4K3AA

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
720
structure length
720
Chain Sequence
GDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
total genus 249
structure length 720
sequence length 720
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k3aA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k3aA04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k3aA02
3BUIA 3S1KA 1NVOA 4CPGA 3MHVA 4KJMA 1OVVA 4IOIH 1OVUA 2OW6A 1TQSA 2SPZA 3EJQA 4ASVA 3D51A 1LT1A 2ALWA 3CZNA 3DDGA 2KUBA 3BVTA 4HJGH 4NPDA 3DX0A 3DX3A 2F1AA 1H0TA 4NPEA 2QVAA 2KI7B 1JM0A 2KS1B 2LR2A 2RKLA 4GOEA 1R33A 2F18A 1SS1A 4EYYQ 1HTYA 4JBZA 1BDCA 3D52A 2B87B 1R34A 2KZIA 1HXKA 3DX4A 1QWNA 3BLBA 2WYHA 2OW7A 3BUPA 1OVRA 2HR3A 2F7PA 2P58A 3BUQA 3ZDMA 1BDDA 2LXCB 2UWJE 2M5AB 1TQUA 1QWUA 2ZAEB 3CZSA 1MFTA 2QRXA 4MN4C 4K35A 4NPFX 4ZMDA 1TQVA 5CBOA 3QWOC 4HB1A 2B88A 2B89A 3EJSA 1FC2C 5C39A 2F7QA 3BVWA 5KBPA 2B87A 1Y47A 2F1BA 3DDFA 1LP1B 3EJRA 1X0TA 1TQWA 4ASWA 3CV5A 1O7DD 4BXLA 2R44A 1ZXGA 1U7JA 5DJTB 3BVUA 3BVXA 1S3JA 2Q1KA 1Q2NA 1PS3A 5K5GB 2F7RA 3BVVA 4WWIA 1EDJA 3EJTA 3LVTA 2F7OA 1U7MA 3EJPA 4HKZH 2OTKE 3FXDA 3BUDA 2WYIA 1ZW0A 2M0BA 2I8DA 3MZWB 3D50A 5EFWB 4GODA 1LP1A 5CBNA 2KZJA 3BUBA 3PH0A 2JWDA 4GOFA 1EDLA 3D4ZA 1H0TB 2LXBA 4K3AA 3DX2A 4ZNCA 1EDIA 1HWWA 2M5AA 1QX1A 1TQTA 3EJUA 1EC5A 2KIKA 1DEEG 2WMMA 2K3RA 3RGUA 2FYVA 3DX1A 5DJUB 3FXEA 1EDKA 3D4YA 1JMBA
chains in the Genus database with same CATH superfamily
2OCCC 5IYDO 2ZQMA 4LR3A 3S1KA 4NTYA 4CH5A 3SEPA 4DRXA 4FZ0A 3RYIB 4LH6A 1L2PA 2M3BA 4CPGA 3SYAA 2Q5UA 3RWRD 2XU6A 2JJ2G 1KC8Q 3G71P 3EJQA 2SPZA 4UCTA 2DYSB 2ZT9B 3NJXA 4L76A 3C3TA 3H9VA 2UXXA 2K9YA 1MSDA 5AW0B 4PD4F 2M3EA 3HUSB 3ZRWB 3CL3D 3U11A 1KQGB 4FVMA 2E74C 1X79B 2ZNJA 4KTPA 1OCCC 4UVAA 3H01A 1VQ8V 2WA3A 3L71J 3ACSA 3OA7A 4PJ0H 2E75C 1OACA 3RK3E 1VQPV 2JO1A 3IGAC 2KLVA 1JZ3A 3WU2E 3HKDA 4IL6H 2PGGA 2VWKA 3CCVP 1QVGU 5EBMC 4RKUJ 2P58A 1IK9A 3RYFA 3BUQA 2HHHO 4JI3B 1BDDA 2V7QG 3RBXA 4F6RB 1J95A 2UWJE 1JRQA 3OGCC 2OCHA 1H38A 2DWDC 1SQPE 1UI7A 2EADA 5CA1A 3H1KJ 3WB2A 2H89C 1JR9A 3HD7C 2EABA 2P1JA 1YDXA 1GL2A 1M8OB 2WSCJ 4ZMDA 3MD0A 2YKPA 3C9IA 2Q4PA 4GKJB 4X8AA 3RL0g 1HN0A 1M90W 1BHAA 1QU7A 2W6JH 2RMZA 2HG5C 2ADQB 3ZHSA 3IAQA 4UXNA 3S4CA 3ZHVA 4O4JA 3M0DC 3H1IE 3CWBD 1LP1B 4WFFA 1GTWA 5J2TB 1OX3A 1OV9A 3FD9A 2I1JA 2RH0A 4G2KA 1AI5A 1BGYD 1RPOA 3APOA 1B6QA 3L70D 5CCHA 1N4CA 1H2GA 4R4MA 1YVWA 1M57D 4BTXA 1Q6HA 3DTUB 2UUBB 2QJKB 3QVNA 2PI5A 1EDJA 4X64O 2A7WA 2Q7CA 2Q6QA 4IYHA 1GMGA 2F1MA 1UIXA 2IZ1A 2PNCA 2BE3A 2IH3C 1P7BA 5JVDB 5CBFA 4WFBV 2C9LY 4CS2A 4DJGA 3I56P 1W0JG 2WAMA 2Q9IA 1ZL8A 1CI6B 3AG3C 1HR0B 2KZJA 1XNRB 2FB5A 1OW7A 1RH5B 1VQ6P 2XNDG 3HB3B 2G38A 1MABG 1SQBG 3P8MC 4BTYA 4W7ZA 4I50A 1VEWA 3M7MX 3J7AU 3KHUA 4TLFA 3SWFA 2LFSA 1Y67A 4K8XA 5FNVA 4JI6B 1EZVG 4GKKO 4H13D 3N7NA 3WU2H 3A0OA 3A7OA 2YIUC 1OMIA 2K9JA 2ZR3A 2K1AA 4JYAB 2Z5HA 3CC4V 4MVRA 1SQPH 1VQ9P 1PU4A 1THZA 3V4WA 4J80A 3G3ZA 1KILA 4ZKIA 1QHTA 3MUDC 2Q67A 4C7RA 4ASVA 1NH4A 4OGQB 5IT9N 5CCGA 2OTLP 2AXCA 1G4YB 2C0XA 1NVPB 4AUWA 5CBHA 2F1AA 1FZAA 2ZCEA 5JCOC 2PP6A 1BCCG 3H1IH 3OT7A 4PHZA 1VQKP 4BIZA 4IGGA 4NEIA 1FDMA 2ZE8A 4BZFA 1JNMA 2FYUE 1QR9A 4YIPA 5IYZB 3ZMTA 3ABVC 1VQ4V 2RDYA 3D6ZA 2KZIA 5GTIZ 3MPHA 4TUYA 5APWA 1PNMA 5BR8O 1XEQA 5CA0B 1OHHG 5AW3B 1KILD 1FAFA 3NR7A 2WSSH 3GMAA 4O2BA 3NBBA 4DUWA 1M56C 4B7KA 1OXZA 2J58A 5CHXA 4LFAO 5CCGD 5KLVG 1LTGC 4DK0A 5BXZA 3JSNA 1IFDA 1SZTA 1RQVA 3L36A 1XMOO 1VQMP 3LW5H 2K37A 1Y9BA 4FNUA 3QO5A 3G9RA 2EACA 1SQBK 2JDIG 2CPSA 4LBEC 3SPJA 1SQVG 1XREA 2HFEC 1SFCD 4J41A 3MIWA 1Q81Q 3ZHRA 2D3OW 2ADPA 1SQQJ 5FLXN 1FZCC 1CB8A 3T1YB 2KLUA 1JYXA 2LFRA 5L3BA 1NU1G 1AJNA 2HTBA 2CG0A 3FB7C 3RW0A 3WUVA 3JATB 3ZIAG 3EHBB 3L35A 4N23A 1L0NG 1S76D 4HH2A 4JI8B 2EZPA 3HKEB 1NYHA 1HN1A 4RESB 1N7NA 1AFOA 2OQQA 4FLXA 4P2ZA 5KJ7A 1NO4A 1QL2A 3D36A 1Y74A 1BS3A 2FKXA 2WPDG 1J1EC 1NTZG 1N7SA 2FXMA 1GK4A 4CH6A 3S4DA 3TDKA 2LGWA 3MZWB 1JY3P 2BCCG 2QWOB 2YI8A 5AVTB 3WFAA 4QGPA 1AA0A 2WSFJ 4U3FJ 1T2KD 5KHGA 3JSVC 1EDLA 4NTXA 1PPJD 4JI7B 1ZMEC 3E1IA 2FYUH 4LH7A 1PPJE 1RF1C 1NKNA 3Q4HA 2M5AA 2JGUA 5KA6A 1SIHA 4NKGB 2XHNA 1G2CA 1Q8IA 1HNWO 1URQA 2QA4V 5JJJB 1LTJB 1SPUA 2Y69C 3G4SV 1AJPA 1ZP0C 3N2GB 5DJUB 2Q3EA 4X88A 5BMVA 2LQTA 2G3AA 1BE3E 5KJ7D 5KLVK 1NSSA 1Q7YW 3VN0A 1JVMA 3ZJZA 2IJJA 3S4AA 5KAFE 1W5ZA 2OQEA 5IDJA 1SQBE 1N7QA 1SQVK 2FFDA 3QNEA 4R4LA 4TWKA 3HKCB 5JH7A 5JQGB 1N73B 2ITDC 2VQFO 3RVZA 3MGNA 3K0DA 2YXYA 1H0TA 1S5HC 1IXMA 2CTWA 5APUA 3CCLV 1R3KC 4FLTA 4CH4A 1NU1K 2W27A 1GU5A 3H1HJ 3IAOA 5B1NA 1X4TA 3OAKA 2V7QH 5GTIH 4W80A 1R33A 2F4VO 1HTYA 1L0NK 5CBGA 3JD2A 1HJ0A 1I08A 1VQOP 3H1LD 4MS2A 1QWNA 2QM8A 3RSYA 3L73G 3GWOA 1DIPA 1X1HA 3UM7A 1OVRA 2HR3A 2ARHA 2OYOA 3B8EB 1SQFA 2Q9LA 4BRYB 1VF5C 2GUZB 1NTZK 1AJYA 5AW9B 1F4MA 1L0LJ 1BCCE 4ZHQB 1YTZT 2QRXA 2ZM6B 2KK7A 1HUCA 4TV8A 4UB6Z 2IU3A 2BOBC 4YJ2B 3C8VA 4U3FD 3DSQA 4WVZA 3B77A 4E2LA 3ZCCA 4WY4B 2GBOA 3CMAP 3FB6C 4UB8Z 1KYOD 5LA6A 3H1JG 2F1BA 3T0AA 1TQWA 2WVXA 1RE4C 2R3CA 3MWXA 1IBMO 3KQGA 2WW0A 3N2KA 1ROPA 2X03A 4NYKA 5KLVE 1GN3A 3TNUB 1K8AQ 2WW1A 3T1HO 2KG7B 1BE3H 1JTHB 3VD9A 3WG7C 3L73J 3AECC 5CMZA 5LYJB 5KAFH 2ZE5A 2XNDH 1SQBH 4Q6GA 3W7UA 2K1EA 2B9ZA 3WUTA 1LXKA 4QE7A 1R6KA 2OTKE 3M8AA 4DRXB 1C82A 2CIQA 1R3JC 3RK3C 2QWNB 4LC1A 1BSNA 2YXQB 3L37A 4DV1O 4UCRA 1YTFD 1R6NA 1NU1E 4WFGA 1LTIC 3RL0C 2HLDG 1KYOF 1LTAC 3B5NC 1VP7A 4DV6O 3CS5A 3HD7A 1L0NE 4DR6O 3I3BA 3ZN1A 1TGOA 1XDCA 4B86A 3K3WA 4CH3A 1ZRTE 1ZR2A 1PFIA 1PP9J 1FS0G 2E74D 1NKZB 4EV5A 4H0LB 2XDJA 2IJKA 1ZR4A 3KDPB 2K3RA 1QVGO 1RKYA 4B7EA 2YEVA 3AE6C 1NTZE 3M0DA 3JD1A 2E5YA 5DM6V 5EC2C 3NREA 2N1TD 2WVRA 3D70A 3CRCA 3RFRA 1Q81W 2K9PA 4PDVA 2UXCB 2BCCE 3HKDB 3R4YA 1BCCH 2EIKB 1YSCA 4UCOA 3E8FA 1VQ5P 1BQ0A 3BCCE 1TQSA 1W3YA 1RW9A 3SYQA 1Y76A 2QWRB 3AG1B 1Q82Q 1NGMB 1K97A 1M57B 1WP7A 5CA1B 5LMNO 1N7PA 1N8RQ 4FFKA 3IJ4A 3A0HE 3GF7A 3HD7D 4GKGA 3QFZA 3K9SA 5AVQB 3BS6A 5LXTA 1GL2B 1IFJA 2IW5A 3G80A 3ZHTA 5CMUA 3OFNG 1IZNB 2CTQA 3K58A 2QJPB 2HG5D 4DR4B 2PTMA 5J9PC 2N9BA 2F18A 4O4JB 2YIBA 3PGBA 3CE2A 5KLVH 4DK1A 2RN9A 3CLQA 4DR5B 5GW7A 3P32A 4JGSA 2QSIA 3AE4C 2CFWA 5KKZC 2PZSA 4FPPA 3TSIA 1SQVH 4PDLA 1GRJA 4H13B 1M1JB 4JI0O 3ZX6A 3BA8A 4UB6H 2RDCA 4OXSA 4D6TG 3J81N 4LF5B 1L4AC 3B71A 1NU1H 3WIRA 4GX2A 2UXDO 3IFXA 1DX7A 1W7CA 4JI5B 5F2VO 3IC9A 2FUTA 1L0NH 2E42A 2XAQA 3E8HA 3MUDA 1ZL8B 2ILMA 2WTYA 5KAIZ 2A79B 2HYNA 4PV1D 3SFEC 4Z2WA 3T0BA 1NKDA 3ZMSA 4BXLA 2KB1A 4L87A 3THOA 3P30A 4I50B 5JCOA 2YS8A 3WA3A 1NTZH 3AEEC 1KQSU 4JV5B 5ITZA 3BVXA 5FNVB 5B5EE 3LDCA 3L75D 2BCCH 2WWWA 3M0AA 3OD4A 3BVVA 4WWIA 