3IMHA

Crystal structure of galactose 1-epimerase from lactobacillus acidophilus ncfm
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
SLKTNFVKYERKDNKDLCEITLENDAGMAVKVLNYGATLEKVLLDGENMILSLNSPEDYSKERNFLGGTVGRIAGRVRAGQWKHGNEIHQLPLNDGDNHIHGGIGTDMHVWDFRPSCDSEHARVDLTLFDPDGNNDYPGNLKLHARYELDNENNLHYLLEAVSDKLTIFNPVNHTYFNLGERAEDLNLQMNADYYLPVDEAGLPDRGMAEVAGTAFDFRKTKRIGDALNSDDSQIKLRNGLDHPFILNGNNPAALLSSNKHRLIVKTNAPALVLYAGNHFNHTGIVNNIGQYDGITFEAQCPPAEGNDLGQITLLPFEKFKRTVDWKFEEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-1-epimerase
publication title CRYSTAL STRUCTURE OF GALACTOSE 1-EPIMERASE FROM Lactobacillus acidophilus
rcsb
source organism Lactobacillus acidophilus
molecule tags Isomerase
total genus 104
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3imhA00
2X03A 1LOHA 3OS7A 3NJXA 2WZSA 5A1AA 3MV01 1HMUA 3T2OA 3T0BA 1NS2A 1LF9A 1K1XA 1RWAA 4DUWA 4AQ0A 1LXMA 2ZXQA 1K1YA 4DUVA 1MMYA 2HTAA 3VD5A 2WW3A 2WVXA 3T08A 2WVZA 1SNZA 3SEPA 3VD7A 3I3BA 1F9GA 1NKGA 1NSSA 2JKAA 3WFAA 1JZ4A 3MUY1 1TXKA 1RWGA 1K1WA 1HM2A 3A24A 2HTBA 1Z45A 1RWCA 1NSMA 3IMHA 3VDBA 1F4HA 2JKEA 1RWFA 1OJPA 2CIRA 3T2PA 1C82A 1N7RA 3MUZ1 2XHNA 3DYMA 1W3YA 3VD3A 1YGAA 3DYOA 1RWHA 3VD4A 1NSXA 2JKPA 1N7PA 3ECQA 1I8QA 1JZ6A 1JYVA 3NREA 2XSGA 1UG9A 2ZQ0A 1SO0A 3T0DA 1HN0A 1PX4A 1JZ8A 3K25A 3OBAA 1CB8A 3MV11 1N7OA 3Q1NA 1MMUA 2BRWA 2BRVX 3VDCA 1OJMA 3OB8A 4BZGA 1F1SA 1JZ2A 1X1JA 1N7QA 1JYNA 4TTGA 3VD9A 1MMZA 1NSZA 5E1QA 4RNLA 3VDAA 3DCDA 3NJVA 1HMWA 3CZJA 1NSUA 1LURA 1NSVA 2E24A 2WDAA 1F4AA 2WW0A 3I3EA 4DUXA 1JZ5A 1RW9A 1OJNA 1X1HA 1L7KA 1X1IA 1JZ3A 1HM3A 1JOVA 3DYPA 2WW2A 2WVYA 1DP0A 1ULVA 3IAPA 3T09A 1NS0A 2CISA 2BRPA 3BGAA 1NS8A 3IAQA 1J0MA 1L7JA 2E22A 1LXKA 2CIQA 1HN1A 1N7NA 1JYXA 1J0NA 1NS4A 1NS7A 4BZFA 3I3DA 3DECA 2WW1A 2WCOA 1OJOA 2D73A 4BZEA 1MN0A 3MWXA 4BZHA 1LF6A 2Q1FA 1EGUA 1JZ7A 2WVXB 1MMXA 1NSRA 1JYWA 1PX3A 3T0AA 3J7HA 1YQ2A 3E1F1 3T2QA
