HM3A 2BRVX 2ZQ0A 3MWXA 3T0BA 3T09A 1L7JA 3VD9A 1YQ2A 2WVXA 1OJOA 3VD5A 2X03A 1F9GA 4RNLA 1LXKA 1PX3A 1CB8A 1PX4A 1RWCA 2WW2A 3VDAA 2CIRA 3SEPA 3VDBA 1NS2A 1UG9A 1NSRA 3BGAA 3T0AA 1RWHA 2JKEA 1JZ3A 1MMZA 4BZHA 2WVXB 1HM2A 4DUVA 1NSVA 3DYMA 1JZ5A 2WZSA 3T0DA 1LF9A 1NSUA 1JOVA 1J0NA 1K1WA 1LOHA 2JKPA 1W3YA 1NKGA 3ECQA 3MV01 5E1QA 1TXKA 3CZJA 2XHNA 1NS8A 3VDCA 3IMHA 4AQ0A 1OJMA 1JYVA 1HN1A 5A1AA 1JYNA 1I8QA 3T2QA 1JZ6A 2CISA 1J0MA 1MN0A 2Q1FA 2E24A 3MUZ1 1RW9A 3IAQA 1OJNA 1LURA 1NS4A 4DUXA 1K1YA 1X1IA 3MUY1 1JYXA 2WVYA 2JKAA 3DYOA 3NREA 2ZXQA 2D73A 1JZ4A 3E1F1 1MMUA 3J7HA
chains in the Genus database with same CATH superfamily
4K3AA 1JZ8A 1RJOA 3ALAA 1NSSA 4NEIA 2HTAA 3VD7A 1LF6A 1X1HA 1PS3A 1WMOA 1IU7A 3HIIA 1HTYA 3EJTA 3DYPA 2CFWA 3TY1A 2WW3A 1OJPA 3SX1A 3I3BA 3WIQA 3EJRA 2D1WA 1Z45A 2FYVA 2WYIA 4TTGA 2CWUA 2HTBA 1SO0A 3T08A 3QFYA 2E2VA 3NJXA 3S4BA 3EJQA 3WIRA 1UI7A 1N7NA 2XSGA 2F1BA 2WCOA 3T09A 2ZQ0A 3T0BA 2C10A 1YQ2A 1OJOA 3EJSA 1F9GA 1LXKA 1CB8A 1PX4A 4KFFA 1RWCA 2WW2A 3BUPA 1O7DD 2CWTA 2WO0A 1RWHA 3DX3A 1HM2A 4DUVA 3DYMA 1PU4A 4BTXA 3AMOA 1W3YA 1NKGA 3MV01 1TXKA 1NS8A 4AQ0A 1UI8A 3BUDA 1MN0A 2E24A 1RW9A 1LURA 2OQEC 1W2ZA 2CG1A 4FNPA 1IVUA 2E2UA 1AV4A 4OJZA 4BZGA 3W7UA 1IVVA 3I3EA 3WFAA 2F7RA 3VD4A 1QAFA 3NBJA 3WA3A 1AVLA 1N7RA 1F1SA 1WMPA 3DCDA 2BRWA 1SNZA 1W5ZA 2ZL8A 1RKYA 3W7TA 4KFDA 5JMDA 2CG0A 1N7PA 3ACTA 1D6YA 1SIHA 2BT3A 3BUQA 2OOVC 1K1XA 3D52A 4KFEA 1EKMA 1D6UA 1QAKA 1MMYA 1RWAA 3VSNA 2WW0A 3DX4A 1WMNA 2F7OA 1IQYA 3A24A 1YGAA 4FNUA 3IAPA 4BZEA 1NSXA 2CFKA 4K35A 3Q1NA 2C11A 1DP0A 3E80A 1HM3A 2BRVX 1QWNA 1L7JA 1W7CA 2XN1A 3BVVA 3VD5A 2X03A 4RNLA 1PX3A 1KSIA 2ALWA 2CFLA 3BVXA 3VDAA 3SEPA 4J5TA 4EV2A 3BGAA 1R33A 1OACA 2EADA 2JKEA 3WVFA 4FNQA 1JZ3A 1MMZA 3W7WA 1IVXA 1NSVA 3T0DA 1TQSA 1IVWA 3AFLA 3BLCA 3QFZA 1OJMA 1R34A 1HN1A 3HIGA 3BS6A 3NBBA 3T2QA 2WOFA 1JZ6A 3MI6A 3EJPA 2Q1FA 2YX9A 1X1IA 3MUY1 1JYXA 3X40A 3NREA 3BUIA 1LVNA 1N9EA 1W6GA 4KTPA 3D50A 2W0QA 3LVTA 3HI7A 1MMUA 3J7HA 2F1AA 4FNVA 3S4CA 3OS7A 1JYWA 3EJUA 1D6ZA 1RWFA 4FNSA 