4DUZO 2XAFA 1KQLA 2K9JB 2JK5C 4NXNO 1KKCA 1R5SA 1QVFO 2A45H 3BCCH 4I0XA 4DV0B 3U10A 3UO2A 3CRQA 3H1JE 4YXDC 1OIPA 3A2AA 1AR1B 2OYIC 3U1AA 1KILB 2E76D 4BR6A 1ZW0A 2KB7P 3Q1MA 1AP6A 3F89A 2DYRC 1AR4A 4I5SA 4J7ZA 1K92A 2IJHA 1WPXA 4LF4O 4X1YA 2AHZA 3PJSK 1MNGA 5B66Z 3I3DA 2QJYB 2LXBA 1KMIZ 3SR2C 2H3OA 4TTGA 3EFFK 1OW6A 1NTMG 1YJWV 3X2QC 2KIKA 1NTKG 1I5YA 2JIZG 2FYVA 4DR3B 3CHXA 2XKMA 1ZUQA 3CC7V 3DX1A 2WLMA 1L7JA 2PUSA 2AXTZ 3G67A 4X89A 2FMLA 1YI2P 2RNBA 1FKAO 4TUYB 5FPOA 1FZCA 1SFCC 2Y0IA 4KHXA 2WSEH 4BIUA 1MMUA 1OVUA 5IJ9A 3EWKA 4W7YA 3ITKA 4O2BB 4WBNA 1M56D 1OWAA 1OJPA 3CRRA 4BWAA 1F9GA 4IL6X 1N33O 3SJAC 5B66E 3P7KA 5K1PA 1JM0A 1HTLC 4JAAA 1H2KA 2QTSA 3M9BA 2RKLA 3TGUG 3L74G 3T2QA 3G71V 2OARA 4DYLA 2HFED 2DQ0A 5IY5C 1F7YA 1CEZA 2A06G 5L8RJ 2BRPA 1VQNP 4J5TA 3IR9A 2UXNA 1R34A 1G1JA 4OK2A 2AXTE 3TJTA 5B5EH 3OW2U 2POHA 5EYPA 1SQXD 5B1AB 2WPQA 1RF1A 2EJRA 3L72D 3ZDMA 1NH2D 1JPXA 2P10A 3CMEV 1MOFA 1TAEA 3DCDA 2XHBA 1MMXA 2WT7A 5AG2A 4LF8O 1T2KC 2JGDB 4QNHB 1D6UA 3JAKA 3H1JH 1OZHA 1IBLO 1HDJA 3K5TA 2ZL8A 1NSZA 1F23A 2LW1A 3X3ZA 3VDAA 1TQVA 1WB8A 1Y74B 4JI4B 5IE9A 4B3SB 1R1BA 3EJSA 1FC2C 3KZIE 1N7SB 1OCRC 2CFDA 1JOVA 5LHGA 1Q86Q 3BVWA 1NTMK 3RBZA 2P4KA 2KSDA 4X62O 5AVUB 5KBPA 1NTKK 2UUAO 3O8ZA 3TGUJ 2YDEA 4LF7O 2R5DA 3L74J 3OMIB 1K1WA 1UG9A 1JY2P 2X6CA 1Q82W 3OTOO 4J9ZB 1N8RW 3Q4HB 1WT6A 4KFDA 4BWNA 2OIEA 4D6TE 4JI1B 5L3FA 1G2CB 4Z1MH 1URQB 4HYTB 1P84E 1LWUC 4UV9A 4FLYA 3MUZ1 2M7WA 2A45I 5B1OA 5BMVB 3O6QA 5C93A 3E1F1 4LF9B 3AE8C 4ZI7A 4DR6B 4HKZH 4H33A 4JYYA 4EOTA 4F4LA 1NS2A 1N2DC 3CWBG 5B66H 1IU7A 1ZTEA 3OR6C 3P8CE 1HNXB 3I55V 3BUBA 2WCOA 2WLHA 5JH7B 4L74A 1HBWA 3OR7C 2HJDA 1BGYG 1OFCX 4ZKPA 1H0TB 1W59A 3FX7A 1L8DA 1HWWA 3FFQA 3L70G 2XSGA 1SRYA 3PP5A 3I56V 4IL6E 2HPCA 2XN2A 4MMIA 1GW4A 2AXTH 1R73A 2N9YB 1AP5A 4PELA 2XAJA 4OX9O 3H25A 1HM2A 2Y48A 2ZIMA 1VQ6V 2EILB 2GA1A 2YO2A 4JI2B 3LIEA 3HIIA 5LMNB 1W6GA 2JS3A 4PA3A 5KLIC 1HW7A 1RE4A 1LXMA 2WGQA 5AW5B 5B3SB 4AI8A 2IFMA 1NVOA 2GV9A 3V2NA 3K03A 2AEMA 3K25A 2KSEA 1OVVA 1M9NA 4KJMA 4OPAA 1LT9C 4JZ2A 5KHJA 2K88A 3E86A 3RGBA 1QAKA 4HJGH 1BT8A 3OUSA 1NTME 2IPPA 3L71G 1I7FA 4NPDA 3V2QA 3VMZA 1NQTA 2HEPA 1H89A 2IBZE 3CWBJ 1AJQA 1NTKE 5C8YA 2MW2B 2Y0DA 1GU4A 2KG7A 2OCCB 4N6JA 2OYHC 4TV8B 4RNLA 1AI6A 4BTWA 3MDSA 3CCSP 3GG2A 1RWCA 2QR4A 3A8TA 4OJZA 2A3QA 2ZQ0A 4EB6A 1YBKA 3L70J 3TY1A 2XT9A 5LA6B 2B1IA 4B3MB 3E8GA 2WVXB 5BU8B 1NBMG 3H1KG 3B5NA 3A0BZ 1T5EA 1WP8A 4MW3A 4D6TH 3N2KB 3QF7A 1SZXA 2M6YA 1P84H 2MJZA 4BZHA 2UXDB 4U7JA 1ZX3A 2WPVB 2E74B 2ZIOA 2CIRA 3X40A 4WFAV 1SETA 1N34O 1OCCB 1B04A 1F4AA 3OJAB 5IYCO 2NNUA 5EZYA 3W7WA 3CCEV 1ZLLA 2E75B 1ORQC 3E7JA 2XAHA 3ABKC 1USDA 3AE5C 1X9VA 3N4XA 4EEQA 3LNMB 1IVXA 4DV7O 3CX5E 3RK3D 2KNCA 4I9QA 4DW0A 2N1TC 2P67A 2B87A 4CS4A 3W7TA 1DF5A 4DV5O 4B08A 1QNMA 1VQMV 3RL0D 1O7DD 4DUZB 1JUNA 3X3XA 3CD6V 1IC2A 3B5ND 3HD7B 3BEHA 4X66B 4YXWG 4MT8A 1NOHA 3E7KA 1SQPD 1VQ7V 4M3LA 3V5BA 1Q6IA 3FAVA 2JS5A 4PI2A 4LFCB 1IBKO 1N0JA 2YEVB 1YGAA 2H7HA 2ITCC 2DOSA 1MG1A 4GUNA 3IFMA 1NTMH 3H1ID 2WYIA 4DUVA 1Q7YQ 2IBZH 5JWPA 1MUUA 1NTKH 3WMM0 2W90A 1Y66A 1FOSE 1Y76B 1S72P 1AVLA 3OMAB 1K4CC 2P4VA 3RVYA 4OK4A 2DMXA 1EFRG 2AGAA 2QSAA 3R2PA 1V55C 2XN1A 5LXTB 2W83C 1M1JA 3V2RA 1L4AA 2P6JA 4FM2A 2J5UA 4FM0A 2WMMA 1LTTC 2F95B 4MVQA 1J5EB 4PD4H 2ODMA 3ASNC 1W0KG 5JJEB 1Q86W 3AG3B 2EZOA 2YICA 4O4LA 3CCUP 3CZJA 1ZAUA 2LO1A 1F51A 2XUMA 3K5BA 1FJGO 1N32O 2F43G 1E5WA 1EN6A 4PV1C 1FXKC 2VQEB 1Z2GA 1HVVA 2EIMC 5H5NA 5LBQA 1U97A 2LP7A 3CCQV 3HI7A 1WMKA 2YIUB 3ZMUA 1WRGA 3CX5H 4DV3B 4MVMA 2HLOA 3BRCA 3TYYA 2FKWB 1AR5A 4N3YB 3HKBA 2P2UA 2ZXWC 2O01J 3CCRV 1R3IC 4GX0A 4GX5A 4QPKA 1L4AD 3TXQA 3JAWA 1M1KW 3KYQA 2OYIA 3I5CA 2EIJC 2E43A 1EBOA 1BSHA 1D5NA 2JJ1G 1LVNA 3ABMC 5H6QA 4B3RB 4B3TO 1XNQO 3Q3DA 2Z0AA 1ZV8A 2HODA 3G6BA 4U7OA 2E76C 4EIJA 1KECA 2IU0A 1YHQP 1XOUA 3CCJP 2QKAA 3L71E 4R6ZA 1KUQA 1P84I 4MVZA 5ITZB 2PYLA 1RWGA 1IVVA 3SJCC 4QPJA 3SXXA 4RO2A 4FLZA 4UFCA 1PGJA 4LF7B 2Q7HA 4NPFX 4UUJC 4I0XB 2WVZA 1SS3A 2E5LO 1SFCA 1SQQG 4DV4O 2FYUD 2C9NY 2UXBO 2Y4TA 3IF4A 3F5HA 1YJNP 3K06A 3UT5A 3CC2V 3OTFA 4HYOA 3U59A 4IIJA 3DDFA 1M56B 4DO2A 4MVUA 1D7MA 4X1YB 1AV1A 1PL5A 2D2CD 1WAZA 3W7XA 4X65O 2YIDA 3LIDA 3QFYA 2QWPB 2BRWA 4LFBO 3VD4A 5DJTB 5LGNA 1KB9E 2L6LA 4YHHB 4QJFB 3R65A 1IO4A 2OTJV 3VYIA 4G28B 3LVTA 4FMTA 4FLUA 4W4LA 1BGYH 2RQ6A 1ZN5A 4DV2B 3W7SA 4U3FG 1FZCB 3NJVA 3M9QA 3BUDA 2PAJA 1QR8A 4CC5A 1USEA 1IVUA 4P9OA 1JYWA 1H54A 1NH2B 5IJ9B 1YXBA 1JY3O 3FB5C 2IBZI 1VF7A 1FFTB 3AEIA 5TISZ 4WBNB 1JZ7A 3JD3A 5GTIE 1ZLZA 4KFFA 4GOFA 3BGAA 2EINB 4FFBA 2GTSA 1URFA 1QX1A 4JTCB 1TQTA 3H1LJ 2QTOA 1O9GA 1CPYA 2JGDA 2YC0A 3DXRB 1YQ3C 5BVZA 1FXVA 4YJ3B 1J1EB 5APQA 3ETQA 2EX3A 2EINC 1I94O 2CUGA 1PGPA 3OE7G 3E35A 2H94A 4PD4I 3L71H 1Y6XA 3PN1A 2ZKOA 4GLXA 4BAYA 1IZ3A 4KP4A 5EYPB 3SWYA 2NN4A 2W6AA 1JYNA 4H44C 2RN0A 2WQYC 4TT3H 1RF1B 3Q1NA 2DQ3A 1SQQK 2DN9A 4ZIBA 2WT7B 3CYOA 3DC6A 4N78E 3BVTA 3H1HG 1RQUA 3JAKB 4FJCC 1J2JB 1LGHB 2RCVA 5M1BA 4DOJA 1LWUA 3CX5I 2Y69B 1GH6A 4J7KA 3CCMV 3H1KH 2A0LA 4CBCA 1XBLA 5LHIA 4FM1A 2WSCH 4GT1A 2IJIA 2FUQA 3CXHE 3BRTB 4U3JA 4UVBA 1BE3D 3JCUZ 3J7HA 1N34B 1L0LG 1KB9H 4P30A 2Z5IA 2NPSD 3VD7A 2WLKA 3BY6A 3STZC 1SQBD 3MP7B 2QIWA 1K1XA 5E79Z 1SA0B 1IFNA 1N9EA 1TUEB 2V4DA 2ZVNB 1Q5OA 1EZVE 1ZOYC 1EZJA 1PKXA 1LTSC 3ZRXA 2PRRA 2KS1A 2W6IG 3O6QB 2AEFA 1QAFA 2ZNIA 4NR1A 4YXWH 4ZI7B 1NSUA 2Y9ZA 2HHHB 3LDEA 2WA4A 1XMQO 1VF5B 1LT9A 3BASA 3LSUA 2O01N 4IYIA 4ASWA 3D3QA 3AE2C 3JCUE 3RK2C 5APYA 2Y9YA 3CPWU 1US1A 3UKMA 3CC4P 4DR1O 2AEJA 3SJBC 1CZQA 4AQ0A 1JJOA 1G1IA 1KTMA 1BCCD 1U7JA 5JMDA 2OYHA 2HPCB 1IFPA 3GHGC 1Q2NA 1EM1A 3ICXA 4HBNA 1NS1A 2NZ2A 5E79E 5K5GB 1XILA 3B4SA 1SQQE 5APTA 4J10A 4UCVA 1R8EA 3LSSA 2QEXV 3AG2C 3T97A 1LTBC 1QLEC 4N21A 2Q5ZA 3T2OA 4KXRA 5TISH 4IHJA 3JD4A 1JZ8A 2WPSA 2O57A 4Z1VA 1DGSA 1HH0A 3NXSA 2EBOA 1PP9G 1XL4A 4PI0A 1GM9A 3WG7B 4X1IA 4X64B 2WLNA 1VQ4P 2MKVA 5KLVD 4MTXA 5KX5A 3PTZA 4Y99C 4ZNCA 1L0LK 3CXHH 5C8YB 2OT5A 1SERA 4DR2O 2DWEC 3L75G 1OCZC 3KN4A 1JFFA 3LUTB 4FZ1A 3RK3B 3IAPA 1L1FA 2BSKB 1RE3C 1SQVD 1W6CA 2Z3YA 2O1KA 1SQVE 5KA5A 4EB6B 2N1TA 3FXEA 1EDKA 4L8JA 2IDBA 3OEHG 2P5OA 3JSLA 1GK9A 2Y0EA 3RL0B 4C7NA 2GUVA 3B5NB 3VQVA 4UB6E 1OJMA 3VDCA 1MMYA 1EZVH 1NU1D 4IFFA 4GKKB 3M99B 3RYHA 4UB8E 1LT1A 1L0ND 3VD5A 2WLIA 1RF0C 2XV5A 5EZYB 1ZRTD 1LUWA 1NT2B 1JX9A 1TUBA 2Q1FA 3B40A 2LR2A 4XDKA 2R9RB 3ZS8C 2B9BA 3VMYA 2BTQA 2E2VA 3JCUH 2NR5A 4A5UB 5KMGA 1DK1A 1YEWA 1NTZD 3VSMA 2KNCB 1HM3A 2YKOA 3UIAA 3E89A 5D5QA 2H8PC 2B87B 5H6RA 2BCCD 3L75J 1PGOA 3SFDC 1KB9I 3BAAA 3BCCD 5E79H 5L3CA 1SQQH 2R3SA 2Y0CA 3Q2YA 1JZ6A 4DV4B 