chains in the Genus database with same CATH superfamily
3X3ZA 3QG0A 1HWWA 3OS7A 2E2VA 3MV01 1HMUA 1RWAA 2E2UA 1IVWA 4DUVA 1MMYA 2CWTA 1QALA 2HTAA 3VD5A 2WVXA 2WVZA 3DDFA 1QAFA 3VD7A 2YFNA 1NSSA 1NKGA 2JKAA 1JZ4A 1TXKA 1HM2A 2OOVC 2HTBA 1RWCA 1NSMA 3IMHA 2WYHA 1F4HA 3E7JA 1A2VA 3AFJA 2F7PA 1WMPA 1OJPA 2OW6A 2XHNA 3DYMA 3LOYA 4OK4A 3W7XA 2F18A 3VD4A 1NSXA 1N7PA 3N9HA 3EJQA 1I8QA 1V7VA 4BTYA 3K5TA 1W4NA 1AVKA 3K25A 2OQEA 3MV11 3Q1NA 1MMUA 3DX4A 2F7OA 2BRVX 3VDCA 1OJMA 1F1SA 1JZ2A 1JYNA 3D51A 2WGQA 1NSZA 4K3AA 1R33A 1SIHA 1DYUA 1WMOA 1UI8A 3EJTA 1W2ZA 3IAPA 2CFDA 3D50A 3IAQA 3TY1A 1JYXA 2Y74A 4FNUA 3W7UA 3I3DA 3HI7A 2WW1A 3AMOB 3MWXA 2Q1FA 2CQSA 3MPHA 1JYWA 2CG1A 3T0AA 2C11A 1AVLA 1EKMA 3E1F1 5GW7A 5A1AA 3MI6A 4UFCA 3LVTA 1TQVA 2ZXQA 3AMOA 1K1YA 3AFLA 3BUBA 2WW3A 2WYIA 2F1BA 3I3BA 1K1WA 3A24A 1Z45A 3VDBA 1W5ZA 3QFZA 3EJSA 3DX0A 1HXKA 3T2PA 1C82A 1H54A 1N7RA 3MUZ1 1W3YA 3VD3A 1YGAA 3ACTA 2OW7A 3CZSA 3SX1A 3BVXA 3NREA 2XSGA 1UG9A 2ZQ0A 3X3XA 1PX4A 3DX3A 1JZ8A 3OBAA 4NEIA 2WOHA 2FUQA 1O7DD 4KFDA 3RSYA 3W7SA 1X1JA 5JMDA 2OQEC 4RNLA 1NSVA 2WDAA 1F4AA 2F1AA 2CQTA 3SXXA 3I3EA 4FNVA 1PS3A 1OJNA 2EACA 1X1IA 3S4CA 2XN2A 3DYPA 4MMHA 2EADA 3BVWA 1TQWA 2CISA 3DX1A 2BRPA 3BGAA 1J0MA 3RRSA 1L7JA 1LXKA 2CIQA 4OK2A 3S4DA 1J0NA 1NS4A 1QAKA 1D6YA 2CFLA 2YFOA 3EJUA 4BZFA 4BZEA 3VSMA 1MN0A 1LF6A 1QWNA 1TU5A 3T0UA 3BLBA 2D1WA 1SPUA 2WO0A 3DDGA 1LOHA 3T0BA 4FNSA 1K1XA 5CA3A 1LXMA 3NBBA 3W7TA 3T08A 3SEPA 1SNZA 1F9GA 2FYVA 3MUY1 1SIIA 2Y73A 3NBJA 1RWGA 1TQSA 1R34A 1LVNA 4KTRA 4OJZA 4FNRA 1RWFA 1IVXA 2ZL8A 3HIGA 3DYOA 3BVVA 1IVVA 4J5TA 3ECQA 1OACA 3DX2A 1QX1A 1HN0A 4FNTA 3S4AA 4K35A 1CB8A 1N7OA 4FNQA 1IU7A 4MMIA 2CWUA 2EAEA 3BUQA 2BRWA 2XN0A 3OB8A 1W6CA 4BZGA 1KSIA 1N7QA 4TTGA 2BT3A 1MMZA 3WIRA 2F7QA 3VDAA 2W0QA 5KBPA 1HTYA 2E24A 1LURA 2CFGA 2WW0A 1IQXA 1V7WA 1JZ5A 1QWUA 3PGBA 1HM3A 2WW2A 3A0OA 1DP0A 3X3YA 1IQYA 3WIQA 2CFKA 1NS0A 1N9EA 2E22A 1D6ZA 1HN1A 1N7NA 3CZNA 1NS7A 3D4ZA 2ALWA 1MMXA 