4MMHA 2CIQA 1N7QA 1C82A 2WDAA 3W7SA 3KN4A 3DDFA 2Y74A 3T2OA 1NS7A 3K5TA 2WVZA 4KTRA 1F4HA 1QALA 1US1A 4DUWA 3N9HA 5JMFA 4BZFA 2F7QA 3ACSA 3DECA 1HXKA 3D51A 1DYUA 2YFNA 3E7JA 3T0UA 4OK4A 3SXXA 1W6CA 1TU5A 1SPUA 2WGQA 2E2TA 3D4YA 3VD3A 1JZ2A 4BTYA 3MWXA 3VD9A 2FUTA 2EAEA 2FUQA 2CIRA 3VDBA 1NS2A 1UG9A 3X3XA 1AVKA 1H54A 2CFDA 2F7PA 2WVXB 2PNCA 1JZ5A 2WZSA 1JOVA 1K1WA 5E1QA 3W7XA 3CZJA 3CZSA 1JYVA 4EV5A 1TQTA 3CZNA 1I8QA 3VSMA 3WA2X 2CISA 3S4DA 3IAQA 3DX0A 4DUXA 1K1YA 2OQEA 2WVYA 2JKAA 3A0OA 3QDEA 4UFCA 3BVTA 3X3ZA 2XN0A 2EABA 2CWVA 5GW7A 1NSZA 2CQSA 3RSYA 3OB8A 1TQWA 1MMXA 3DX2A 1LXMA 3T2PA 1ULVA 2EACA 3CV5A 2BRPA 1QWUA 3BVUA 3D4ZA 3KIIA 2YFOA 1X1JA 1V7XA 3S4AA 2XN2A 1HMUA 1NS0A 3QG0A 1JZ7A 3I3DA 3RRSA 1V7WA 1RWGA 1NSMA 1SIIA 3NJVA 3X42A 2OOVA 2WYHA 1EGUA 3OBAA 1N7OA 4MMIA 3X41A 1L7KA 2WW1A 3MV11 1HN0A 3D3IA 1HMWA 3K25A 3BLBA 2OW6A 4BTWA 2WOHA 2E22A 3PGBA 1F4AA 3LOYA 2WVXA 2RDYA 5KBPA 2OW7A 1NSRA 3T0AA 1IQXA 4FNRA 4BZHA 1JRQA 4OK2A 1TQVA 2Y73A 5CA3A 1LF9A 1NSUA 1J0NA 1LOHA 2CFGA 2JKPA 3ECQA 2XHNA 2CQTA 3VDCA 3IMHA 1W4NA 5A1AA 1JYNA 1V7VA 2F18A 3AMOB 1J0MA 3DDGA 3MUZ1 1TQUA 3BVWA 1OJNA 1NS4A 3DX1A 1A2VA 3MPHA 1HWWA 3X3YA 3DYOA 1QX1A 2ZXQA 3BUBA 2D73A 3AFJA 1JZ4A 3E1F1 4FNTA
chains in the Genus database with same CATH topology
4OJZA 4BZGA 1JZ8A 1NSSA 4NEIA 4FNVA 1JYWA 3OS7A 2HTAA 3VD7A 1LF6A 1NSZA 1RWFA 1X1HA 3I3EA 3WFAA 3OB8A 1MMXA 3VD4A 1LXMA 3T2PA 1ULVA 4MMHA 2BRPA 2CIQA 1N7QA 1N7RA 1C82A 2WDAA 1F1SA 3DYPA 1X1JA 3DCDA 3TY1A 2BRWA 3T2OA 1NS7A 2WW3A 1OJPA 2WVZA 1HMUA 1F4HA 3I3BA 1SNZA 1NS0A 4DUWA 1JZ7A 3I3DA 5JMFA 1RWGA 4BZFA 1NSMA 5JMDA 3NJVA 1N7PA 3DECA 1K1XA 1Z45A 1EGUA 3OBAA 4TTGA 1N7OA 4MMIA 2HTBA 1MMYA 3E7JA 1RWAA 3VSNA 1SO0A 1L7KA 4OK4A 3T08A 2WW1A 2WW0A 3MV11 1HN0A 3NJXA 3A24A 1YGAA 1HMWA 3IAPA 3K25A 1NSXA 4BZEA 3VD3A 1JZ2A 1N7NA 3Q1NA 2XSGA 2E22A 1DP0A 3E80A 2WCOA 1F4AA 1HM3A 2BRVX 2ZQ0A 3MWXA 3T0BA 3T09A 1L7JA 3VD9A 1YQ2A 2WVXA 1OJOA 3VD5A 2FUTA 2X03A 1F9GA 4RNLA 1LXKA 1PX3A 1CB8A 1PX4A 1RWCA 2FUQA 2WW2A 3VDAA 2CIRA 3SEPA 3VDBA 