4DUYO 2C10A 1S1CX 2ZAEB 2ZT9D 3FAVB 2FTKA 4X20A 5L3DA 1PL0A 3HE4B 3BRVB 3BABA 4U7NA 2JEUA 2FBWC 4I6MC 1A32A 4BW9A 2R5BA 2WITA 5BR8B 2KP8A 3DECA 1N7RA 1JZ2A 4HB1A 4IFDK 4BW5A 3G6EV 3SWKA 5KKZB 2F7QA 1L0LE 1T6AA 5KHHA 2ITAA 4PA9A 3VQXA 4TV9A 1MZ9A 2NLJC 2F66C 1VARA 4LFAB 1FXKA 1Y47A 3M9HA 3S4RA 4UV8A 4O4IA 5IWAO 3VOPA 3T4DA 2QA4P 4EKWA 1J1DC 1RM1B 1XMOB 2O1JA 3VDBA 4X1KA 2JKPA 5EBLC 2JDIH 1ZSPA 3L72G 1WNSA 3KCYA 3II6A 1IVWA 4U3FH 2UU9O 2WSFH 2UUCO 1L4AB 4ZBMA 4XFJA 1RM1C 1W5CE 2FYNC 2N74A 3X41A 1N7OA 2F7RA 1TA8A 3JALA 1OCOC 2JEEA 3EJTA 4XBFA 4ASUG 4KL1A 5BU5A 2OOVC 3ZEDA 2JKAA 4QE9A 2ZXQA 4LP8A 1IFMA 1MV8A 1JZ5A 5GONA 2QKCA 4UB8H 4GIFA 1SNZA 4O4LB 4YY3O 2X6AA 3CCLP 4JPZB 2L91A 3WIQA 3JYCA 3L73E 4RQFA 3HE5A 4BZGA 3UQ8A 3X42A 1V7VA 3AFLA 4TQDA 3B2EE 5A9GA 2YFNA 2QDOA 3MV11 2AZ2A 3USSA 4MMHA 5H2FZ 1Z5VA 1EDIA 4JPRA 2Q7EA 3CXHI 3OB8A 3HKBB 1UPGA 1SQXJ 2Z4EA 5LP6C 1P7GA 1B06A 2OIGA 3JAWB 1YJ9V 1Y8AA 1Z45A 2OYIB 2HKOA 3L72J 1K7DA 4XA4A 1J0MA 3ZHUA 3H1HH 3D71A 3OMNB 2DYRB 2ZDIC 4FLWA 3H1JD 3TF5A 2HP8A 2D2CB 2HODB 1PP9E 4UFZA 1EZVI 4KFMA 3MHHC 1KZUB 2CGNA 2V4HA 1HMWA 2OW6A 1W2ZA 3QTCA 2G8YA 1HNWB 4MVOA 2D2CC 2KSJA 2KUBA 3X2QB 5KAIE 1YZBA 2ZYDA 4I7ZC 5A2QN 4FIPC 1L0LH 3AG4C 4F6EA 2BEQD 1RSOA 1L7KA 3D6YA 3SYCA 3SPIA 3CEIA 1XI1A 4D7SA 1YIJV 1SFCB 1GZLA 3EVKA 4YTPC 3UT5B 3BVOA 4IIJB 3P3PA 4XDLA 1FJPA 1I5XA 1S5JA 2VQFB 3ABLC 4GKJO 1DEBA 2KKWA 5L3EA 3CCSV 2LXCB 3ASOB 1H2LA 2ZE6A 2CPBA 3CRAA 1K9MW 2F4VB 1K3EA 1VQLP 1FS0E 1NAFA 1ENVA 3AFJA 3A24A 1NI8A 5IY5B 2AW9A 4K35A 3ETEA 2Q3IA 3ASOC 2LKMA 3L73H 3DXRA 3AEFC 3T0UA 2ZD9A 4YJ3A 4DR1B 2BASA 3GWKC 3SGIA 3VQWA 1W2EA 5AVXB 1UI8A 1S9KE 3Q5SA 2WVYA 1TVKA 3L4FA 3NTNA 2UUBO 3C1LA 3CI9A 1YCIA 3GLMA 3Q5RA 4ZOLA 1CXZB 5LMUO 1ULVA 1JY2O 5AVZB 4WCEV 3U1CA 2GHYA 4FFBB 2Q8VA 3WB0A 2ZYGA 4NB5A 2AHYA 5AVYB 2CWVA 3BVUA 3N27A 1QBZA 4DUXA 1PS3A 3ZHQA 2XNXA 3MAQA 1OCRB 1HR0O 2JP3A 2LGQA 1XNRO 1PP9H 3ETGA 1A2VA 3FYIB 1S5LX 3CCVV 3I5DA 1BL8A 1IBMB 1N86A 3K04A 1KP3A 3ZRVA 3V6IA 5KAIH 5DEDA 3AG7A 4JI6O 4H44D 4GYCB 1MMMA 4JYBA 5CA3A 3T1HB 2M0BA 4LLHA 3V2PA 1IJDB 1M4UA 4OVNF 2FYZA 2NPSC 3LOYA 3H6PA 1XQ8A 3DYMA 5DECA 1LWUB 1SQPG 3OM3B 3VOUA 4D6TD 1SA0A 5HFLA 3ZMVA 4CS3A 1EC5A 4DV1B 1JJ2U 1P84D 3LNNA 2IX7C 5E1AC 1FDIA 1W4NA 3R66A 2IZ0A 4U3JB 1M1KQ 4XDJA 3JAMN 4DV6B 1LURA 4I2LC 4GX1A 3BATA 3DYOA 1SIIA 5LOVA 3H1IG 2CTRA 2V1DA 2W0FC 3O65A 1NS7A 3P8CD 1DD4A 1QX8A 3GHGA 3SPCA 1R3LC 2HTAA 2XN0A 3RYCB 1D2DA 4E4EA 4O2AA 1FDOA 4NPEA 4RJTA 5CB4A 3SYPA 1EXIA 2KS1B 1A02F 2JR8A 5KLIB 1S5LZ 4JTDB 1I8QA 1NSRA 1FPOA 4TSFG 2WSSG 1HNZO 1SQPJ 1HGZA 2HVJC 5EIBC 1P84F 3D52A 4QIWF 1LT9B 3HRNA 2XTAA 1HXKA 3RK2D 3WFVA 3CSXA 1D6ZA 1IQXA 3BLBA 4TOIA 4JF3A 2OW7A 4UCUA 1SO0A 2GDSA 4A7PA 3T1CA 2OYHB 4L75A 1NTMD 3K5NA 2FFDC 4BIOA 4FNVA 3H1IJ 2IBZD 1NTKD 5L3GA 1V54C 3SJQC 1MZEA 1RE3A 1VQ9V 3T1YO 2F23A 2X6BA 3HR0A 4AYCA 1E79G 2YKQA 1YF2A 1YHQV 1J0NA 2B89A 3T97B 2Y73A 2YSUB 1QLED 2IFNA 2BSKA 1CW5A 1S5LE 2OTLV 4IHJB 1YJWP 2ETNA 1YTFB 1GO3F 1OJOA 4JI0B 3EJRA 1LR1A 2YMKA 3CV5A 4PA7A 2P90A 3CC7P 3OS7A 4X1IB 1RF0A 1VQKV 1PIXA 4PD4E 1G1XB 5KX5B 3ABKB 1FZEA 1G6UA 2XAGA 1KN7A 2C2AA 3CP1A 4EFBA 1YJNV 4AQRD 3EQ2A 3LW5J 2Q1KA 1H8EG 1JFFB 3TGUE 4WFEA 3L74E 3CJHA 3A0RA 3SPHA 2ATKC 1NSVA 4HNAA 4I9WA 2N1TB 4BZEA 2A06E 1DP0A 1U7MA 3WU2Z 5AW1B 4C7NB 2FYUG 3CX5D 1YITP 2CISA 4JF7A 4WY4D 3RYHB 2BT3A 3IMHA 4UVCA 1GN6A 1XTCC 2JKEA 3KKYA 1KD1Q 3MHSC 4RAIA 2D73A 4NXNB 1E1QG 4ZKUA 2WLIB 2PFXA 2W0XA 3A0BE 1TUBB 1FD9A 2DYSC 1GTOA 2ZT9C 2CAZC 2BTQB 3ABTA 4LWSA 5KMGB 3CMEP 5JJNB 3HE4A 4EDFA 1RJOA 3HUSC 4RWUA 1BSMA 4LF4B 4KTRA 3HIGA 4DT0A 3OBAA 1GN2A 2LJ2A 1IK7A 2H8PD 2I1KA 3NMDA 4QMAA 1GD2E 1KFNA 2L35A 3CX5F 4PA6A 4IOIH 4EV2A 3ACTA 1XHZA 1V55B 2FYUJ 3TETA 3VMAA 5KHIA 2QKSA 4X20B 1KKDA 1S5LH 2L5GB 2HVKC 2OOVA 3ASNB 2OGUA 1T3UA 3MV01 1AVKA 4D7TA 1D5AA 3K79A 4OPHA 4GCZA 4H0LD 2KXPB 1FZGA 1FZFA 4TV9B 4PV1B 1FXKB 1JZ4A 1N33B 1JQ0A 2Y4UA 4O4IB 3CWBE 5CJ0A 1K73Q 2ZM6O 1H88A 2CH7A 2EIMB 4X1KB 3VTPC 1K4DC 4PA4A 2WW2A 1PM9A 2WYHA 3BUPA 3TGUH 3L9DA 2F7PA 1VL2A 3QG0A 3L74H 1JO5A 3HPLC 5J2UA 1BGYE 2FYUK 2ZXWB 2WZ7A 1GDTA 2A06H 1FOSF 1QWUA 5LP6A 3L70E 1PPJG 3T0DA 3JALB 2EIJB 2XOKG 3I55P 5LMUB 2V7QJ 2ZDIA 1DD3A 2BEZF 2CG1A 1GL2D 1LOHA 2FL4A 3ABMB 5GONB 2CWUA 4EI2A 5KHKA 2PYJA 2E76B 2QJKC 4MW8A 3ZBHA 3A0BH 3K57A 1MZFA 1H2SB 4LF8B 1MSWD 1BE3G 3VP8A 3WA2X 1KQSO 3HE5B 1K5QA 3AMOA 1FZBA 1IBLB 1HMUA 2QG4A 4JTAB 4PDRA 2ZJSE 1Z5WA 2DE0X 2Z5UA 2CFGA 1RPRA 2WDAA 3L71D 3W68A 1AV4A 2KOGA 1S77D 3KXDA 5AVVB 1QQCA 1S3JA 2R72A 3N9HA 5CCHD 1N36O 2CE4A 5AVRB 4I55A 1M7LA 4JAUA 1QEXA 4X62B 1GM7A 1BQZA 1VQOV 2UUAB 1HGVA 1IX9A 1K34A 2J59M 1KORA 3A3YB 3IN6A 2YXHA 2F7OA 3EJPA 3JASA 3OTOB 3ZRSA 3AE9C 5EK0A 3DC5A 3P3NA 3H1KD 1GKFA 3H1KE 4RUEA 2I8DA 1LF6A 2EJ7A 3K08A 1QVFU 4GODA 2DJVA 3H1LG 3PH0A 2BOCC 3E22A 1KFMA 1VMGA 2VRZA 1FE6A 1WJZA 1BE3J 3D3IA 3C90A 2UXCO 1KB9D 3F7YC 1RSOB 2YI9A 4OGQC 5AW4B 1EGUA 1TU5A 3CMAV 3CWBH 1NS0A 1DEEG 2R70A 1SLQA 4LF6O 1HWTC 5H9CA 1SQBJ 2EAEA 2VS0A 3ZMZA 3AEBC 3M91A 5KTBA 1LJ2A 4FNSA 1PV3A 3TCUA 2YUAA 4AQYO 3BUIA 5IJ0B 3CCEP 3F5WC 3U0ZA 5AVSB 2DW4A 3L70H 3K0GA 2QM7A 3MHVA 3QDEA 1OW8A 4HZ3A 2YXRB 1JEKA 1QALA 4DR4O 3S3XA 1D6YA 1VQ8P 1KILE 3GVMA 4OX9B 3J80N 1HNZB 3VP9A 2WPRA 1X1IA 1VQPP 3E80A 1W2BU 1CP9A 2ZXEB 4GDOA 2CTPA 4DR5O 4MVSA 1SF9A 1JCHA 3AK2A 4MTGA 3CD6P 1WA8A 2QE7G 1KB9F 3OW2O 4R50A 2ZE7A 1JY3N 3ECQA 4P9PA 1LF9A 1VQ7P 4FNQA 3E1RA 4JZGA 1EXJA 4H44B 5AW2B 1TVKB 1AI4A 4JBZA 1BCCJ 3KCXA 2Q68A 4CZZA 4I4TA 4WF9V 1JMMA 1WMNA 4ZOLB 1KC8W 4C46A 4KT0J 2NPSA 4LF5O 1MMZA 5IYBO 3HTKB 1NAYA 1E79H 1KD1W 5CJ4A 3CXCU 4YIOA 3S4BA 2GSMB 4JI5O 1AROP 1SC5B 5D5PA 4N78D 1ZWIC 1JB0J 5TISE 1NJIQ 3DYPA 4JYCA 2H88C 1VDFA 2HJFC 3E83A 2QGNA 2DW3A 1VQ5V 1JA8A 1FFXA 2QWQB 3QO7A 4JAVA 4JV5O 3AK3A 4Q20A 5KLVJ 5KAFZ 4NXMO 2W8ZA 3CXHD 3SPGA 4KFEA 4JQ0D 1MN0A 4LNUA 2R9AA 4WBAA 5EBWC 4FLVA 1SQVJ 1VF6C 1QCEA 2A45G 4DV0O 3BCCG 1FXHA 3WB1A 2CFLA 2O3JA 1AB3A 2OWOA 3IAYA 3FGAD 2Q69A 3H32A 1WB7A 2WLLA 4DV7B 5KUKA 3RYCA 1EZVD 4J7JA 1OZ0A 4O4HA 1NU1J 4DV5B 1X22A 2Q0OC 3A5TA 1YQ2A 1O9HA 3CCQP 2KYVA 1RWHA 1L0NJ 5FL7G 3RK2B 4X9QA 1DLBA 2P22C 4J42A 3KPEA 3EFGA 5AW7B 5LOVB 1K73W 1N7SD 3CCRP 1LTJC 5APXA 3CXHF 1NZ6A 4DR3O 3ETDA 1CSBA 1IBKB 3GHGB 2D1WA 1NTZJ 3S9OA 2BTOA 1JOCA 5KUMA 1SP4A 1V7WA 4CC6A 2VRSA 3KIIA 4O2AB 1NKGA 3DX2A 1Y4MA 5CB4B 2BCCJ 1BMFG 5FPRA 3AG2B 1AI7A 1QLEB 2FY8A 1N73C 3BCCJ 1SQQD 3ZN0A 2O01H 3AE7C 1URQD 5EIBD 3B8MA 2YO3A 1QGKB 1NWQA 2JVDA 2P7TC 5HFMA 3H1LE 1IURA 5DN6G 1M5IA 4Y99B 4DXWA 2WOFA 3BLCA 1JOYA 1GMJA 3RN4A 3FX0A 3CZNA 1OCZB 3FWLA 3FYEB 3CC2P 2WOHA 