3IMHA

Crystal structure of galactose 1-epimerase from lactobacillus acidophilus ncfm
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
SLKTNFVKYERKDNKDLCEITLENDAGMAVKVLNYGATLEKVLLDGENMILSLNSPEDYSKERNFLGGTVGRIAGRVRAGQWKHGNEIHQLPLNDGDNHIHGGIGTDMHVWDFRPSCDSEHARVDLTLFDPDGNNDYPGNLKLHARYELDNENNLHYLLEAVSDKLTIFNPVNHTYFNLGERAEDLNLQMNADYYLPVDEAGLPDRGMAEVAGTAFDFRKTKRIGDALNSDDSQIKLRNGLDHPFILNGNNPAALLSSNKHRLIVKTNAPALVLYAGNHFNHTGIVNNIGQYDGITFEAQCPPAEGNDLGQITLLPFEKFKRTVDWKFEEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Galactose-1-epimerase
publication title CRYSTAL STRUCTURE OF GALACTOSE 1-EPIMERASE FROM Lactobacillus acidophilus
rcsb
source organism Lactobacillus acidophilus
total genus 104
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3imhA00
1L7JA 1K1WA 1OJOA 2JKPA 2ZXQA 3MV01 1JYNA 2WW3A 1LXKA 3MWXA 1LF6A 1HN1A 1MMUA 1HMWA 3Q1NA 1RWGA 4DUXA 1JZ3A 1L7KA 1NSZA 2BRWA 4BZEA 2WVYA 3NJVA 2JKAA 3MUY1 1HM3A 3OBAA 2E22A 1HMUA 2WVXB 1ULVA 1J0MA 1PX4A 1NSXA 4AQ0A 3IMHA 1SNZA 3NREA 3DYPA 2CISA 4RNLA 2CIRA 1N7PA 2XSGA 1MN0A 1NS2A 1W3YA 3CZJA 2ZQ0A 1MMXA 1NS0A 2WW1A 5A1AA 1UG9A 1OJNA 1LF9A 1F4HA 1NS4A 3VD5A 1X1IA 3NJXA 1X1HA 1NS7A 1C82A 1HM2A 1F4AA 1MMYA 2BRVX 2HTAA 3MV11 3VD9A 2E24A 1F1SA 1NSRA 1I8QA 1JYXA 1LURA 2X03A 2WVZA 2CIQA 1F9GA 4BZHA 3DCDA 4BZFA 3WFAA 1K1XA 3E1F1 1NSSA 4DUVA 4TTGA 2BRPA 2HTBA 3VD4A 1JYWA 1YQ2A 2WW0A 1JZ4A 1PX3A 3SEPA 3VDBA 2WDAA 3DYMA 3DYOA 1JZ7A 1RWFA 1RWCA 3T0DA 3BGAA 1RWAA 3I3BA 3T0BA 1JZ8A 3OB8A 1NSUA 3VD3A 1Z45A 3T08A 1YGAA 1LXMA 1N7RA 3I3DA 3OS7A 1HN0A 1RWHA 5E1QA 3T2PA 2WZSA 3ECQA 1JYVA 1NS8A 1LOHA 2Q1FA 2WVXA 3J7HA 3A24A 2XHNA 3K25A 3VDAA 3DECA 1NSVA 3T2OA 1JZ6A 1SO0A 2D73A 1EGUA 1NSMA 1N7OA 1OJMA 3IAQA 3T0AA 1MMZA 4BZGA 3IAPA 1TXKA 1N7QA 1JOVA 2WCOA 1J0NA 1CB8A 3VDCA 1RW9A 1JZ5A 3T09A 1NKGA 3MUZ1 1K1YA 2JKEA 1N7NA 3T2QA 4DUWA 1JZ2A 1OJPA 1X1JA 1DP0A 3VD7A 2WW2A 3I3EA
chains in the Genus database with same CATH superfamily