3ALAA 1NSRA 3BS6A 3E80A 3EJRA 3J7HA 3D4YA 1US1A 3BVTA 2X03A 3NJXA 2WZSA 3T2OA 1NS2A 1LF9A 4DUWA 3BLCA 4AQ0A 2OOVA 3BVUA 4EV2A 3QDEA 1TQUA 1RJOA 3S4BA 3WFAA 2XN1A 1PU4A 3BUIA 2JKEA 3ACSA 4BTWA 4FNPA 2CIRA 3W7WA 3HIIA 2RDYA 1RWHA 2WOFA 3BUPA 2JKPA 2F7RA 1JZ6A 3VSNA 1JYVA 1RKYA 3WA3A 3D3IA 1TQTA 4EV5A 1SO0A 3T0DA 3D52A 1UI7A 3EJPA 1V7XA 1IVUA 3VD9A 1D6UA 2YX9A 4KFFA 3QFYA 5E1QA 3DCDA 3X42A 3NJVA 2C10A 1HMWA 3CZJA 1NSUA 3WA2X 2FUTA 4DUXA 1RW9A 2CG0A 3CV5A 1X1HA 2PNCA 1L7KA 2CFWA 3X40A 1JZ3A 1JOVA 2WVYA 4KTPA 4KFEA 1ULVA 4BTXA 3KN4A 1W7CA 2EABA 3T09A 1W6GA 1NS8A 3WVFA 3X41A 1AV4A 1JRQA 3KIIA 3DECA 1WMNA 1OJOA 2D73A 2WCOA 3BUDA 4BZHA 1EGUA 1JZ7A 2CWVA 2E2TA 2WVXB 1PX3A 1YQ2A 3T2QA 5JMFA
chains in the Genus database with same CATH topology
2X03A 1LOHA 3OS7A 3NJXA 2WZSA 5A1AA 3MV01 1HMUA 3T2OA 3T0BA 1NS2A 1LF9A 1K1XA 1RWAA 3BLCA 4DUWA 4AQ0A 1LXMA 2ZXQA 3AFLA 1K1YA 4DUVA 1MMYA 2HTAA 3VD5A 2WW3A 2WVXA 3T08A 2WVZA 1SNZA 3SEPA 3VD7A 3I3BA 1F9GA 1NKGA 1NSSA 2JKAA 3WFAA 1JZ4A 3MUY1 1TXKA 1RWGA 1K1WA 1HM2A 3A24A 2HTBA 1Z45A 1RWCA 1NSMA 3IMHA 3VDBA 4OJZA 1F4HA 3E7JA 2JKEA 1RWFA 1OJPA 2CIRA 3T2PA 1C82A 1N7RA 3MUZ1 2XHNA 3DYMA 4OK4A 1W3YA 3VD3A 1YGAA 3DYOA 1RWHA 3VD4A 1NSXA 2JKPA 4J5TA 1N7PA 3ECQA 1I8QA 3VSNA 1JZ6A 1JYVA 3NREA 2XSGA 1UG9A 2ZQ0A 1SO0A 3T0DA 1HN0A 1PX4A 1JZ8A 3K25A 3OBAA 4NEIA 1CB8A 3MV11 1N7OA 2FUQA 1MMUA 3Q1NA 4MMIA 2BRWA 2BRVX 3VDCA 1OJMA 3OB8A 4BZGA 1F1SA 1JZ2A 1X1JA 1N7QA 5JMDA 1JYNA 4TTGA 3VD9A 1MMZA 1NSZA 5E1QA 4RNLA 3VDAA 3DCDA 3NJVA 1HMWA 3CZJA 1NSUA 1LURA 1NSVA 2E24A 2WDAA 1F4AA 2WW0A 2FUTA 3I3EA 4DUXA 1JZ5A 4FNVA 1RW9A 1OJNA 1X1HA 1L7KA 1X1IA 1JZ3A 1HM3A 1JOVA 3DYPA 2WW2A 3A0OA 2WVYA 1DP0A 4MMHA 1ULVA 3IAPA 3T09A 1NS0A 2CISA 2BRPA 3BGAA 1NS8A 3IAQA 1J0MA 3WVFA 1L7JA 2E22A 1LXKA 2CIQA 3TY1A 1HN1A 1N7NA 4OK2A 1JYXA 1J0NA 1NS4A 1NS7A 4BZFA 3I3DA 3DECA 2WW1A 2WCOA 1OJOA 2D73A 3VSMA 4BZEA 1MN0A 3MWXA 4BZHA 1LF6A 2Q1FA 1EGUA 1JZ7A 2WVXB 