2FXPA 1KQFB 1UFIA 3F5TA 1AQTA 2GUSA 2KI7B 1K9MQ 3JARA 1NR1A 3IC7A 2XASA 3AE3C 4KHPO 2E24A 3GW6A 2A9HA 1FJGB 1N32B 2YX9A 3NBJA 1SS1A 4U3FE 3DGEA 1AVYA 1BDCA 2CK3G 1HF9A 4FNPA 1MFZA 1PPJH 2WSEJ 5AW8B 2ZYAA 3VMXA 1AVMA 2OTJP 1KYOE 1JYVA 1EQ7A 2P7JA 3APQA 2X7RB 1VIBA 1XTGB 1DTOA 4G27B 2YIAA 2Q0AA 3RYIA 4B3SO 4JI4O 1NS8A 4WB4A 4WY4C 4DR7O 4HAMA 4DW1A 1IVSA 2ZFCA 1EN5A 3JC22 4W4KA 3RT3C 3QH9A 2BRVX 2CFKA 3B09A 2OYQA 3T09A 1V9PA 1YI2V 1I0HA 1MFTA 1N7LA 3HUSA 3CJHB 3ZRWA 1KSIA 4B3TB 4HNAB 1XNQB 1DH3A 2Q6AA 5CBOA 2GM4A 1OJNA 3EXAA 2YNYA 5C39A 2MK3A 4GZRB 4R8CA 1DYUA 4JI1O 3E2EA 1VQLV 4I1LA 1N36B 3ALAA 2E5TA 1X0TA 4Z1MG 5APSA 3A0HZ 5BZBA 2W0QA 1FU1A 3H1HD 4LF9O 4J9YB 3VD3A 3H1HE 1LUVA 2E3CA 2E5LB 5EC1C 4F6RA 1US6A 1KBHA 1S2EA 2UXBB 1ZXGA 2R44A 3H1JJ 3K5LA 1NS4A 1SQGA 1VQNV 1KU9A 2F93B 2ZXXA 1PL4A 3CRMA 4LWSB 1HNXO 1MA1A 1FJKA 3AEGC 3H1LH 3Q5PA 4RUFA 2E75D 1PGQA 2ZINA 4X65B 5GTHZ 3F7VC 1Q90D 1RWAA 4LFBB 1J1DB 1L0LD 4H0LC 3CCMP 2XZRA 1RY3A 4FK5C 3D50A 1AVOA 1Q43A 3RYFB 1JCDA 2CWTA 1LP1A 1WN7A 5CBNA 2WW3A 4LF6B 4Y28J 3AEDC 5J2TA 3AK1A 1SQXG 1YYCA 4JI2O 2FYNB 3G4SP 2EIKC 1OCOB 1NJIW 4K3AA 4AQYB 1H8HG 1F1SA 1GAXA 1WLEA 4K0KO 4FNTA 4L73A 4O9BA 4MTOA 3AG1C 3BPZA 1P49A 1M57C 1KYOH 1EKMA 1DF4A 5LL6Y 2Y74A 4C7UA 3UO3A 2NRGA 1GL2C 1BZKA 3D8CA 1FBMA 1JMBA 3QO8A 2QJPC 1AQ5A 2CH7B 4NTWA 5JVDA 5GTHE 3L73D 4AHCA 2QE7H 2Y0PA 1SESA 5J2UB 5B5EZ 2WZSA 1CI6A 2AZ0A 3DDGA 3ML0A 1I94B 4XE5B 2YXLA 5LP6B 3DX0A 4B3MO 1PZQA 3DX3A 1U96A 5A1AA 1QL1A 2QVAA 1Q6UA 2PGDA 1M1JC 4H13C 3BHPA 4OH8B 5CCHC 3TXSA 2IM9A 5B1BB 4GOEA 4OWFA 1PD3A 1S0VA 4EYYQ 1PX3A 2R32A 2VWJA 3UCSC 2YIBD 3AMOB 1KV4A 3B8NA 4ICGA 1PP9D 4AILC 4I7ZB 5B1BC 1E1RG 2QEXP 4PDMA 3AG4B 2YFOA 1WMOA 3T08A 3FB8C 4NXMB 2W6BA 2H43A 3CZSA 1GW3A 1EN4A 4I55B 3V4QA 3L75E 3MI6A 1M93A 1R5LA 5H2FE 3KG2A 1SQXK 3K5OA 1X1JA 4X66O 2WO0A 4JI3O 3QWOC 1PNLA 3JASB 2JRIA 3ABLB 2QJ1A 1IFIA 3AE1C 1A02J 3JCZA 3PRJA 5IYZA 3T4ZA 3A0HH 4D6TJ 4LFCO 1H2NA 1HP8A 3GF3A 5IJ0A 3SX1A 3E22B 5CA0A 1NSXA 2PY5A 2W6JG 1KILC 4IT5A 1UJWB 4LGDE 2JJLA 2ZVOB 4OGQD 1K33A 2RJZA 5CCGC 3WUUA 3PHLA 3OUFA 1XMQB 1YQ4C 2IBZG 2RMKB 4NVPA 4KUMA 1NVPD 2QJYC 5GTHH 1VPCA 4K8ZA 3PLNA 1LNQA 3SYOA 1NSMA 2IH1C 2N05A 2N04A 1K5SA 3QG5A 1PNKA 1S9KD 1GM8A 1W2BO 1WPBA 3MUY1 1K1YA 5E1QA 1P4RA 5EFWB 5JMFA 3M06A 2CDYA 1J5EO 3HTKA 1K8AW 2QM4A 3D4ZA 1KP2A 3SDLA 3A2FA 3JATA 1NHLA 1YITV 2M8RA 4TQFA 3OAAG 1WA8B 2EULA 3KZIZ 2B5UA 1KYOI 3HKEA 3RRSA 2VQEO 3STLC 1JY2N 1M90Q 4DCKA 4I4TB 1NTMJ 5TJHA 3D4YA 4ABMA 5LHHA 4DV3O 5AW6B 3CB2A 1NTKJ 2NPSB 1OJHA 1VF6A 1Q3EA 5AVWB 5LGUA 4RQEA 3L75H 3E8BA 1SQXE 4DR2B 4KHPB 3G6EP 3BVHA 2WLJA 4WFHA 3L72E 3NFQA 5H2FH 1RWFA 3D51A 5APVA 4JYAO 3T2PA 2ALWA 4IFMA 2C11A 1XUQA 2CK3H 1JMKC 3I3EA 5B1AC 4B3RO 1SKVA 1K04A 3AEAC 1IQYA 3LSQA 1HJBA 1T3JA 1UIIA 1U57A 1FFXB 4DR7B 1V7XA 3S3WA 2IYOA 1H2MA 3OGIB 1S72V 5CN0A 1LTJA 3K5MA 1T8ZA 3N2GA 5KJ7C 3D36C 2R9IA 4J11A 2X0LA 2KQXA 4LNUB 4PJ0Z 3DX4A 4H37A 3K59A 1N7SC 2FXOA 1HWYA 4FNRA 4EFEA 1B3QA 2PI4A 1X59A 1Z56A 1F4HA 4IL6Z 3FKSG 1MKMA 4DZOA 3VBBA 2M5AB 1TQUA 3H32B 3SSUA 1GN4A 2WLLB 3K9AA 2YMYA 2P06A 3HKCA 5JQGA 1N73A 4R7CA 2ZR2A 3OEEG 4O4HB 1WMPA 3BA9A 3CCUV 4MN4C 1H8AA 1COWG 1IDSA 3VSNA 2B88A 3CPWO 1X8YA 1TU3F 3LDDA 4YHHO 1URQC 2E22A 4DUYB 1S4XA 1F4NA 1FYJA 5LGTA 1XL6A 1YJ9P 1NR7A 2Q73A 2FFDB 2E2UA 1GK6A 1JCCA 4PJ0E 1V54B 1G8MA 4DV2O 4LCUC 4RO0A 2OQEC 4BRYA 3BFRA 2GUZA 3FWNA 1N0NA 1PX4A 2CGOA 2CQTA 4ZHQA 3MTUE 2LW7A 5IWAB 3WVFA 1SQXH 3GB7C 1AILA 4UCSA 5BY1A 1QLNA 3X3YA 3L72H 3CCJV 4YJ2A 1SVFA 1SQPK 1RHZB 2UU9B 2Q7GA 4K0KB 3FXDA 2UUCB 2JWAA 2JEXA 4WY4A 2GTAA 4JI8O 1RP3B 3T2MA 2C0WA 3O9OA 2EILC 1YIJP 1BHBA 1VF5D 2CQSA 2PF4E 2JWDA 1TXKA 3ABUA 5B3SC 4PD4D 3KZIH 2IYPA 4MTFA 3TK1A 3JARB 3TNUA 1RFYA 4YY3B 1IXBA 1JTHA 2E2TA 1YTZI 3EJUA 2B1GA 4TT3G 3TGUD 3L74D 3C3SA 1PV0A 4MSWC 1FAVA 4YPCA 1BGYJ 1XHXA 3RGUA 3JD0A 5LYJA 5K1XA 1K05A 3VQYA 2A06D 3W67A 2JKVA 4JI7O 4JASA 1R6TA
chains in the Genus database with same CATH topology
3BUIA 3S1KA 1NVOA 4CPGA 3MHVA 4KJMA 1OVVA 4IOIH 1OVUA 2OW6A 1TQSA 2SPZA 3EJQA 4ASVA 3D51A 1LT1A 2ALWA 3CZNA 3DDGA 2KUBA 3BVTA 4HJGH 4NPDA 3DX0A 3DX3A 2F1AA 1H0TA 4NPEA 2QVAA 2KI7B 1JM0A 2KS1B 2LR2A 2RKLA 4GOEA 1R33A 2F18A 1SS1A 4EYYQ 1HTYA 4JBZA 1BDCA 3D52A 2B87B 1R34A 2KZIA 1HXKA 3DX4A 1QWNA 3BLBA 2WYHA 2OW7A 3BUPA 1OVRA 2HR3A 2F7PA 2P58A 3BUQA 3ZDMA 1BDDA 2LXCB 2UWJE 2M5AB 1TQUA 1QWUA 2ZAEB 3CZSA 1MFTA 2QRXA 4MN4C 4K35A 4NPFX 4ZMDA 1TQVA 5CBOA 3QWOC 4HB1A 2B88A 2B89A 3EJSA 1FC2C 5C39A 2F7QA 3BVWA 5KBPA 2B87A 1Y47A 2F1BA 3DDFA 1LP1B 3EJRA 1X0TA 1TQWA 4ASWA 3CV5A 1O7DD 4BXLA 2R44A 1ZXGA 1U7JA 5DJTB 3BVUA 3BVXA 1S3JA 2Q1KA 1Q2NA 1PS3A 5K5GB 2F7RA 3BVVA 4WWIA 1EDJA 3EJTA 3LVTA 2F7OA 1U7MA 3EJPA 4HKZH 2OTKE 3FXDA 3BUDA 2WYIA 1ZW0A 2M0BA 2I8DA 3MZWB 3D50A 5EFWB 4GODA 1LP1A 5CBNA 2KZJA 3BUBA 3PH0A 2JWDA 4GOFA 1EDLA 3D4ZA 1H0TB 2LXBA 4K3AA 3DX2A 4ZNCA 1EDIA 1HWWA 2M5AA 1QX1A 1TQTA 3EJUA 1EC5A 2KIKA 1DEEG 2WMMA 2K3RA 3RGUA 2FYVA 3DX1A 5DJUB 3FXEA 1EDKA 3D4YA 1JMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUI A;  3S1K A;  1NVO A;  4CPG A;  3MHV A;  4KJM A;  1OVV A;  4IOI H;  1OVU A;  2OW6 A;  1TQS A;  2SPZ A;  3EJQ A;  4ASV A;  3D51 A;  1LT1 A;  2ALW A;  3CZN A;  3DDG A;  2KUB A;  3BVT A;  4HJG H;  4NPD A;  3DX0 A;  3DX3 A;  2F1A A;  1H0T A;  4NPE A;  2QVA A;  2KI7 B;  1JM0 A;  2KS1 B;  2LR2 A;  2RKL A;  4GOE A;  1R33 A;  2F18 A;  1SS1 A;  4EYY Q;  1HTY A;  4JBZ A;  1BDC A;  3D52 A;  2B87 B;  1R34 A;  2KZI A;  1HXK A;  3DX4 A;  1QWN A;  3BLB A;  2WYH A;  2OW7 A;  3BUP A;  1OVR A;  2HR3 A;  2F7P A;  2P58 A;  3BUQ A;  3ZDM A;  1BDD A;  2LXC B;  2UWJ E;  2M5A B;  1TQU A;  1QWU A;  2ZAE B;  3CZS A;  1MFT A;  2QRX A;  4MN4 C;  4K35 A;  4NPF X;  4ZMD A;  1TQV A;  5CBO A;  3QWO C;  4HB1 A;  2B88 A;  2B89 A;  3EJS A;  1FC2 C;  5C39 A;  2F7Q A;  3BVW A;  5KBP A;  2B87 A;  1Y47 A;  2F1B A;  3DDF A;  1LP1 B;  3EJR A;  1X0T A;  1TQW A;  4ASW A;  3CV5 A;  1O7D D;  4BXL A;  2R44 A;  1ZXG A;  1U7J A;  5DJT B;  3BVU A;  3BVX A;  1S3J A;  2Q1K A;  1Q2N A;  1PS3 A;  5K5G B;  2F7R A;  3BVV A;  4WWI A;  1EDJ A;  3EJT A;  3LVT A;  2F7O A;  1U7M A;  3EJP A;  4HKZ H;  2OTK E;  3FXD A;  3BUD A;  2WYI A;  1ZW0 A;  2M0B A;  2I8D A;  3MZW B;  3D50 A;  5EFW B;  4GOD A;  1LP1 A;  5CBN A;  2KZJ A;  3BUB A;  3PH0 A;  2JWD A;  4GOF A;  1EDL A;  3D4Z A;  1H0T B;  2LXB A;  4K3A A;  3DX2 A;  4ZNC A;  1EDI A;  1HWW A;  2M5A A;  1QX1 A;  1TQT A;  3EJU A;  1EC5 A;  2KIK A;  1DEE G;  2WMM A;  2K3R A;  3RGU A;  2FYV A;  3DX1 A;  5DJU B;  3FXE A;  1EDK A;  3D4Y A;  1JMB A; 