1IVWA 1OJOA 4FNTA 2YFOA 1V7VA 4FNVA 1LXKA 3WIRA 1HMWA 1PU4A 3MUY1 1HM3A 2PNCA 1J0MA 1R33A 3HIIA 3W7WA 1PX4A 2WYHA 4AQ0A 1IQXA 2YFNA 2CISA 3T0UA 1N9EA 3BUQA 2XN0A 3D52A 1MN0A 3S4BA 1NS2A 3K5TA 2ZQ0A 3AMOA 5A1AA 2F7PA 3BLBA 1NS4A 3VD5A 1X1HA 2E2VA 2E2TA 1NSRA 1V7XA 2CG1A 1F9GA 3WFAA 2Y74A 2CG0A 3E1F1 4EV2A 3VSMA 1D6ZA 2F1AA 1PX3A 3MI6A 2WDAA 3EJPA 1TQUA 3T0DA 1KSIA 1US1A 4BTYA 1HWWA 3OB8A 3HIGA 3BUPA 3OS7A 5E1QA 4OK4A 1NS8A 4BTXA 2WVXA 3D50A 4OK2A 3K25A 5JMFA 3VDAA 1TQTA 5KBPA 1AVKA 5GW7A 3T2OA 4K35A 2D73A 1N7OA 3IAQA 4KTPA 4EV5A 4NEIA 1IU7A 1TXKA 2WCOA 3D51A 3EJRA 1NKGA 3MUZ1 1K1YA 1WMOA 1JZ2A 1TU5A 2WW2A 4FNSA 2F1BA 2D1WA 2JKPA 2ZXQA 1QALA 3CV5A 1V7WA 1JYNA 1IVVA 3A0OA 2CFGA 2CFKA 3LVTA 3E7JA 4FNPA 3Q1NA 1JZ3A 2YX9A 2EABA 3DX0A 1AV4A 2CQTA 2WVYA 2JKAA 3N9HA 3OBAA 1HMUA 3EJQA 4RNLA 1WMNA 2XSGA 3ALAA 2F7RA 1W3YA 1LVNA 2BT3A 1MMXA 1NS0A 2WW1A 1UG9A 3X42A 3ACSA 1NS7A 1C82A 1W6CA 2BRVX 3DX2A 3SX1A 3D3IA 1JYXA 1W5ZA 3DX1A 1LURA 3VSNA 3AMOB 4BZFA 3RSYA 4FNRA 1A2VA 4TTGA 3QG0A 3X3ZA 2CWUA 3DYMA 4BTWA 1JZ7A 1RWFA 2ALWA 3BGAA 3I3BA 3T0BA 1JZ8A 1HTYA 3VD3A 2WOFA 4KFDA 2FUTA 3AFJA 1QWNA 1HN0A 1RWHA 3QDEA 3ECQA 2Q1FA 3J7HA 4KFEA 1D6YA 1JZ6A 1IQYA 1OJMA 3T0AA 1N7QA 1QAFA 2F7OA 1RW9A 3S4AA 2CWVA 4DUWA 3T2QA 1JRQA 3QFZA 4OJZA 1DP0A 3DDGA 3D4ZA 1L7JA 1SIIA 1K1WA 1AVLA 3MV01 3BUIA 1LF6A 3DX3A 4DUXA 2RDYA 1L7KA 1NSZA 4MMHA 3W7TA 3TY1A 2CFDA 1ULVA 1W4NA 2OQEA 1SNZA 3NREA 2OW7A 3DYPA 1N7PA 2FYVA 2EAEA 3CZJA 3EJTA 2F7QA 3BVVA 2OQEC 1R34A 1SIHA 3BVTA 1LF9A 2WOHA 2CQSA 1HM2A 1H54A 1F4AA 1MMYA 3MV11 1I8QA 1DYUA 1SPUA 2WVZA 4BZHA 3NBBA 3WIQA 3DCDA 1K1XA 4DUVA 3PGBA 1TQSA 2BRPA 3X40A 4FNQA 1JYWA 1YQ2A 1JZ4A 3SEPA 4K3AA 1IVXA 4FNUA 1RWCA 1RWAA 3S4DA 1Z45A 3LOYA 3T08A 2FUQA 1QX1A 1YGAA 1N7RA 3S4CA 3ACTA 3T2PA 1JYVA 1D6UA 3A24A 2XN2A 1NSVA 3BVWA 1NSMA 1MMZA 4BZGA 2ZL8A 3EJUA 3W7XA 1W2ZA 3DX4A 3BUBA 1CB8A 2OW6A 5JMDA 1JZ5A 3BVUA 4KTRA 3WVFA 3KN4A 