1MMXA 1NSRA 3BS6A 1JYWA 1PX3A 3T0AA 3E80A 3J7HA 1YQ2A 3E1F1 3T2QA 5JMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X03 A;  1LOH A;  3OS7 A;  3NJX A;  2WZS A;  5A1A A;  3MV0 1;  1HMU A;  3T2O A;  3T0B A;  1NS2 A;  1LF9 A;  1K1X A;  1RWA A;  4DUW A;  4AQ0 A;  1LXM A;  2ZXQ A;  1K1Y A;  4DUV A;  1MMY A;  2HTA A;  3VD5 A;  2WW3 A;  2WVX A;  3T08 A;  2WVZ A;  1SNZ A;  3SEP A;  3VD7 A;  3I3B A;  1F9G A;  1NKG A;  1NSS A;  2JKA A;  3WFA A;  1JZ4 A;  3MUY 1;  1TXK A;  1RWG A;  1K1W A;  1HM2 A;  3A24 A;  2HTB A;  1Z45 A;  1RWC A;  1NSM A;  3IMH A;  3VDB A;  1F4H A;  2JKE A;  1RWF A;  1OJP A;  2CIR A;  3T2P A;  1C82 A;  1N7R A;  3MUZ 1;  2XHN A;  3DYM A;  1W3Y A;  3VD3 A;  1YGA A;  3DYO A;  1RWH A;  3VD4 A;  1NSX A;  2JKP A;  1N7P A;  3ECQ A;  1I8Q A;  1JZ6 A;  1JYV A;  3NRE A;  2XSG A;  1UG9 A;  2ZQ0 A;  1SO0 A;  3T0D A;  1HN0 A;  1PX4 A;  1JZ8 A;  3K25 A;  3OBA A;  1CB8 A;  3MV1 1;  1N7O A;  3Q1N A;  1MMU A;  2BRW A;  2BRV X;  3VDC A;  1OJM A;  3OB8 A;  4BZG A;  1F1S A;  1JZ2 A;  1X1J A;  1N7Q A;  1JYN A;  4TTG A;  3VD9 A;  1MMZ A;  1NSZ A;  5E1Q A;  4RNL A;  3VDA A;  3DCD A;  3NJV A;  1HMW A;  3CZJ A;  1NSU A;  1LUR A;  1NSV A;  2E24 A;  2WDA A;  1F4A A;  2WW0 A;  3I3E A;  4DUX A;  1JZ5 A;  1RW9 A;  1OJN A;  1X1H A;  1L7K A;  1X1I A;  1JZ3 A;  1HM3 A;  1JOV A;  3DYP A;  2WW2 A;  2WVY A;  1DP0 A;  1ULV A;  3IAP A;  3T09 A;  1NS0 A;  2CIS A;  2BRP A;  3BGA A;  1NS8 A;  3IAQ A;  1J0M A;  1L7J A;  2E22 A;  1LXK A;  2CIQ A;  1HN1 A;  1N7N A;  1JYX A;  1J0N A;  1NS4 A;  1NS7 A;  4BZF A;  3I3D A;  3DEC A;  2WW1 A;  2WCO A;  1OJO A;  2D73 A;  4BZE A;  1MN0 A;  3MWX A;  4BZH A;  1LF6 A;  2Q1F A;  1EGU A;  1JZ7 A;  2WVX B;  1MMX A;  1NSR A;  1JYW A;  1PX3 A;  3T0A A;  3J7H A;  1YQ2 A;  3E1F 1;  3T2Q A; 
#chains in the Genus database with same CATH topology