#chains in the Genus database with same CATH topology
 2OCC C;  5IYD O;  2ZQM A;  4LR3 A;  3S1K A;  4NTY A;  4CH5 A;  3SEP A;  4DRX A;  4FZ0 A;  3RYI B;  4LH6 A;  1L2P A;  2M3B A;  4CPG A;  3SYA A;  2Q5U A;  3RWR D;  2XU6 A;  2JJ2 G;  1KC8 Q;  3G71 P;  3EJQ A;  2SPZ A;  4UCT A;  2DYS B;  2ZT9 B;  3NJX A;  4L76 A;  3C3T A;  3H9V A;  2UXX A;  2K9Y A;  1MSD A;  5AW0 B;  4PD4 F;  2M3E A;  3HUS B;  3ZRW B;  3CL3 D;  3U11 A;  1KQG B;  4FVM A;  2E74 C;  1X79 B;  2ZNJ A;  4KTP A;  1OCC C;  4UVA A;  3H01 A;  1VQ8 V;  2WA3 A;  3L71 J;  3ACS A;  3OA7 A;  4PJ0 H;  2E75 C;  1OAC A;  3RK3 E;  1VQP V;  2JO1 A;  3IGA C;  2KLV A;  1JZ3 A;  3WU2 E;  3HKD A;  4IL6 H;  2PGG A;  2VWK A;  3CCV P;  1QVG U;  5EBM C;  4RKU J;  2P58 A;  1IK9 A;  3RYF A;  3BUQ A;  2HHH O;  4JI3 B;  1BDD A;  2V7Q G;  3RBX A;  4F6R B;  1J95 A;  2UWJ E;  1JRQ A;  3OGC C;  2OCH A;  1H38 A;  2DWD C;  1SQP E;  1UI7 A;  2EAD A;  5CA1 A;  3H1K J;  3WB2 A;  2H89 C;  1JR9 A;  3HD7 C;  2EAB A;  2P1J A;  1YDX A;  1GL2 A;  1M8O B;  2WSC J;  4ZMD A;  3MD0 A;  2YKP A;  3C9I A;  2Q4P A;  4GKJ B;  4X8A A;  3RL0 g;  1HN0 A;  1M90 W;  1BHA A;  1QU7 A;  2W6J H;  2RMZ A;  2HG5 C;  2ADQ B;  3ZHS A;  3IAQ A;  4UXN A;  3S4C A;  3ZHV A;  4O4J A;  3M0D C;  3H1I E;  3CWB D;  1LP1 B;  4WFF A;  1GTW A;  5J2T B;  1OX3 A;  1OV9 A;  3FD9 A;  2I1J A;  2RH0 A;  4G2K A;  1AI5 A;  1BGY D;  1RPO A;  3APO A;  1B6Q A;  3L70 D;  5CCH A;  1N4C A;  1H2G A;  4R4M A;  1YVW A;  1M57 D;  4BTX A;  1Q6H A;  3DTU B;  2UUB B;  2QJK B;  3QVN A;  2PI5 A;  1EDJ A;  4X64 O;  2A7W A;  2Q7C A;  2Q6Q A;  4IYH A;  1GMG A;  2F1M A;  1UIX A;  2IZ1 A;  2PNC A;  2BE3 A;  2IH3 C;  1P7B A;  5JVD B;  5CBF A;  4WFB V;  2C9L Y;  4CS2 A;  4DJG A;  3I56 P;  1W0J G;  2WAM A;  2Q9I A;  1ZL8 A;  1CI6 B;  3AG3 C;  1HR0 B;  2KZJ A;  1XNR B;  2FB5 A;  1OW7 A;  1RH5 B;  1VQ6 P;  2XND G;  3HB3 B;  2G38 A;  1MAB G;  1SQB G;  3P8M C;  4BTY A;  4W7Z A;  4I50 A;  1VEW A;  3M7M X;  3J7A U;  3KHU A;  4TLF A;  3SWF A;  2LFS A;  1Y67 A;  4K8X A;  5FNV A;  4JI6 B;  1EZV G;  4GKK O;  4H13 D;  3N7N A;  3WU2 H;  3A0O A;  3A7O A;  2YIU C;  1OMI A;  2K9J A;  2ZR3 A;  2K1A A;  4JYA B;  2Z5H A;  3CC4 V;  4MVR A;  1SQP H;  1VQ9 P;  1PU4 A;  1THZ A;  3V4W A;  4J80 A;  3G3Z A;  1KIL A;  4ZKI A;  1QHT A;  3MUD C;  2Q67 A;  4C7R A;  4ASV A;  1NH4 A;  4OGQ B;  5IT9 N;  5CCG A;  2OTL P;  2AXC A;  1G4Y B;  2C0X A;  1NVP B;  4AUW A;  5CBH A;  2F1A A;  1FZA A;  2ZCE A;  5JCO C;  2PP6 A;  1BCC G;  3H1I H;  3OT7 A;  4PHZ A;  1VQK P;  4BIZ A;  4IGG A;  4NEI A;  1FDM A;  2ZE8 A;  4BZF A;  1JNM A;  2FYU E;  1QR9 A;  4YIP A;  5IYZ B;  3ZMT A;  3ABV C;  1VQ4 V;  2RDY A;  3D6Z A;  2KZI A;  5GTI Z;  3MPH A;  4TUY A;  5APW A;  1PNM A;  5BR8 O;  1XEQ A;  5CA0 B;  1OHH G;  5AW3 B;  1KIL D;  1FAF A;  3NR7 A;  2WSS H;  3GMA A;  4O2B A;  3NBB A;  4DUW A;  1M56 C;  4B7K A;  1OXZ A;  2J58 A;  5CHX A;  4LFA O;  5CCG D;  5KLV G;  1LTG C;  4DK0 A;  5BXZ A;  3JSN A;  1IFD A;  1SZT A;  1RQV A;  3L36 A;  1XMO O;  1VQM P;  3LW5 H;  2K37 A;  1Y9B A;  4FNU A;  3QO5 A;  3G9R A;  2EAC A;  1SQB K;  2JDI G;  2CPS A;  4LBE C;  3SPJ A;  1SQV G;  1XRE A;  2HFE C;  1SFC D;  4J41 A;  3MIW A;  1Q81 Q;  3ZHR A;  2D3O W;  2ADP A;  1SQQ J;  5FLX N;  1FZC C;  1CB8 A;  3T1Y B;  2KLU A;  1JYX A;  2LFR A;  5L3B A;  1NU1 G;  1AJN A;  2HTB A;  2CG0 A;  3FB7 C;  3RW0 A;  3WUV A;  3JAT B;  3ZIA G;  3EHB B;  3L35 A;  4N23 A;  1L0N G;  1S76 D;  4HH2 A;  4JI8 B;  2EZP A;  3HKE B;  1NYH A;  1HN1 A;  4RES B;  1N7N A;  1AFO A;  2OQQ A;  4FLX A;  4P2Z A;  5KJ7 A;  1NO4 A;  1QL2 A;  3D36 A;  1Y74 A;  1BS3 A;  2FKX A;  2WPD G;  1J1E C;  1NTZ G;  1N7S A;  2FXM A;  1GK4 A;  4CH6 A;  3S4D A;  3TDK A;  2LGW A;  3MZW B;  1JY3 P;  2BCC G;  2QWO B;  2YI8 A;  5AVT B;  3WFA A;  4QGP A;  1AA0 A;  2WSF J;  4U3F J;  1T2K D;  5KHG A;  3JSV C;  1EDL A;  4NTX A;  1PPJ D;  4JI7 B;  1ZME C;  3E1I A;  2FYU H;  4LH7 A;  1PPJ E;  1RF1 C;  1NKN A;  3Q4H A;  2M5A A;  2JGU A;  5KA6 A;  1SIH A;  4NKG B;  2XHN A;  1G2C A;  1Q8I A;  1HNW O;  1URQ A;  2QA4 V;  5JJJ B;  1LTJ B;  1SPU A;  2Y69 C;  3G4S V;  1AJP A;  1ZP0 C;  3N2G B;  5DJU B;  2Q3E A;  4X88 A;  5BMV A;  2LQT A;  2G3A A;  1BE3 E;  5KJ7 D;  5KLV K;  1NSS A;  1Q7Y W;  3VN0 A;  1JVM A;  3ZJZ A;  2IJJ A;  3S4A A;  5KAF E;  1W5Z A;  2OQE A;  5IDJ A;  1SQB E;  1N7Q A;  1SQV K;  2FFD A;  3QNE A;  4R4L A;  4TWK A;  3HKC B;  5JH7 A;  5JQG B;  1N73 B;  2ITD C;  2VQF O;  3RVZ A;  3MGN A;  3K0D A;  2YXY A;  1H0T A;  1S5H C;  1IXM A;  2CTW A;  5APU A;  3CCL V;  1R3K C;  4FLT A;  4CH4 A;  1NU1 K;  2W27 A;  1GU5 A;  3H1H J;  3IAO A;  5B1N A;  1X4T A;  3OAK A;  2V7Q H;  5GTI H;  4W80 A;  1R33 A;  2F4V O;  1HTY A;  1L0N K;  5CBG A;  3JD2 A;  1HJ0 A;  1I08 A;  1VQO P;  3H1L D;  4MS2 A;  1QWN A;  2QM8 A;  3RSY A;  3L73 G;  3GWO A;  1DIP A;  1X1H A;  3UM7 A;  1OVR A;  2HR3 A;  2ARH A;  2OYO A;  3B8E B;  1SQF A;  2Q9L A;  4BRY B;  1VF5 C;  2GUZ B;  1NTZ K;  1AJY A;  5AW9 B;  1F4M A;  1L0L J;  1BCC E;  4ZHQ B;  1YTZ T;  2QRX A;  2ZM6 B;  2KK7 A;  1HUC A;  4TV8 A;  4UB6 Z;  2IU3 A;  2BOB C;  4YJ2 B;  3C8V A;  4U3F D;  3DSQ A;  4WVZ A;  3B77 A;  4E2L A;  3ZCC A;  4WY4 B;  2GBO A;  3CMA P;  3FB6 C;  4UB8 Z;  1KYO D;  5LA6 A;  3H1J G;  2F1B A;  3T0A A;  1TQW A;  2WVX A;  1RE4 C;  2R3C A;  3MWX A;  1IBM O;  3KQG A;  2WW0 A;  3N2K A;  1ROP A;  2X03 A;  4NYK A;  5KLV E;  1GN3 A;  3TNU B;  1K8A Q;  2WW1 A;  3T1H O;  2KG7 B;  1BE3 H;  1JTH B;  3VD9 A;  3WG7 C;  3L73 J;  3AEC C;  5CMZ A;  5LYJ B;  5KAF H;  2ZE5 A;  2XND H;  1SQB H;  4Q6G A;  3W7U A;  2K1E A;  2B9Z A;  3WUT A;  1LXK A;  4QE7 A;  1R6K A;  2OTK E;  3M8A A;  4DRX B;  1C82 A;  2CIQ A;  1R3J C;  3RK3 C;  2QWN B;  4LC1 A;  1BSN A;  2YXQ B;  3L37 A;  4DV1 O;  4UCR A;  1YTF D;  1R6N A;  1NU1 E;  4WFG A;  1LTI C;  3RL0 C;  2HLD G;  1KYO F;  1LTA C;  3B5N C;  1VP7 A;  4DV6 O;  3CS5 A;  3HD7 A;  1L0N E;  4DR6 O;  3I3B A;  3ZN1 A;  1TGO A;  1XDC A;  4B86 A;  3K3W A;  4CH3 A;  1ZRT E;  1ZR2 A;  1PFI A;  1PP9 J;  1FS0 G;  2E74 D;  1NKZ B;  4EV5 A;  4H0L B;  2XDJ A;  2IJK A;  1ZR4 A;  3KDP B;  2K3R A;  1QVG O;  1RKY A;  4B7E A;  2YEV A;  3AE6 C;  1NTZ E;  3M0D A;  3JD1 A;  2E5Y A;  5DM6 V;  5EC2 C;  3NRE A;  2N1T D;  2WVR A;  3D70 A;  3CRC A;  3RFR A;  1Q81 W;  2K9P A;  4PDV A;  2UXC B;  2BCC E;  3HKD B;  3R4Y A;  1BCC H;  2EIK B;  1YSC A;  4UCO A;  3E8F A;  1VQ5 P;  1BQ0 A;  3BCC E;  1TQS A;  1W3Y A;  1RW9 A;  3SYQ A;  1Y76 A;  2QWR B;  3AG1 B;  1Q82 Q;  1NGM B;  1K97 A;  1M57 B;  1WP7 A;  5CA1 B;  5LMN