2JKEA 1WMPA 1X1JA 4MMIA 1RKYA 3BUDA 2WW3A 3MWXA 3EJSA 2WYIA 4UFCA 1HN1A 3CZSA 1MMUA 3WA2X 3WA3A 1RWGA 2BRWA 2W0QA 3AFLA 4BZEA 1W7CA 3NJVA 2EADA 2E22A 2WVXB 3BS6A 1NSXA 2CFWA 2EACA 3IMHA 3W7UA 2CIRA 1TQVA 1OACA 2CWTA 1O7DD 3D4YA 1OJNA 1EKMA 3X41A 1F4HA 1X1IA 3NJXA 2C10A 1HXKA 3MPHA 2HTAA 3VD9A 2E24A 1F1SA 2Y73A 3BLCA 2X03A 2CIQA 5CA3A 3KIIA 3HI7A 2WO0A 4KFFA 1NSSA 2CFLA 2HTBA 1QWUA 3X3YA 3VD4A 4J5TA 2WW0A 3VDBA 2C11A 3DYOA 1IVUA 2WGQA 1RJOA 3BVXA 3E80A 2XN1A 1NSUA 1W6GA 3CZNA 3SXXA 1LXMA 3I3DA 2WZSA 2E2UA 1PS3A 1LOHA 1QAKA 2XHNA 3DECA 3W7SA 1SO0A 1EGUA 3RRSA 3NBJA 2F18A 3X3XA 3IAPA 2OOVA 1JOVA 1J0NA 1UI7A 3DDFA 3VDCA 3QFYA 3T09A 1TQWA 1UI8A 1N7NA 2OOVC 1OJPA 3VD7A 3I3EA
chains in the Genus database with same CATH topology
1L7JA 1K1WA 1OJOA 2JKPA 2ZXQA 3MV01 1JYNA 2WW3A 4FNVA 1LXKA 3MWXA 1LF6A 3A0OA 3E7JA 1HN1A 1MMUA 1HMWA 3Q1NA 1RWGA 4DUXA 1JZ3A 1L7KA 1NSZA 2BRWA 4MMHA 3AFLA 4BZEA 3TY1A 2WVYA 3NJVA 2JKAA 3MUY1 1HM3A 3OBAA 2E22A 1HMUA 2WVXB 1ULVA 1J0MA 3BS6A 1PX4A 1NSXA 4AQ0A 3IMHA 1SNZA 3NREA 3DYPA 2CISA 4RNLA 2CIRA 1N7PA 2XSGA 1MN0A 1NS2A 1W3YA 3CZJA 2ZQ0A 1MMXA 1NS0A 2WW1A 5A1AA 1UG9A 1OJNA 1LF9A 1F4HA 1NS4A 3VD5A 1X1IA 3NJXA 1X1HA 1NS7A 1C82A 1HM2A 1F4AA 1MMYA 2BRVX 2HTAA 3MV11 3VD9A 2E24A 1F1SA 3BLCA 1NSRA 1I8QA 1JYXA 1LURA 2X03A 2WVZA 2CIQA 1F9GA 4BZHA 3VSNA 3DCDA 4BZFA 3WFAA 1K1XA 3E1F1 1NSSA 4DUVA 4TTGA 3VSMA 2BRPA 2HTBA 3VD4A 1JYWA 1YQ2A 4J5TA 2WW0A 1JZ4A 1PX3A 3SEPA 3VDBA 2WDAA 3DYMA 3DYOA 1JZ7A 1RWFA 1RWCA 3E80A 3T0DA 3BGAA 1RWAA 3I3BA 3T0BA 1JZ8A 3OB8A 1NSUA 3VD3A 1Z45A 3T08A 2FUQA 2FUTA 1YGAA 1LXMA 1N7RA 3I3DA 3OS7A 1HN0A 1RWHA 5E1QA 3T2PA 2WZSA 3ECQA 4OK4A 1NS8A 1JYVA 1LOHA 2Q1FA 2WVXA 3J7HA 3A24A 2XHNA 3K25A 4OK2A 3DECA 3VDAA 5JMFA 1NSVA 3T2OA 1JZ6A 1SO0A 2D73A 1EGUA 1NSMA 1N7OA 1OJMA 3IAQA 3T0AA 1MMZA 4BZGA 4NEIA 3IAPA 1TXKA 1N7QA 1JOVA 2WCOA 1J0NA 1CB8A 3VDCA 1RW9A 5JMDA 1JZ5A 3T09A 1NKGA 3MUZ1 3WVFA 1K1YA 2JKEA 1N7NA 