1NS2A 1UG9A 4J5TA 1NSRA 3BGAA 3T0AA 1RWHA 2JKEA 3WVFA 1JZ3A 1MMZA 4BZHA 2WVXB 1HM2A 4DUVA 1NSVA 4OK2A 3DYMA 1JZ5A 2WZSA 3T0DA 1LF9A 1NSUA 1JOVA 1J0NA 1K1WA 1LOHA 2JKPA 1W3YA 1NKGA 3ECQA 3MV01 5E1QA 1TXKA 3AFLA 3BLCA 3CZJA 2XHNA 1NS8A 3VDCA 3IMHA 4AQ0A 1OJMA 1JYVA 1HN1A 5A1AA 1JYNA 1I8QA 3BS6A 3T2QA 3VSMA 1JZ6A 2CISA 1J0MA 1MN0A 2Q1FA 2E24A 3MUZ1 1RW9A 3IAQA 1OJNA 1LURA 1NS4A 4DUXA 1K1YA 1X1IA 3MUY1 1JYXA 2WVYA 2JKAA 3DYOA 3NREA 2ZXQA 3A0OA 2D73A 1JZ4A 3E1F1 1MMUA 3J7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BZG A;  1JZ8 A;  1NSS A;  1JYW A;  3OS7 A;  2HTA A;  3VD7 A;  1LF6 A;  1NSZ A;  1RWF A;  1X1H A;  3I3E A;  3WFA A;  3OB8 A;  1MMX A;  3VD4 A;  1LXM A;  3T2P A;  1ULV A;  2BRP A;  2CIQ A;  1N7Q A;  1N7R A;  1C82 A;  2WDA A;  1F1S A;  3DYP A;  1X1J A;  3DCD A;  2BRW A;  3T2O A;  1NS7 A;  2WW3 A;  1OJP A;  2WVZ A;  1HMU A;  1F4H A;  3I3B A;  1SNZ A;  1NS0 A;  4DUW A;  1JZ7 A;  3I3D A;  1RWG A;  4BZF A;  1NSM A;  3NJV A;  1N7P A;  3DEC A;  1K1X A;  1Z45 A;  1EGU A;  3OBA A;  4TTG A;  1N7O A;  2HTB A;  1MMY A;  1RWA A;  1SO0 A;  1L7K A;  3T08 A;  2WW1 A;  2WW0 A;  3MV1 1;  1HN0 A;  3NJX A;  3A24 A;  1YGA A;  1HMW A;  3IAP A;  3K25 A;  1NSX A;  4BZE A;  3VD3 A;  1JZ2 A;  1N7N A;  3Q1N A;  2XSG A;  2E22 A;  1DP0 A;  2WCO A;  1F4A A;  1HM3 A;  2BRV X;  2ZQ0 A;  3MWX A;  3T0B A;  3T09 A;  1L7J A;  3VD9 A;  1YQ2 A;  2WVX A;  1OJO A;  3VD5 A;  2X03 A;  1F9G A;  4RNL A;  1LXK A;  1PX3 A;  1CB8 A;  1PX4 A;  1RWC A;  2WW2 A;  3VDA A;  2CIR A;  3SEP A;  3VDB A;  1NS2 A;  1UG9 A;  1NSR A;  3BGA A;  3T0A A;  1RWH A;  2JKE A;  1JZ3 A;  1MMZ A;  4BZH A;  2WVX B;  1HM2 A;  4DUV A;  1NSV A;  3DYM A;  1JZ5 A;  2WZS A;  3T0D A;  1LF9 A;  1NSU A;  1JOV A;  1J0N A;  1K1W A;  1LOH A;  2JKP A;  1W3Y A;  1NKG A;  3ECQ A;  3MV0 1;  5E1Q A;  1TXK A;  3CZJ A;  2XHN A;  1NS8 A;  3VDC A;  3IMH A;  4AQ0 A;  1OJM A;  1JYV A;  1HN1 A;  5A1A A;  1JYN A;  1I8Q A;  3T2Q A;  1JZ6 A;  2CIS A;  1J0M A;  1MN0 A;  2Q1F A;  2E24 A;  3MUZ 1;  1RW9 A;  3IAQ A;  1OJN A;  1LUR A;  1NS4 A;  4DUX A;  1K1Y A;  1X1I A;  3MUY 1;  1JYX A;  2WVY A;  2JKA A;  3DYO A;  3NRE A;  2ZXQ A;  2D73 A;  1JZ4 A;  3E1F 1;  1MMU A;  3J7H A; 