O;  1N7P A;  1N8R Q;  4FFK A;  3IJ4 A;  3A0H E;  3GF7 A;  3HD7 D;  4GKG A;  3QFZ A;  3K9S A;  5AVQ B;  3BS6 A;  5LXT A;  1GL2 B;  1IFJ A;  2IW5 A;  3G80 A;  3ZHT A;  5CMU A;  3OFN G;  1IZN B;  2CTQ A;  3K58 A;  2QJP B;  2HG5 D;  4DR4 B;  2PTM A;  5J9P C;  2N9B A;  2F18 A;  4O4J B;  2YIB A;  3PGB A;  3CE2 A;  5KLV H;  4DK1 A;  2RN9 A;  3CLQ A;  4DR5 B;  5GW7 A;  3P32 A;  4JGS A;  2QSI A;  3AE4 C;  2CFW A;  5KKZ C;  2PZS A;  4FPP A;  3TSI A;  1SQV H;  4PDL A;  1GRJ A;  4H13 B;  1M1J B;  4JI0 O;  3ZX6 A;  3BA8 A;  4UB6 H;  2RDC A;  4OXS A;  4D6T G;  3J81 N;  4LF5 B;  1L4A C;  3B71 A;  1NU1 H;  3WIR A;  4GX2 A;  2UXD O;  3IFX A;  1DX7 A;  1W7C A;  4JI5 B;  5F2V O;  3IC9 A;  2FUT A;  1L0N H;  2E42 A;  2XAQ A;  3E8H A;  3MUD A;  1ZL8 B;  2ILM A;  2WTY A;  5KAI Z;  2A79 B;  2HYN A;  4PV1 D;  3SFE C;  4Z2W A;  3T0B A;  1NKD A;  3ZMS A;  4BXL A;  2KB1 A;  4L87 A;  3THO A;  3P30 A;  4I50 B;  5JCO A;  2YS8 A;  3WA3 A;  1NTZ H;  3AEE C;  1KQS U;  4JV5 B;  5ITZ A;  3BVX A;  5FNV B;  5B5E E;  3LDC A;  3L75 D;  2BCC H;  2WWW A;  3M0A A;  3OD4 A;  3BVV A;  4WWI A;  4DUZ O;  2XAF A;  1KQL A;  2K9J B;  2JK5 C;  4NXN O;  1KKC A;  1R5S A;  1QVF O;  2A45 H;  3BCC H;  4I0X A;  4DV0 B;  3U10 A;  3UO2 A;  3CRQ A;  3H1J E;  4YXD C;  1OIP A;  3A2A A;  1AR1 B;  2OYI C;  3U1A A;  1KIL B;  2E76 D;  4BR6 A;  1ZW0 A;  2KB7 P;  3Q1M A;  1AP6 A;  3F89 A;  2DYR C;  1AR4 A;  4I5S A;  4J7Z A;  1K92 A;  2IJH A;  1WPX A;  4LF4 O;  4X1Y A;  2AHZ A;  3PJS K;  1MNG A;  5B66 Z;  3I3D A;  2QJY B;  2LXB A;  1KMI Z;  3SR2 C;  2H3O A;  4TTG A;  3EFF K;  1OW6 A;  1NTM G;  1YJW V;  3X2Q C;  2KIK A;  1NTK G;  1I5Y A;  2JIZ G;  2FYV A;  4DR3 B;  3CHX A;  2XKM A;  1ZUQ A;  3CC7 V;  3DX1 A;  2WLM A;  1L7J A;  2PUS A;  2AXT Z;  3G67 A;  4X89 A;  2FML A;  1YI2 P;  2RNB A;  1FKA O;  4TUY B;  5FPO A;  1FZC A;  1SFC C;  2Y0I A;  4KHX A;  2WSE H;  4BIU A;  1MMU A;  1OVU A;  5IJ9 A;  3EWK A;  4W7Y A;  3ITK A;  4O2B B;  4WBN A;  1M56 D;  1OWA A;  1OJP A;  3CRR A;  4BWA A;  1F9G A;  4IL6 X;  1N33 O;  3SJA C;  5B66 E;  3P7K A;  5K1P A;  1JM0 A;  1HTL C;  4JAA A;  1H2K A;  2QTS A;  3M9B A;  2RKL A;  3TGU G;  3L74 G;  3T2Q A;  3G71 V;  2OAR A;  4DYL A;  2HFE D;  2DQ0 A;  5IY5 C;  1F7Y A;  1CEZ A;  2A06 G;  5L8R J;  2BRP A;  1VQN P;  4J5T A;  3IR9 A;  2UXN A;  1R34 A;  1G1J A;  4OK2 A;  2AXT E;  3TJT A;  5B5E H;  3OW2 U;  2POH A;  5EYP A;  1SQX D;  5B1A B;  2WPQ A;  1RF1 A;  2EJR A;  3L72 D;  3ZDM A;  1NH2 D;  1JPX A;  2P10 A;  3CME V;  1MOF A;  1TAE A;  3DCD A;  2XHB A;  1MMX A;  2WT7 A;  5AG2 A;  4LF8 O;  1T2K C;  2JGD B;  4QNH B;  1D6U A;  3JAK A;  3H1J H;  1OZH A;  1IBL O;  1HDJ A;  3K5T A;  2ZL8 A;  1NSZ A;  1F23 A;  2LW1 A;  3X3Z A;  3VDA A;  1TQV A;  1WB8 A;  1Y74 B;  4JI4 B;  5IE9 A;  4B3S B;  1R1B A;  3EJS A;  1FC2 C;  3KZI E;  1N7S B;  1OCR C;  2CFD A;  1JOV A;  5LHG A;  1Q86 Q;  3BVW A;  1NTM K;  3RBZ A;  2P4K A;  2KSD A;  4X62 O;  5AVU B;  5KBP A;  1NTK K;  2UUA O;  3O8Z A;  3TGU J;  2YDE A;  4LF7 O;  2R5D A;  3L74 J;  3OMI B;  1K1W A;  1UG9 A;  1JY2 P;  2X6C A;  1Q82 W;  3OTO O;  4J9Z B;  1N8R W;  3Q4H B;  1WT6 A;  4KFD A;  4BWN A;  2OIE A;  4D6T E;  4JI1 B;  5L3F A;  1G2C B;  4Z1M H;  1URQ B;  4HYT B;  1P84 E;  1LWU C;  4UV9 A;  4FLY A;  3MUZ 1;  2M7W A;  2A45 I;  5B1O A;  5BMV B;  3O6Q A;  5C93 A;  3E1F 1;  4LF9 B;  3AE8 C;  4ZI7 A;  4DR6 B;  4HKZ H;  4H33 A;  4JYY A;  4EOT A;  4F4L A;  1NS2 A;  1N2D C;  3CWB G;  5B66 H;  1IU7 A;  1ZTE A;  3OR6 C;  3P8C E;  1HNX B;  3I55 V;  3BUB A;  2WCO A;  2WLH A;  5JH7 B;  4L74 A;  1HBW A;  3OR7 C;  2HJD A;  1BGY G;  1OFC X;  4ZKP A;  1H0T B;  1W59 A;  3FX7 A;  1L8D A;  1HWW A;  3FFQ A;  3L70 G;  2XSG A;  1SRY A;  3PP5 A;  3I56 V;  4IL6 E;  2HPC A;  2XN2 A;  4MMI A;  1GW4 A;  2AXT H;  1R73 A;  2N9Y B;  1AP5 A;  4PEL A;  2XAJ A;  4OX9 O;  3H25 A;  1HM2 A;  2Y48 A;  2ZIM A;  1VQ6 V;  2EIL B;  2GA1 A;  2YO2 A;  4JI2 B;  3LIE A;  3HII A;  5LMN B;  1W6G A;  2JS3 A;  4PA3 A;  5KLI C;  1HW7 A;  1RE4 A;  1LXM A;  2WGQ A;  5AW5 B;  5B3S B;  4AI8 A;  2IFM A;  1NVO A;  2GV9 A;  3V2N A;  3K03 A;  2AEM A;  3K25 A;  2KSE A;  1OVV A;  1M9N A;  4KJM A;  4OPA A;  1LT9 C;  4JZ2 A;  5KHJ A;  2K88 A;  3E86 A;  3RGB A;  1QAK A;  4HJG H;  1BT8 A;  3OUS A;  1NTM E;  2IPP A;  3L71 G;  1I7F A;  4NPD A;  3V2Q A;  3VMZ A;  1NQT A;  2HEP A;  1H89 A;  2IBZ E;  3CWB J;  1AJQ A;  1NTK E;  5C8Y A;  2MW2 B;  2Y0D A;  1GU4 A;  2KG7 A;  2OCC B;  4N6J A;  2OYH C;  4TV8 B;  4RNL A;  1AI6 A;  4BTW A;  3MDS A;  3CCS P;  3GG2 A;  1RWC A;  2QR4 A;  3A8T A;  4OJZ A;  2A3Q A;  2ZQ0 A;  4EB6 A;  1YBK A;  3L70 J;  3TY1 A;  2XT9 A;  5LA6 B;  2B1I A;  4B3M B;  3E8G A;  2WVX B;  5BU8 B;  1NBM G;  3H1K G;  3B5N A;  3A0B Z;  1T5E A;  1WP8 A;  4MW3 A;  4D6T H;  3N2K B;  3QF7 A;  1SZX A;  2M6Y A;  1P84 H;  2MJZ A;  4BZH A;  2UXD B;  4U7J A;  1ZX3 A;  2WPV B;  2E74 B;  2ZIO A;  2CIR A;  3X40 A;  4WFA V;  1SET A;  1N34 O;  1OCC B;  1B04 A;  1F4A A;  3OJA B;  5IYC O;  2NNU A;  5EZY A;  3W7W A;  3CCE V;  1ZLL A;  2E75 B;  1ORQ C;  3E7J A;  2XAH A;  3ABK C;  1USD A;  3AE5 C;  1X9V A;  3N4X A;  4EEQ A;  3LNM B;  1IVX A;  4DV7 O;  3CX5 E;  3RK3 D;  2KNC A;  4I9Q A;  4DW0 A;  2N1T C;  2P67 A;  2B87 A;  4CS4 A;  3W7T A;  1DF5 A;  4DV5 O;  4B08 A;  1QNM A;  1VQM V;  3RL0 D;  1O7D D;  4DUZ B;  1JUN A;  3X3X A;  3CD6 V;  1IC2 A;  3B5N D;  3HD7 B;  3BEH A;  4X66 B;  4YXW G;  4MT8 A;  1NOH A;  3E7K A;  1SQP D;  1VQ7 V;  4M3L A;  3V5B A;  1Q6I A;  3FAV A;  2JS5 A;  4PI2 A;  4LFC B;  1IBK O;  1N0J A;  2YEV B;  1YGA A;  2H7H A;  2ITC C;  2DOS A;  1MG1 A;  4GUN A;  3IFM A;  1NTM H;  3H1I D;  2WYI A;  4DUV A;  1Q7Y Q;  2IBZ H;  5JWP A;  1MUU A;  1NTK H;  3WMM 0;  2W90 A;  1Y66 A;  1FOS E;  1Y76 B;  1S72 P;  1AVL A;  3OMA B;  1K4C C;  2P4V A;  3RVY A;  4OK4 A;  2DMX A;  1EFR G;  2AGA A;  2QSA A;  3R2P A;  1V55 C;  2XN1 A;  5LXT B;  2W83 C;  1M1J A;  3V2R A;  1L4A A;  2P6J A;  4FM2 A;  2J5U A;  4FM0 A;  2WMM A;  1LTT C;  2F95 B;  4MVQ A;  1J5E B;  4PD4 H;  2ODM A;  3ASN C;  1W0K G;  5JJE B;  1Q86 W;  3AG3 B;  2EZO A;  2YIC A;  4O4L A;  3CCU P;  3CZJ A;  1ZAU A;  2LO1 A;  1F51 A;  2XUM A;  3K5B A;  1FJG O;  1N32 O;  2F43 G;  1E5W A;  1EN6 A;  4PV1 C;  1FXK C;  2VQE B;  1Z2G A;  1HVV A;  2EIM C;  5H5N A;  5LBQ A;  1U97 A;  2LP7 A;  3CCQ V;  3HI7 A;  1WMK A;  2YIU B;  3ZMU A;  1WRG A;  3CX5 H;  4DV3 B;  4MVM A;  2HLO A;  3BRC A;  3TYY A;  2FKW B;  1AR5 A;  4N3Y B;  3HKB A;  2P2U A;  2ZXW C;  2O01 J;  3CCR V;  1R3I C;  4GX0 A;  4GX5 A;  4QPK A;  