3T2QA 4DUWA 1JZ2A 1OJPA 1X1JA 4OJZA 1DP0A 3VD7A 2WW2A 4MMIA 3I3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7J A;  1K1W A;  1OJO A;  2JKP A;  2ZXQ A;  3MV0 1;  1JYN A;  2WW3 A;  1LXK A;  3MWX A;  1LF6 A;  1HN1 A;  1MMU A;  1HMW A;  3Q1N A;  1RWG A;  4DUX A;  1JZ3 A;  1L7K A;  1NSZ A;  2BRW A;  4BZE A;  2WVY A;  3NJV A;  2JKA A;  3MUY 1;  1HM3 A;  3OBA A;  2E22 A;  1HMU A;  2WVX B;  1ULV A;  1J0M A;  1PX4 A;  1NSX A;  4AQ0 A;  3IMH A;  1SNZ A;  3NRE A;  3DYP A;  2CIS A;  4RNL A;  2CIR A;  1N7P A;  2XSG A;  1MN0 A;  1NS2 A;  1W3Y A;  3CZJ A;  2ZQ0 A;  1MMX A;  1NS0 A;  2WW1 A;  5A1A A;  1UG9 A;  1OJN A;  1LF9 A;  1F4H A;  1NS4 A;  3VD5 A;  1X1I A;  3NJX A;  1X1H A;  1NS7 A;  1C82 A;  1HM2 A;  1F4A A;  1MMY A;  2BRV X;  2HTA A;  3MV1 1;  3VD9 A;  2E24 A;  1F1S A;  1NSR A;  1I8Q A;  1JYX A;  1LUR A;  2X03 A;  2WVZ A;  2CIQ A;  1F9G A;  4BZH A;  3DCD A;  4BZF A;  3WFA A;  1K1X A;  3E1F 1;  1NSS A;  4DUV A;  4TTG A;  2BRP A;  2HTB A;  3VD4 A;  1JYW A;  1YQ2 A;  2WW0 A;  1JZ4 A;  1PX3 A;  3SEP A;  3VDB A;  2WDA A;  3DYM A;  3DYO A;  1JZ7 A;  1RWF A;  1RWC A;  3T0D A;  3BGA A;  1RWA A;  3I3B A;  3T0B A;  1JZ8 A;  3OB8 A;  1NSU A;  3VD3 A;  1Z45 A;  3T08 A;  1YGA A;  1LXM A;  1N7R A;  3I3D A;  3OS7 A;  1HN0 A;  1RWH A;  5E1Q A;  3T2P A;  2WZS A;  3ECQ A;  1JYV A;  1NS8 A;  1LOH A;  2Q1F A;  2WVX A;  3J7H A;  3A24 A;  2XHN A;  3K25 A;  3VDA A;  3DEC A;  1NSV A;  3T2O A;  1JZ6 A;  1SO0 A;  2D73 A;  1EGU A;  1NSM A;  1N7O A;  1OJM A;  3IAQ A;  3T0A A;  1MMZ A;  4BZG A;  3IAP A;  1TXK A;  1N7Q A;  1JOV A;  2WCO A;  1J0N A;  1CB8 A;  3VDC A;  1RW9 A;  1JZ5 A;  3T09 A;  1NKG A;  3MUZ 1;  1K1Y A;  2JKE A;  1N7N A;  3T2Q A;  4DUW A;  1JZ2 A;  1OJP A;  1X1J A;  1DP0 A;  3VD7 A;  2WW2 A;  3I3E A; 
#chains in the Genus database with same CATH topology