#chains in the Genus database with same CATH topology
 4K3A A;  1JZ8 A;  1RJO A;  3ALA A;  1NSS A;  4NEI A;  2HTA A;  3VD7 A;  1LF6 A;  1X1H A;  1PS3 A;  1WMO A;  1IU7 A;  3HII A;  1HTY A;  3EJT A;  3DYP A;  2CFW A;  3TY1 A;  2WW3 A;  1OJP A;  3SX1 A;  3I3B A;  3WIQ A;  3EJR A;  2D1W A;  1Z45 A;  2FYV A;  2WYI A;  4TTG A;  2CWU A;  2HTB A;  1SO0 A;  3T08 A;  3QFY A;  2E2V A;  3NJX A;  3S4B A;  3EJQ A;  3WIR A;  1UI7 A;  1N7N A;  2XSG A;  2F1B A;  2WCO A;  3T09 A;  2ZQ0 A;  3T0B A;  2C10 A;  1YQ2 A;  1OJO A;  3EJS A;  1F9G A;  1LXK A;  1CB8 A;  1PX4 A;  4KFF A;  1RWC A;  2WW2 A;  3BUP A;  1O7D D;  2CWT A;  2WO0 A;  1RWH A;  3DX3 A;  1HM2 A;  4DUV A;  3DYM A;  1PU4 A;  4BTX A;  3AMO A;  1W3Y A;  1NKG A;  3MV0 1;  1TXK A;  1NS8 A;  4AQ0 A;  1UI8 A;  3BUD A;  1MN0 A;  2E24 A;  1RW9 A;  1LUR A;  2OQE C;  1W2Z A;  2CG1 A;  4FNP A;  1IVU A;  2E2U A;  1AV4 A;  4OJZ A;  4BZG A;  3W7U A;  1IVV A;  3I3E A;  3WFA A;  2F7R A;  3VD4 A;  1QAF A;  3NBJ A;  3WA3 A;  1AVL A;  1N7R A;  1F1S A;  1WMP A;  3DCD A;  2BRW A;  1SNZ A;  1W5Z A;  2ZL8 A;  1RKY A;  3W7T A;  4KFD A;  5JMD A;  2CG0 A;  1N7P A;  3ACT A;  1D6Y A;  1SIH A;  2BT3 A;  3BUQ A;  2OOV C;  1K1X A;  3D52 A;  4KFE A;  1EKM A;  1D6U A;  1QAK A;  1MMY A;  1RWA A;  3VSN A;  2WW0 A;  3DX4 A;  1WMN A;  2F7O A;  1IQY A;  3A24 A;  1YGA A;  4FNU A;  3IAP A;  4BZE A;  1NSX A;  2CFK A;  4K35 A;  3Q1N A;  2C11 A;  1DP0 A;  3E80 A;  1HM3 A;  2BRV X;  1QWN A;  1L7J A;  1W7C A;  2XN1 A;  3BVV A;  3VD5 A;  2X03 A;  4RNL A;  1PX3 A;  1KSI A;  2ALW A;  2CFL A;  3BVX A;  3VDA A;  3SEP A;  4J5T A;  4EV2 A;  3BGA A;  1R33 A;  1OAC A;  2EAD A;  2JKE A;  3WVF A;  4FNQ A;  1JZ3 A;  1MMZ A;  3W7W A;  1IVX A;  1NSV A;  3T0D A;  1TQS A;  1IVW A;  3AFL A;  3BLC A;  3QFZ A;  1OJM A;  1R34 A;  1HN1 A;  3HIG A;  3BS6 A;  3NBB A;  3T2Q A;  2WOF A;  1JZ6 A;  3MI6 A;  