 3X3Z A;  3QG0 A;  1HWW A;  3OS7 A;  2E2V A;  3MV0 1;  1HMU A;  1RWA A;  2E2U A;  1IVW A;  4DUV A;  1MMY A;  2CWT A;  1QAL A;  2HTA A;  3VD5 A;  2WVX A;  2WVZ A;  3DDF A;  1QAF A;  3VD7 A;  2YFN A;  1NSS A;  1NKG A;  2JKA A;  1JZ4 A;  1TXK A;  1HM2 A;  2OOV C;  2HTB A;  1RWC A;  1NSM A;  3IMH A;  2WYH A;  1F4H A;  3E7J A;  1A2V A;  3AFJ A;  2F7P A;  1WMP A;  1OJP A;  2OW6 A;  2XHN A;  3DYM A;  3LOY A;  4OK4 A;  3W7X A;  2F18 A;  3VD4 A;  1NSX A;  1N7P A;  3N9H A;  3EJQ A;  1I8Q A;  1V7V A;  4BTY A;  3K5T A;  1W4N A;  1AVK A;  3K25 A;  2OQE A;  3MV1 1;  3Q1N A;  1MMU A;  3DX4 A;  2F7O A;  2BRV X;  3VDC A;  1OJM A;  1F1S A;  1JZ2 A;  1JYN A;  3D51 A;  2WGQ A;  1NSZ A;  4K3A A;  1R33 A;  1SIH A;  1DYU A;  1WMO A;  1UI8 A;  3EJT A;  1W2Z A;  3IAP A;  2CFD A;  3D50 A;  3IAQ A;  3TY1 A;  1JYX A;  2Y74 A;  4FNU A;  3W7U A;  3I3D A;  3HI7 A;  2WW1 A;  3AMO B;  3MWX A;  2Q1F A;  2CQS A;  3MPH A;  1JYW A;  2CG1 A;  3T0A A;  2C11 A;  1AVL A;  1EKM A;  3E1F 1;  5GW7 A;  5A1A A;  3MI6 A;  4UFC A;  3LVT A;  1TQV A;  2ZXQ A;  3AMO A;  1K1Y A;  3AFL A;  3BUB A;  2WW3 A;  2WYI A;  2F1B A;  3I3B A;  1K1W A;  3A24 A;  1Z45 A;  3VDB A;  1W5Z A;  3QFZ A;  3EJS A;  3DX0 A;  1HXK A;  3T2P A;  1C82 A;  1H54 A;  1N7R A;  3MUZ 1;  1W3Y A;  3VD3 A;  1YGA A;  3ACT A;  2OW7 A;  3CZS A;  3SX1 A;  3BVX A;  3NRE A;  2XSG A;  1UG9 A;  2ZQ0 A;  3X3X A;  1PX4 A;  3DX3 A;  1JZ8 A;  3OBA A;  4NEI A;  2WOH A;  2FUQ A;  1O7D D;  4KFD A;  3RSY A;  3W7S A;  1X1J A;  5JMD A;  2OQE C;  4RNL A;  1NSV A;  2WDA A;  1F4A A;  2F1A A;  2CQT A;  3SXX A;  3I3E A;  4FNV A;  1PS3 A;  1OJN A;  2EAC A;  1X1I A;  3S4C A;  2XN2 A;  3DYP A;  4MMH A;  2EAD A;  3BVW A;  1TQW A;  2CIS A;  3DX1 A;  2BRP A;  3BGA A;  1J0M A;  3RRS A;  1L7J A;  1LXK A;  2CIQ A;  4OK2 A;  3S4D A;  1J0N A;  1NS4 A;  1QAK A;  1D6Y A;  2CFL A;  2YFO A;  3EJU A;  4BZF A;  4BZE A;  3VSM A;  1MN0 A;  1LF6 A;  1QWN A;  1TU5 A;  3T0U A;  3BLB A;  2D1W A;  1SPU A;  2WO0 A;  3DDG A;  1LOH A;  3T0B A;  4FNS A;  1K1X