 1IVW A;  1OJO A;  4FNT A;  2YFO A;  1V7V A;  4FNV A;  1LXK A;  3WIR A;  1HMW A;  1PU4 A;  3MUY 1;  1HM3 A;  2PNC A;  1J0M A;  1R33 A;  3HII A;  3W7W A;  1PX4 A;  2WYH A;  4AQ0 A;  1IQX A;  2YFN A;  2CIS A;  3T0U A;  1N9E A;  3BUQ A;  2XN0 A;  3D52 A;  1MN0 A;  3S4B A;  1NS2 A;  3K5T A;  2ZQ0 A;  3AMO A;  5A1A A;  2F7P A;  3BLB A;  1NS4 A;  3VD5 A;  1X1H A;  2E2V A;  2E2T A;  1NSR A;  1V7X A;  2CG1 A;  1F9G A;  3WFA A;  2Y74 A;  2CG0 A;  3E1F 1;  4EV2 A;  3VSM A;  1D6Z A;  2F1A A;  1PX3 A;  3MI6 A;  2WDA A;  3EJP A;  1TQU A;  3T0D A;  1KSI A;  1US1 A;  4BTY A;  1HWW A;  3OB8 A;  3HIG A;  3BUP A;  3OS7 A;  5E1Q A;  4OK4 A;  1NS8 A;  4BTX A;  2WVX A;  3D50 A;  4OK2 A;  3K25 A;  5JMF A;  3VDA A;  1TQT A;  5KBP A;  1AVK A;  5GW7 A;  3T2O A;  4K35 A;  2D73 A;  1N7O A;  3IAQ A;  4KTP A;  4EV5 A;  4NEI A;  1IU7 A;  1TXK A;  2WCO A;  3D51 A;  3EJR A;  1NKG A;  3MUZ 1;  1K1Y A;  1WMO A;  1JZ2 A;  1TU5 A;  2WW2 A;  4FNS A;  2F1B A;  2D1W A;  2JKP A;  2ZXQ A;  1QAL A;  3CV5 A;  1V7W A;  1JYN A;  1IVV A;  3A0O A;  2CFG A;  2CFK A;  3LVT A;  3E7J A;  4FNP A;  3Q1N A;  1JZ3 A;  2YX9 A;  2EAB A;  3DX0 A;  1AV4 A;  2CQT A;  2WVY A;  2JKA A;  3N9H A;  3OBA A;  1HMU A;  3EJQ A;  4RNL A;  1WMN A;  2XSG A;  3ALA A;  2F7R A;  1W3Y A;  1LVN A;  2BT3 A;  1MMX A;  1NS0 A;  2WW1 A;  1UG9 A;  3X42 A;  3ACS A;  1NS7 A;  1C82 A;  1W6C A;  2BRV X;  3DX2 A;  3SX1 A;  3D3I A;  1JYX A;  1W5Z A;  3DX1 A;  1LUR A;  3VSN A;  3AMO B;  4BZF A;  3RSY A;  4FNR A;  1A2V A;  4TTG A;  3QG0 A;  3X3Z A;  2CWU A;  3DYM A;  4BTW A;  1JZ7 A;  1RWF A;  2ALW A;  3BGA A;  3I3B A;  3T0B A;  1JZ8 A;  1HTY A;  3VD3 A;  2WOF A;  4KFD A;  2FUT A;  3AFJ A;  1QWN A;  1HN0 A;  1RWH A;  3QDE A;  3ECQ A;  2Q1F A;  3J7H A;  4KFE A;  1D6Y A;  1JZ6 A;  1IQY A;  1OJM A;  3T0A A;  1N7Q A;  1QAF A;  2F7O A;  1RW9 A;  3S4A A;  2CWV A;  4DUW A;  3T2Q A;  1JRQ A;  3QFZ A;  4OJZ A;  1DP0 A;  3DDG A;  3D4Z A;  1L7J A;  1SII A;  1K1W A;  1AVL A;  3MV0 1;  3BUI A;  1LF6 A;  3DX3 A;  4DUX A;  2RDY A;  