3EJP A;  2Q1F A;  2YX9 A;  1X1I A;  3MUY 1;  1JYX A;  3X40 A;  3NRE A;  3BUI A;  1LVN A;  1N9E A;  1W6G A;  4KTP A;  3D50 A;  2W0Q A;  3LVT A;  3HI7 A;  1MMU A;  3J7H A;  2F1A A;  4FNV A;  3S4C A;  3OS7 A;  1JYW A;  3EJU A;  1D6Z A;  1RWF A;  4FNS A;  4MMH A;  2CIQ A;  1N7Q A;  1C82 A;  2WDA A;  3W7S A;  3KN4 A;  3DDF A;  2Y74 A;  3T2O A;  1NS7 A;  3K5T A;  2WVZ A;  4KTR A;  1F4H A;  1QAL A;  1US1 A;  4DUW A;  3N9H A;  5JMF A;  4BZF A;  2F7Q A;  3ACS A;  3DEC A;  1HXK A;  3D51 A;  1DYU A;  2YFN A;  3E7J A;  3T0U A;  4OK4 A;  3SXX A;  1W6C A;  1TU5 A;  1SPU A;  2WGQ A;  2E2T A;  3D4Y A;  3VD3 A;  1JZ2 A;  4BTY A;  3MWX A;  3VD9 A;  2FUT A;  2EAE A;  2FUQ A;  2CIR A;  3VDB A;  1NS2 A;  1UG9 A;  3X3X A;  1AVK A;  1H54 A;  2CFD A;  2F7P A;  2WVX B;  2PNC A;  1JZ5 A;  2WZS A;  1JOV A;  1K1W A;  5E1Q A;  3W7X A;  3CZJ A;  3CZS A;  1JYV A;  4EV5 A;  1TQT A;  3CZN A;  1I8Q A;  3VSM A;  3WA2 X;  2CIS A;  3S4D A;  3IAQ A;  3DX0 A;  4DUX A;  1K1Y A;  2OQE A;  2WVY A;  2JKA A;  3A0O A;  3QDE A;  4UFC A;  3BVT A;  3X3Z A;  2XN0 A;  2EAB A;  2CWV A;  5GW7 A;  1NSZ A;  2CQS A;  3RSY A;  3OB8 A;  1TQW A;  1MMX A;  3DX2 A;  1LXM A;  3T2P A;  1ULV A;  2EAC A;  3CV5 A;  2BRP A;  1QWU A;  3BVU A;  3D4Z A;  3KII A;  2YFO A;  1X1J A;  1V7X A;  3S4A A;  2XN2 A;  1HMU A;  1NS0 A;  3QG0 A;  1JZ7 A;  3I3D A;  3RRS A;  1V7W A;  1RWG A;  1NSM A;  1SII A;  3NJV A;  3X42 A;  2OOV A;  2WYH A;  1EGU A;  3OBA A;  1N7O A;  4MMI A;  3X41 A;  1L7K A;  2WW1 A;  3MV1 1;  1HN0 A;  3D3I A;  1HMW A;  3K25 A;  3BLB A;  2OW6 A;  4BTW A;  2WOH A;  2E22 A;  3PGB A;  1F4A A;  3LOY A;  2WVX A;  2RDY A;  5KBP A;  2OW7 A;  1NSR A;  3T0A A;  1IQX A;  4FNR A;  4BZH A;  1JRQ A;  4OK2 A;  1TQV A;  2Y73 A;  5CA3 A;  1LF9 A;  1NSU A;  1J0N A;  1LOH A;  2CFG A;  2JKP A;  3ECQ A;  2XHN A;  2CQT A;  3VDC A;  3IMH A;  1W4N A;  5A1A A;  1JYN A;  1V7V A;  2F18 A;  3AMO B;  1J0M A;  3DDG A;  3MUZ 1;  1TQU A;  3BVW A;  1OJN A;  1NS4 A;  3DX1 A;  1A2V A;  3MPH A;  1HWW A;  3X3Y A;  3DYO A;  1QX1 A;  2ZXQ A;  3BUB A;  2D73 A;  3AFJ A;  1JZ4 A;  3E1F 1;  4FNT A; 