1L4A D;  3TXQ A;  3JAW A;  1M1K W;  3KYQ A;  2OYI A;  3I5C A;  2EIJ C;  2E43 A;  1EBO A;  1BSH A;  1D5N A;  2JJ1 G;  1LVN A;  3ABM C;  5H6Q A;  4B3R B;  4B3T O;  1XNQ O;  3Q3D A;  2Z0A A;  1ZV8 A;  2HOD A;  3G6B A;  4U7O A;  2E76 C;  4EIJ A;  1KEC A;  2IU0 A;  1YHQ P;  1XOU A;  3CCJ P;  2QKA A;  3L71 E;  4R6Z A;  1KUQ A;  1P84 I;  4MVZ A;  5ITZ B;  2PYL A;  1RWG A;  1IVV A;  3SJC C;  4QPJ A;  3SXX A;  4RO2 A;  4FLZ A;  4UFC A;  1PGJ A;  4LF7 B;  2Q7H A;  4NPF X;  4UUJ C;  4I0X B;  2WVZ A;  1SS3 A;  2E5L O;  1SFC A;  1SQQ G;  4DV4 O;  2FYU D;  2C9N Y;  2UXB O;  2Y4T A;  3IF4 A;  3F5H A;  1YJN P;  3K06 A;  3UT5 A;  3CC2 V;  3OTF A;  4HYO A;  3U59 A;  4IIJ A;  3DDF A;  1M56 B;  4DO2 A;  4MVU A;  1D7M A;  4X1Y B;  1AV1 A;  1PL5 A;  2D2C D;  1WAZ A;  3W7X A;  4X65 O;  2YID A;  3LID A;  3QFY A;  2QWP B;  2BRW A;  4LFB O;  3VD4 A;  5DJT B;  5LGN A;  1KB9 E;  2L6L A;  4YHH B;  4QJF B;  3R65 A;  1IO4 A;  2OTJ V;  3VYI A;  4G28 B;  3LVT A;  4FMT A;  4FLU A;  4W4L A;  1BGY H;  2RQ6 A;  1ZN5 A;  4DV2 B;  3W7S A;  4U3F G;  1FZC B;  3NJV A;  3M9Q A;  3BUD A;  2PAJ A;  1QR8 A;  4CC5 A;  1USE A;  1IVU A;  4P9O A;  1JYW A;  1H54 A;  1NH2 B;  5IJ9 B;  1YXB A;  1JY3 O;  3FB5 C;  2IBZ I;  1VF7 A;  1FFT B;  3AEI A;  5TIS Z;  4WBN B;  1JZ7 A;  3JD3 A;  5GTI E;  1ZLZ A;  4KFF A;  4GOF A;  3BGA A;  2EIN B;  4FFB A;  2GTS A;  1URF A;  1QX1 A;  4JTC B;  1TQT A;  3H1L J;  2QTO A;  1O9G A;  1CPY A;  2JGD A;  2YC0 A;  3DXR B;  1YQ3 C;  5BVZ A;  1FXV A;  4YJ3 B;  1J1E B;  5APQ A;  3ETQ A;  2EX3 A;  2EIN C;  1I94 O;  2CUG A;  1PGP A;  3OE7 G;  3E35 A;  2H94 A;  4PD4 I;  3L71 H;  1Y6X A;  3PN1 A;  2ZKO A;  4GLX A;  4BAY A;  1IZ3 A;  4KP4 A;  5EYP B;  3SWY A;  2NN4 A;  2W6A A;  1JYN A;  4H44 C;  2RN0 A;  2WQY C;  4TT3 H;  1RF1 B;  3Q1N A;  2DQ3 A;  1SQQ K;  2DN9 A;  4ZIB A;  2WT7 B;  3CYO A;  3DC6 A;  4N78 E;  3BVT A;  3H1H G;  1RQU A;  3JAK B;  4FJC C;  1J2J B;  1LGH B;  2RCV A;  5M1B A;  4DOJ A;  1LWU A;  3CX5 I;  2Y69 B;  1GH6 A;  4J7K A;  3CCM V;  3H1K H;  2A0L A;  4CBC A;  1XBL A;  5LHI A;  4FM1 A;  2WSC H;  4GT1 A;  2IJI A;  2FUQ A;  3CXH E;  3BRT B;  4U3J A;  4UVB A;  1BE3 D;  3JCU Z;  3J7H A;  1N34 B;  1L0L G;  1KB9 H;  4P30 A;  2Z5I A;  2NPS D;  3VD7 A;  2WLK A;  3BY6 A;  3STZ C;  1SQB D;  3MP7 B;  2QIW A;  1K1X A;  5E79 Z;  1SA0 B;  1IFN A;  1N9E A;  1TUE B;  2V4D A;  2ZVN B;  1Q5O A;  1EZV E;  1ZOY C;  1EZJ A;  1PKX A;  1LTS C;  3ZRX A;  2PRR A;  2KS1 A;  2W6I G;  3O6Q B;  2AEF A;  1QAF A;  2ZNI A;  4NR1 A;  4YXW H;  4ZI7 B;  1NSU A;  2Y9Z A;  2HHH B;  3LDE A;  2WA4 A;  1XMQ O;  1VF5 B;  1LT9 A;  3BAS A;  3LSU A;  2O01 N;  4IYI A;  4ASW A;  3D3Q A;  3AE2 C;  3JCU E;  3RK2 C;  5APY A;  2Y9Y A;  3CPW U;  1US1 A;  3UKM A;  3CC4 P;  4DR1 O;  2AEJ A;  3SJB C;  1CZQ A;  4AQ0 A;  1JJO A;  1G1I A;  1KTM A;  1BCC D;  1U7J A;  5JMD A;  2OYH A;  2HPC B;  1IFP A;  3GHG C;  1Q2N A;  1EM1 A;  3ICX A;  4HBN A;  1NS1 A;  2NZ2 A;  5E79 E;  5K5G B;  1XIL A;  3B4S A;  1SQQ E;  5APT A;  4J10 A;  4UCV A;  1R8E A;  3LSS A;  2QEX V;  3AG2 C;  3T97 A;  1LTB C;  1QLE C;  4N21 A;  2Q5Z A;  3T2O A;  4KXR A;  5TIS H;  4IHJ A;  3JD4 A;  1JZ8 A;  2WPS A;  2O57 A;  4Z1V A;  1DGS A;  1HH0 A;  3NXS A;  2EBO A;  1PP9 G;  1XL4 A;  4PI0 A;  1GM9 A;  3WG7 B;  4X1I A;  4X64 B;  2WLN A;  1VQ4 P;  2MKV A;  5KLV D;  4MTX A;  5KX5 A;  3PTZ A;  4Y99 C;  4ZNC A;  1L0L K;  3CXH H;  5C8Y B;  2OT5 A;  1SER A;  4DR2 O;  2DWE C;  3L75 G;  1OCZ C;  3KN4 A;  1JFF A;  3LUT B;  4FZ1 A;  3RK3 B;  3IAP A;  1L1F A;  2BSK B;  1RE3 C;  1SQV D;  1W6C A;  2Z3Y A;  2O1K A;  1SQV E;  5KA5 A;  4EB6 B;  2N1T A;  3FXE A;  1EDK A;  4L8J A;  2IDB A;  3OEH G;  2P5O A;  3JSL A;  1GK9 A;  2Y0E A;  3RL0 B;  4C7N A;  2GUV A;  3B5N B;  3VQV A;  4UB6 E;  1OJM A;  3VDC A;  1MMY A;  1EZV H;  1NU1 D;  4IFF A;  4GKK B;  3M99 B;  3RYH A;  4UB8 E;  1LT1 A;  1L0N D;  3VD5 A;  2WLI A;  1RF0 C;  2XV5 A;  5EZY B;  1ZRT D;  1LUW A;  1NT2 B;  1JX9 A;  1TUB A;  2Q1F A;  3B40 A;  2LR2 A;  4XDK A;  2R9R B;  3ZS8 C;  2B9B A;  3VMY A;  2BTQ A;  2E2V A;  3JCU H;  2NR5 A;  4A5U B;  5KMG A;  1DK1 A;  1YEW A;  1NTZ D;  3VSM A;  2KNC B;  1HM3 A;  2YKO A;  3UIA A;  3E89 A;  5D5Q A;  2H8P C;  2B87 B;  5H6R A;  2BCC D;  3L75 J;  1PGO A;  3SFD C;  1KB9 I;  3BAA A;  3BCC D;  5E79 H;  5L3C A;  1SQQ H;  2R3S A;  2Y0C A;  3Q2Y A;  1JZ6 A;  4DV4 B;  4DUY O;  2C10 A;  1S1C X;  2ZAE B;  2ZT9 D;  3FAV B;  2FTK A;  4X20 A;  5L3D A;  1PL0 A;  3HE4 B;  3BRV B;  3BAB A;  4U7N A;  2JEU A;  2FBW C;  4I6M C;  1A32 A;  4BW9 A;  2R5B A;  2WIT A;  5BR8 B;  2KP8 A;  3DEC A;  1N7R A;  1JZ2 A;  4HB1 A;  4IFD K;  4BW5 A;  3G6E V;  3SWK A;  5KKZ B;  2F7Q A;  1L0L E;  1T6A A;  5KHH A;  2ITA A;  4PA9 A;  3VQX A;  4TV9 A;  1MZ9 A;  2NLJ C;  2F66 C;  1VAR A;  4LFA B;  1FXK A;  1Y47 A;  3M9H A;  3S4R A;  4UV8 A;  4O4I A;  5IWA O;  3VOP A;  3T4D A;  2QA4 P;  4EKW A;  1J1D C;  1RM1 B;  1XMO B;  2O1J A;  3VDB A;  4X1K A;  2JKP A;  5EBL C;  2JDI H;  1ZSP A;  3L72 G;  1WNS A;  3KCY A;  3II6 A;  1IVW A;  4U3F H;  2UU9 O;  2WSF H;  2UUC O;  1L4A B;  4ZBM A;  4XFJ A;  1RM1 C;  1W5C E;  2FYN C;  2N74 A;  3X41 A;  1N7O A;  2F7R A;  1TA8 A;  3JAL A;  1OCO C;  2JEE A;  3EJT A;  4XBF A;  4ASU G;  4KL1 A;  5BU5 A;  2OOV C;  3ZED A;  2JKA A;  4QE9 A;  2ZXQ A;  4LP8 A;  1IFM A;  1MV8 A;  1JZ5 A;  5GON A;  2QKC A;  4UB8 H;  4GIF A;  1SNZ A;  4O4L B;  4YY3 O;  2X6A A;  3CCL P;  4JPZ B;  2L91 A;  3WIQ A;  3JYC A;  3L73 E;  4RQF A;  3HE5 A;  4BZG A;  3UQ8 A;  3X42 A;  1V7V A;  3AFL A;  4TQD A;  3B2E E;  5A9G A;  2YFN A;  2QDO A;  3MV1 1;  2AZ2 A;  3USS A;  4MMH A;  5H2F Z;  1Z5V A;  1EDI A;  4JPR A;  2Q7E A;  3CXH I;  3OB8 A;  3HKB B;  1UPG A;  1SQX J;  2Z4E A;  5LP6 C;  1P7G A;  1B06 A;  2OIG A;  3JAW B;  1YJ9 V;  1Y8A A;  1Z45 A;  2OYI B;  2HKO A;  3L72 J;  1K7D A;  4XA4 A;  1J0M A;  3ZHU A;  3H1H H;  3D71 A;  3OMN B;  2DYR B;  2ZDI C;  4FLW A;  3H1J D;  3TF5 A;  2HP8 A;  2D2C B;  2HOD B;  1PP9 E;  4UFZ A;  1EZV I;  4KFM A;  3MHH C;  1KZU B;  2CGN A;  2V4H A;  1HMW A;  2OW6 A;  1W2Z A;  3QTC A;  2G8Y A;  1HNW B;  4MVO A;  2D2C C;  2KSJ A;  2KUB A;  3X2Q B;  5KAI E;  1YZB A;  2ZYD A;  4I7Z C;  5A2Q N;  4FIP C;  1L0L H;  3AG4 C;  4F6E A;  2BEQ D;  1RSO A;  1L7K A;  3D6Y A;  3SYC A;  3SPI A;  3CEI A;  1XI1 A;  4D7S A;  1YIJ V;  1SFC B;  1GZL A;  3EVK A;  4YTP C;  3UT5 B;  3BVO A;  4IIJ B;  3P3P A;  4XDL A;  1FJP A;  1I5X A;  1S5J A;  2VQF B;  3ABL C;  4GKJ O;  1DEB A;  2KKW A;  5L3E A;  3CCS V;  2LXC B;  3ASO B;  1H2L A;  2ZE6 A;  