1L7K A;  1NSZ A;  4MMH A;  3W7T A;  3TY1 A;  2CFD A;  1ULV A;  1W4N A;  2OQE A;  1SNZ A;  3NRE A;  2OW7 A;  3DYP A;  1N7P A;  2FYV A;  2EAE A;  3CZJ A;  3EJT A;  2F7Q A;  3BVV A;  2OQE C;  1R34 A;  1SIH A;  3BVT A;  1LF9 A;  2WOH A;  2CQS A;  1HM2 A;  1H54 A;  1F4A A;  1MMY A;  3MV1 1;  1I8Q A;  1DYU A;  1SPU A;  2WVZ A;  4BZH A;  3NBB A;  3WIQ A;  3DCD A;  1K1X A;  4DUV A;  3PGB A;  1TQS A;  2BRP A;  3X40 A;  4FNQ A;  1JYW A;  1YQ2 A;  1JZ4 A;  3SEP A;  4K3A A;  1IVX A;  4FNU A;  1RWC A;  1RWA A;  3S4D A;  1Z45 A;  3LOY A;  3T08 A;  2FUQ A;  1QX1 A;  1YGA A;  1N7R A;  3S4C A;  3ACT A;  3T2P A;  1JYV A;  1D6U A;  3A24 A;  2XN2 A;  1NSV A;  3BVW A;  1NSM A;  1MMZ A;  4BZG A;  2ZL8 A;  3EJU A;  3W7X A;  1W2Z A;  3DX4 A;  3BUB A;  1CB8 A;  2OW6 A;  5JMD A;  1JZ5 A;  3BVU A;  4KTR A;  3WVF A;  3KN4 A;  2JKE A;  1WMP A;  1X1J A;  4MMI A;  1RKY A;  3BUD A;  2WW3 A;  3MWX A;  3EJS A;  2WYI A;  4UFC A;  1HN1 A;  3CZS A;  1MMU A;  3WA2 X;  3WA3 A;  1RWG A;  2BRW A;  2W0Q A;  3AFL A;  4BZE A;  1W7C A;  3NJV A;  2EAD A;  2E22 A;  2WVX B;  3BS6 A;  1NSX A;  2CFW A;  2EAC A;  3IMH A;  3W7U A;  2CIR A;  1TQV A;  1OAC A;  2CWT A;  1O7D D;  3D4Y A;  1OJN A;  1EKM A;  3X41 A;  1F4H A;  1X1I A;  3NJX A;  2C10 A;  1HXK A;  3MPH A;  2HTA A;  3VD9 A;  2E24 A;  1F1S A;  2Y73 A;  3BLC A;  2X03 A;  2CIQ A;  5CA3 A;  3KII A;  3HI7 A;  2WO0 A;  4KFF A;  1NSS A;  2CFL A;  2HTB A;  1QWU A;  3X3Y A;  3VD4 A;  4J5T A;  2WW0 A;  3VDB A;  2C11 A;  3DYO A;  1IVU A;  2WGQ A;  1RJO A;  3BVX A;  3E80 A;  2XN1 A;  1NSU A;  1W6G A;  3CZN A;  3SXX A;  1LXM A;  3I3D A;  2WZS A;  2E2U A;  1PS3 A;  1LOH A;  1QAK A;  2XHN A;  3DEC A;  3W7S A;  1SO0 A;  1EGU A;  3RRS A;  3NBJ A;  2F18 A;  3X3X A;  3IAP A;  2OOV A;  1JOV A;  1J0N A;  1UI7 A;  3DDF A;  3VDC A;  3QFY A;  3T09 A;  1TQW A;  1UI8 A;  1N7N A;  2OOV C;  1OJP A;  3VD7 A;  3I3E A; 
#chains in the Genus database with same CATH homology