A;  5CA3 A;  1LXM A;  3NBB A;  3W7T A;  3T08 A;  3SEP A;  1SNZ A;  1F9G A;  2FYV A;  3MUY 1;  1SII A;  2Y73 A;  3NBJ A;  1RWG A;  1TQS A;  1R34 A;  1LVN A;  4KTR A;  4OJZ A;  4FNR A;  1RWF A;  1IVX A;  2ZL8 A;  3HIG A;  3DYO A;  3BVV A;  1IVV A;  4J5T A;  3ECQ A;  1OAC A;  3DX2 A;  1QX1 A;  1HN0 A;  4FNT A;  3S4A A;  4K35 A;  1CB8 A;  1N7O A;  4FNQ A;  1IU7 A;  4MMI A;  2CWU A;  2EAE A;  3BUQ A;  2BRW A;  2XN0 A;  3OB8 A;  1W6C A;  4BZG A;  1KSI A;  1N7Q A;  4TTG A;  2BT3 A;  1MMZ A;  3WIR A;  2F7Q A;  3VDA A;  2W0Q A;  5KBP A;  1HTY A;  2E24 A;  1LUR A;  2CFG A;  2WW0 A;  1IQX A;  1V7W A;  1JZ5 A;  1QWU A;  3PGB A;  1HM3 A;  2WW2 A;  3A0O A;  1DP0 A;  3X3Y A;  1IQY A;  3WIQ A;  2CFK A;  1NS0 A;  1N9E A;  2E22 A;  1D6Z A;  1HN1 A;  1N7N A;  3CZN A;  1NS7 A;  3D4Z A;  2ALW A;  1MMX A;  3ALA A;  1NSR A;  3BS6 A;  3E80 A;  3EJR A;  3J7H A;  3D4Y A;  1US1 A;  3BVT A;  2X03 A;  3NJX A;  2WZS A;  3T2O A;  1NS2 A;  1LF9 A;  4DUW A;  3BLC A;  4AQ0 A;  2OOV A;  3BVU A;  4EV2 A;  3QDE A;  1TQU A;  1RJO A;  3S4B A;  3WFA A;  2XN1 A;  1PU4 A;  3BUI A;  2JKE A;  3ACS A;  4BTW A;  4FNP A;  2CIR A;  3W7W A;  3HII A;  2RDY A;  1RWH A;  2WOF A;  3BUP A;  2JKP A;  2F7R A;  1JZ6 A;  3VSN A;  1JYV A;  1RKY A;  3WA3 A;  3D3I A;  1TQT A;  4EV5 A;  1SO0 A;  3T0D A;  3D52 A;  1UI7 A;  3EJP A;  1V7X A;  1IVU A;  3VD9 A;  1D6U A;  2YX9 A;  4KFF A;  3QFY A;  5E1Q A;  3DCD A;  3X42 A;  3NJV A;  2C10 A;  1HMW A;  3CZJ A;  1NSU A;  3WA2 X;  2FUT A;  4DUX A;  1RW9 A;  2CG0 A;  3CV5 A;  1X1H A;  2PNC A;  1L7K A;  2CFW A;  3X40 A;  1JZ3 A;  1JOV A;  2WVY A;  4KTP A;  4KFE A;  1ULV A;  4BTX A;  3KN4 A;  1W7C A;  2EAB A;  3T09 A;  1W6G A;  1NS8 A;  3WVF A;  3X41 A;  1AV4 A;  1JRQ A;  3KII A;  3DEC A;  1WMN A;  1OJO A;  2D73 A;  2WCO A;  3BUD A;  4BZH A;  1EGU A;  1JZ7 A;  2CWV A;  2E2T A;  2WVX B;  1PX3 A;  1YQ2 A;  3T2Q A;  5JMF A; 
#chains in the Genus database with same CATH homology