#chains in the Genus database with same CATH homology
 4OJZ A;  4BZG A;  1JZ8 A;  1NSS A;  4NEI A;  4FNV A;  1JYW A;  3OS7 A;  2HTA A;  3VD7 A;  1LF6 A;  1NSZ A;  1RWF A;  1X1H A;  3I3E A;  3WFA A;  3OB8 A;  1MMX A;  3VD4 A;  1LXM A;  3T2P A;  1ULV A;  4MMH A;  2BRP A;  2CIQ A;  1N7Q A;  1N7R A;  1C82 A;  2WDA A;  1F1S A;  3DYP A;  1X1J A;  3DCD A;  3TY1 A;  2BRW A;  3T2O A;  1NS7 A;  2WW3 A;  1OJP A;  2WVZ A;  1HMU A;  1F4H A;  3I3B A;  1SNZ A;  1NS0 A;  4DUW A;  1JZ7 A;  3I3D A;  5JMF A;  1RWG A;  4BZF A;  1NSM A;  5JMD A;  3NJV A;  1N7P A;  3DEC A;  1K1X A;  1Z45 A;  1EGU A;  3OBA A;  4TTG A;  1N7O A;  4MMI A;  2HTB A;  1MMY A;  3E7J A;  1RWA A;  3VSN A;  1SO0 A;  1L7K A;  4OK4 A;  3T08 A;  2WW1 A;  2WW0 A;  3MV1 1;  1HN0 A;  3NJX A;  3A24 A;  1YGA A;  1HMW A;  3IAP A;  3K25 A;  1NSX A;  4BZE A;  3VD3 A;  1JZ2 A;  1N7N A;  3Q1N A;  2XSG A;  2E22 A;  1DP0 A;  3E80 A;  2WCO A;  1F4A A;  1HM3 A;  2BRV X;  2ZQ0 A;  3MWX A;  3T0B A;  3T09 A;  1L7J A;  3VD9 A;  1YQ2 A;  2WVX A;  1OJO A;  3VD5 A;  2FUT A;  2X03 A;  1F9G A;  4RNL A;  1LXK A;  1PX3 A;  1CB8 A;  1PX4 A;  1RWC A;  2FUQ A;  2WW2 A;  3VDA A;  2CIR A;  3SEP A;  3VDB A;  1NS2 A;  1UG9 A;  4J5T A;  1NSR A;  3BGA A;  3T0A A;  1RWH A;  2JKE A;  3WVF A;  1JZ3 A;  1MMZ A;  4BZH A;  2WVX B;  1HM2 A;  4DUV A;  1NSV A;  4OK2 A;  3DYM A;  1JZ5 A;  2WZS A;  3T0D A;  1LF9 A;  1NSU A;  1JOV A;  1J0N A;  1K1W A;  1LOH A;  2JKP A;  1W3Y A;  1NKG A;  3ECQ A;  3MV0 1;  5E1Q A;  1TXK A;  3AFL A;  3BLC A;  3CZJ A;  2XHN A;  1NS8 A;  3VDC A;  3IMH A;  4AQ0 A;  1OJM A;  1JYV A;  1HN1 A;  5A1A A;  1JYN A;  1I8Q A;  3BS6 A;  3T2Q A;  3VSM A;  1JZ6 A;  2CIS A;  1J0M A;  1MN0 A;  2Q1F A;  2E24 A;  3MUZ 1;  1RW9 A;  3IAQ A;  1OJN A;  1LUR A;  1NS4 A;  4DUX A;  1K1Y A;  1X1I A;  3MUY 1;  1JYX A;  2WVY A;  2JKA A;  3DYO A;  3NRE A;  2ZXQ A;  3A0O A;  2D73 A;  1JZ4 A;  3E1F 1;  1MMU A;  3J7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...