 1L7J A;  1K1W A;  1OJO A;  2JKP A;  2ZXQ A;  3MV0 1;  1JYN A;  2WW3 A;  4FNV A;  1LXK A;  3MWX A;  1LF6 A;  3A0O A;  3E7J A;  1HN1 A;  1MMU A;  1HMW A;  3Q1N A;  1RWG A;  4DUX A;  1JZ3 A;  1L7K A;  1NSZ A;  2BRW A;  4MMH A;  3AFL A;  4BZE A;  3TY1 A;  2WVY A;  3NJV A;  2JKA A;  3MUY 1;  1HM3 A;  3OBA A;  2E22 A;  1HMU A;  2WVX B;  1ULV A;  1J0M A;  3BS6 A;  1PX4 A;  1NSX A;  4AQ0 A;  3IMH A;  1SNZ A;  3NRE A;  3DYP A;  2CIS A;  4RNL A;  2CIR A;  1N7P A;  2XSG A;  1MN0 A;  1NS2 A;  1W3Y A;  3CZJ A;  2ZQ0 A;  1MMX A;  1NS0 A;  2WW1 A;  5A1A A;  1UG9 A;  1OJN A;  1LF9 A;  1F4H A;  1NS4 A;  3VD5 A;  1X1I A;  3NJX A;  1X1H A;  1NS7 A;  1C82 A;  1HM2 A;  1F4A A;  1MMY A;  2BRV X;  2HTA A;  3MV1 1;  3VD9 A;  2E24 A;  1F1S A;  3BLC A;  1NSR A;  1I8Q A;  1JYX A;  1LUR A;  2X03 A;  2WVZ A;  2CIQ A;  1F9G A;  4BZH A;  3VSN A;  3DCD A;  4BZF A;  3WFA A;  1K1X A;  3E1F 1;  1NSS A;  4DUV A;  4TTG A;  3VSM A;  2BRP A;  2HTB A;  3VD4 A;  1JYW A;  1YQ2 A;  4J5T A;  2WW0 A;  1JZ4 A;  1PX3 A;  3SEP A;  3VDB A;  2WDA A;  3DYM A;  3DYO A;  1JZ7 A;  1RWF A;  1RWC A;  3E80 A;  3T0D A;  3BGA A;  1RWA A;  3I3B A;  3T0B A;  1JZ8 A;  3OB8 A;  1NSU A;  3VD3 A;  1Z45 A;  3T08 A;  2FUQ A;  2FUT A;  1YGA A;  1LXM A;  1N7R A;  3I3D A;  3OS7 A;  1HN0 A;  1RWH A;  5E1Q A;  3T2P A;  2WZS A;  3ECQ A;  4OK4 A;  1NS8 A;  1JYV A;  1LOH A;  2Q1F A;  2WVX A;  3J7H A;  3A24 A;  2XHN A;  3K25 A;  4OK2 A;  3DEC A;  3VDA A;  5JMF A;  1NSV A;  3T2O A;  1JZ6 A;  1SO0 A;  2D73 A;  1EGU A;  1NSM A;  1N7O A;  1OJM A;  3IAQ A;  3T0A A;  1MMZ A;  4BZG A;  4NEI A;  3IAP A;  1TXK A;  1N7Q A;  1JOV A;  2WCO A;  1J0N A;  1CB8 A;  3VDC A;  1RW9 A;  5JMD A;  1JZ5 A;  3T09 A;  1NKG A;  3MUZ 1;  3WVF A;  1K1Y A;  2JKE A;  1N7N A;  3T2Q A;  4DUW A;  1JZ2 A;  1OJP A;  1X1J A;  4OJZ A;  1DP0 A;  3VD7 A;  2WW2 A;  4MMI A;  3I3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...