 2X03 A;  1LOH A;  3OS7 A;  3NJX A;  2WZS A;  5A1A A;  3MV0 1;  1HMU A;  3T2O A;  3T0B A;  1NS2 A;  1LF9 A;  1K1X A;  1RWA A;  3BLC A;  4DUW A;  4AQ0 A;  1LXM A;  2ZXQ A;  3AFL A;  1K1Y A;  4DUV A;  1MMY A;  2HTA A;  3VD5 A;  2WW3 A;  2WVX A;  3T08 A;  2WVZ A;  1SNZ A;  3SEP A;  3VD7 A;  3I3B A;  1F9G A;  1NKG A;  1NSS A;  2JKA A;  3WFA A;  1JZ4 A;  3MUY 1;  1TXK A;  1RWG A;  1K1W A;  1HM2 A;  3A24 A;  2HTB A;  1Z45 A;  1RWC A;  1NSM A;  3IMH A;  3VDB A;  4OJZ A;  1F4H A;  3E7J A;  2JKE A;  1RWF A;  1OJP A;  2CIR A;  3T2P A;  1C82 A;  1N7R A;  3MUZ 1;  2XHN A;  3DYM A;  4OK4 A;  1W3Y A;  3VD3 A;  1YGA A;  3DYO A;  1RWH A;  3VD4 A;  1NSX A;  2JKP A;  4J5T A;  1N7P A;  3ECQ A;  1I8Q A;  3VSN A;  1JZ6 A;  1JYV A;  3NRE A;  2XSG A;  1UG9 A;  2ZQ0 A;  1SO0 A;  3T0D A;  1HN0 A;  1PX4 A;  1JZ8 A;  3K25 A;  3OBA A;  4NEI A;  1CB8 A;  3MV1 1;  1N7O A;  2FUQ A;  1MMU A;  3Q1N A;  4MMI A;  2BRW A;  2BRV X;  3VDC A;  1OJM A;  3OB8 A;  4BZG A;  1F1S A;  1JZ2 A;  1X1J A;  1N7Q A;  5JMD A;  1JYN A;  4TTG A;  3VD9 A;  1MMZ A;  1NSZ A;  5E1Q A;  4RNL A;  3VDA A;  3DCD A;  3NJV A;  1HMW A;  3CZJ A;  1NSU A;  1LUR A;  1NSV A;  2E24 A;  2WDA A;  1F4A A;  2WW0 A;  2FUT A;  3I3E A;  4DUX A;  1JZ5 A;  4FNV A;  1RW9 A;  1OJN A;  1X1H A;  1L7K A;  1X1I A;  1JZ3 A;  1HM3 A;  1JOV A;  3DYP A;  2WW2 A;  3A0O A;  2WVY A;  1DP0 A;  4MMH A;  1ULV A;  3IAP A;  3T09 A;  1NS0 A;  2CIS A;  2BRP A;  3BGA A;  1NS8 A;  3IAQ A;  1J0M A;  3WVF A;  1L7J A;  2E22 A;  1LXK A;  2CIQ A;  3TY1 A;  1HN1 A;  1N7N A;  4OK2 A;  1JYX A;  1J0N A;  1NS4 A;  1NS7 A;  4BZF A;  3I3D A;  3DEC A;  2WW1 A;  2WCO A;  1OJO A;  2D73 A;  3VSM A;  4BZE A;  1MN0 A;  3MWX A;  4BZH A;  1LF6 A;  2Q1F A;  1EGU A;  1JZ7 A;  2WVX B;  1MMX A;  1NSR A;  3BS6 A;  1JYW A;  1PX3 A;  3T0A A;  3E80 A;  3J7H A;  1YQ2 A;  3E1F 1;  3T2Q A;  5JMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...