2CPB A;  3CRA A;  1K9M W;  2F4V B;  1K3E A;  1VQL P;  1FS0 E;  1NAF A;  1ENV A;  3AFJ A;  3A24 A;  1NI8 A;  5IY5 B;  2AW9 A;  4K35 A;  3ETE A;  2Q3I A;  3ASO C;  2LKM A;  3L73 H;  3DXR A;  3AEF C;  3T0U A;  2ZD9 A;  4YJ3 A;  4DR1 B;  2BAS A;  3GWK C;  3SGI A;  3VQW A;  1W2E A;  5AVX B;  1UI8 A;  1S9K E;  3Q5S A;  2WVY A;  1TVK A;  3L4F A;  3NTN A;  2UUB O;  3C1L A;  3CI9 A;  1YCI A;  3GLM A;  3Q5R A;  4ZOL A;  1CXZ B;  5LMU O;  1ULV A;  1JY2 O;  5AVZ B;  4WCE V;  3U1C A;  2GHY A;  4FFB B;  2Q8V A;  3WB0 A;  2ZYG A;  4NB5 A;  2AHY A;  5AVY B;  2CWV A;  3BVU A;  3N27 A;  1QBZ A;  4DUX A;  1PS3 A;  3ZHQ A;  2XNX A;  3MAQ A;  1OCR B;  1HR0 O;  2JP3 A;  2LGQ A;  1XNR O;  1PP9 H;  3ETG A;  1A2V A;  3FYI B;  1S5L X;  3CCV V;  3I5D A;  1BL8 A;  1IBM B;  1N86 A;  3K04 A;  1KP3 A;  3ZRV A;  3V6I A;  5KAI H;  5DED A;  3AG7 A;  4JI6 O;  4H44 D;  4GYC B;  1MMM A;  4JYB A;  5CA3 A;  3T1H B;  2M0B A;  4LLH A;  3V2P A;  1IJD B;  1M4U A;  4OVN F;  2FYZ A;  2NPS C;  3LOY A;  3H6P A;  1XQ8 A;  3DYM A;  5DEC A;  1LWU B;  1SQP G;  3OM3 B;  3VOU A;  4D6T D;  1SA0 A;  5HFL A;  3ZMV A;  4CS3 A;  1EC5 A;  4DV1 B;  1JJ2 U;  1P84 D;  3LNN A;  2IX7 C;  5E1A C;  1FDI A;  1W4N A;  3R66 A;  2IZ0 A;  4U3J B;  1M1K Q;  4XDJ A;  3JAM N;  4DV6 B;  1LUR A;  4I2L C;  4GX1 A;  3BAT A;  3DYO A;  1SII A;  5LOV A;  3H1I G;  2CTR A;  2V1D A;  2W0F C;  3O65 A;  1NS7 A;  3P8C D;  1DD4 A;  1QX8 A;  3GHG A;  3SPC A;  1R3L C;  2HTA A;  2XN0 A;  3RYC B;  1D2D A;  4E4E A;  4O2A A;  1FDO A;  4NPE A;  4RJT A;  5CB4 A;  3SYP A;  1EXI A;  2KS1 B;  1A02 F;  2JR8 A;  5KLI B;  1S5L Z;  4JTD B;  1I8Q A;  1NSR A;  1FPO A;  4TSF G;  2WSS G;  1HNZ O;  1SQP J;  1HGZ A;  2HVJ C;  5EIB C;  1P84 F;  3D52 A;  4QIW F;  1LT9 B;  3HRN A;  2XTA A;  1HXK A;  3RK2 D;  3WFV A;  3CSX A;  1D6Z A;  1IQX A;  3BLB A;  4TOI A;  4JF3 A;  2OW7 A;  4UCU A;  1SO0 A;  2GDS A;  4A7P A;  3T1C A;  2OYH B;  4L75 A;  1NTM D;  3K5N A;  2FFD C;  4BIO A;  4FNV A;  3H1I J;  2IBZ D;  1NTK D;  5L3G A;  1V54 C;  3SJQ C;  1MZE A;  1RE3 A;  1VQ9 V;  3T1Y O;  2F23 A;  2X6B A;  3HR0 A;  4AYC A;  1E79 G;  2YKQ A;  1YF2 A;  1YHQ V;  1J0N A;  2B89 A;  3T97 B;  2Y73 A;  2YSU B;  1QLE D;  2IFN A;  2BSK A;  1CW5 A;  1S5L E;  2OTL V;  4IHJ B;  1YJW P;  2ETN A;  1YTF B;  1GO3 F;  1OJO A;  4JI0 B;  3EJR A;  1LR1 A;  2YMK A;  3CV5 A;  4PA7 A;  2P90 A;  3CC7 P;  3OS7 A;  4X1I B;  1RF0 A;  1VQK V;  1PIX A;  4PD4 E;  1G1X B;  5KX5 B;  3ABK B;  1FZE A;  1G6U A;  2XAG A;  1KN7 A;  2C2A A;  3CP1 A;  4EFB A;  1YJN V;  4AQR D;  3EQ2 A;  3LW5 J;  2Q1K A;  1H8E G;  1JFF B;  3TGU E;  4WFE A;  3L74 E;  3CJH A;  3A0R A;  3SPH A;  2ATK C;  1NSV A;  4HNA A;  4I9W A;  2N1T B;  4BZE A;  2A06 E;  1DP0 A;  1U7M A;  3WU2 Z;  5AW1 B;  4C7N B;  2FYU G;  3CX5 D;  1YIT P;  2CIS A;  4JF7 A;  4WY4 D;  3RYH B;  2BT3 A;  3IMH A;  4UVC A;  1GN6 A;  1XTC C;  2JKE A;  3KKY A;  1KD1 Q;  3MHS C;  4RAI A;  2D73 A;  4NXN B;  1E1Q G;  4ZKU A;  2WLI B;  2PFX A;  2W0X A;  3A0B E;  1TUB B;  1FD9 A;  2DYS C;  1GTO A;  2ZT9 C;  2CAZ C;  2BTQ B;  3ABT A;  4LWS A;  5KMG B;  3CME P;  5JJN B;  3HE4 A;  4EDF A;  1RJO A;  3HUS C;  4RWU A;  1BSM A;  4LF4 B;  4KTR A;  3HIG A;  4DT0 A;  3OBA A;  1GN2 A;  2LJ2 A;  1IK7 A;  2H8P D;  2I1K A;  3NMD A;  4QMA A;  1GD2 E;  1KFN A;  2L35 A;  3CX5 F;  4PA6 A;  4IOI H;  4EV2 A;  3ACT A;  1XHZ A;  1V55 B;  2FYU J;  3TET A;  3VMA A;  5KHI A;  2QKS A;  4X20 B;  1KKD A;  1S5L H;  2L5G B;  2HVK C;  2OOV A;  3ASN B;  2OGU A;  1T3U A;  3MV0 1;  1AVK A;  4D7T A;  1D5A A;  3K79 A;  4OPH A;  4GCZ A;  4H0L D;  2KXP B;  1FZG A;  1FZF A;  4TV9 B;  4PV1 B;  1FXK B;  1JZ4 A;  1N33 B;  1JQ0 A;  2Y4U A;  4O4I B;  3CWB E;  5CJ0 A;  1K73 Q;  2ZM6 O;  1H88 A;  2CH7 A;  2EIM B;  4X1K B;  3VTP C;  1K4D C;  4PA4 A;  2WW2 A;  1PM9 A;  2WYH A;  3BUP A;  3TGU H;  3L9D A;  2F7P A;  1VL2 A;  3QG0 A;  3L74 H;  1JO5 A;  3HPL C;  5J2U A;  1BGY E;  2FYU K;  2ZXW B;  2WZ7 A;  1GDT A;  2A06 H;  1FOS F;  1QWU A;  5LP6 A;  3L70 E;  1PPJ G;  3T0D A;  3JAL B;  2EIJ B;  2XOK G;  3I55 P;  5LMU B;  2V7Q J;  2ZDI A;  1DD3 A;  2BEZ F;  2CG1 A;  1GL2 D;  1LOH A;  2FL4 A;  3ABM B;  5GON B;  2CWU A;  4EI2 A;  5KHK A;  2PYJ A;  2E76 B;  2QJK C;  4MW8 A;  3ZBH A;  3A0B H;  3K57 A;  1MZF A;  1H2S B;  4LF8 B;  1MSW D;  1BE3 G;  3VP8 A;  3WA2 X;  1KQS O;  3HE5 B;  1K5Q A;  3AMO A;  1FZB A;  1IBL B;  1HMU A;  2QG4 A;  4JTA B;  4PDR A;  2ZJS E;  1Z5W A;  2DE0 X;  2Z5U A;  2CFG A;  1RPR A;  2WDA A;  3L71 D;  3W68 A;  1AV4 A;  2KOG A;  1S77 D;  3KXD A;  5AVV B;  1QQC A;  1S3J A;  2R72 A;  3N9H A;  5CCH D;  1N36 O;  2CE4 A;  5AVR B;  4I55 A;  1M7L A;  4JAU A;  1QEX A;  4X62 B;  1GM7 A;  1BQZ A;  1VQO V;  2UUA B;  1HGV A;  1IX9 A;  1K34 A;  2J59 M;  1KOR A;  3A3Y B;  3IN6 A;  2YXH A;  2F7O A;  3EJP A;  3JAS A;  3OTO B;  3ZRS A;  3AE9 C;  5EK0 A;  3DC5 A;  3P3N A;  3H1K D;  1GKF A;  3H1K E;  4RUE A;  2I8D A;  1LF6 A;  2EJ7 A;  3K08 A;  1QVF U;  4GOD A;  2DJV A;  3H1L G;  3PH0 A;  2BOC C;  3E22 A;  1KFM A;  1VMG A;  2VRZ A;  1FE6 A;  1WJZ A;  1BE3 J;  3D3I A;  3C90 A;  2UXC O;  1KB9 D;  3F7Y C;  1RSO B;  2YI9 A;  4OGQ C;  5AW4 B;  1EGU A;  1TU5 A;  3CMA V;  3CWB H;  1NS0 A;  1DEE G;  2R70 A;  1SLQ A;  4LF6 O;  1HWT C;  5H9C A;  1SQB J;  2EAE A;  2VS0 A;  3ZMZ A;  3AEB C;  3M91 A;  5KTB A;  1LJ2 A;  4FNS A;  1PV3 A;  3TCU A;  2YUA A;  4AQY O;  3BUI A;  5IJ0 B;  3CCE P;  3F5W C;  3U0Z A;  5AVS B;  2DW4 A;  3L70 H;  3K0G A;  2QM7 A;  3MHV A;  3QDE A;  1OW8 A;  4HZ3 A;  2YXR B;  1JEK A;  1QAL A;  4DR4 O;  3S3X A;  1D6Y A;  1VQ8 P;  1KIL E;  3GVM A;  4OX9 B;  3J80 N;  1HNZ B;  3VP9 A;  2WPR A;  1X1I A;  1VQP P;  3E80 A;  1W2B U;  1CP9 A;  2ZXE B;  4GDO A;  2CTP A;  4DR5 O;  4MVS A;  1SF9 A;  1JCH A;  3AK2 A;  4MTG A;  3CD6 P;  1WA8 A;  2QE7 G;  1KB9 F;  3OW2 O;  4R50 A;  2ZE7 A;  1JY3 N;  3ECQ A;  4P9P A;  1LF9 A;  1VQ7 P;  4FNQ A;  3E1R A;  4JZG A;  1EXJ A;  4H44 B;  5AW2 B;  1TVK B;  1AI4 A;  4JBZ A;  1BCC J;  3KCX A;  2Q68 A;  4CZZ A;  4I4T A;  4WF9 V;  1JMM A;  1WMN A;  4ZOL B;  1KC8 W;  4C46 A;  4KT0 J;  2NPS A;  4LF5 O;  1MMZ A;  5IYB O;  3HTK B;  1NAY A;  1E79 H;  1KD1 W;  5CJ4 A;  3CXC U;  4YIO A;  3S4B A;  2GSM B;  4JI5 O;  1ARO P;  1SC5 B;  5D5P A;  4N78 D;  1ZWI C;  1JB0 J;  5TIS E;  1NJI Q;  3DYP A;  4JYC A;  2H88 C;  1VDF A;  2HJF C;  3E83 A;  2QGN A;  2DW3 A;  1VQ5 V;  1JA8 A;  1FFX A;  2QWQ B;  3QO7 A;  4JAV A;  4JV5 O;  3AK3 A;  4Q20 A;  5KLV J;  5KAF Z;  4NXM O;  2W8Z A;  3CXH D;  3SPG A;  4KFE A;  4JQ0 D;  1MN0 A;  4LNU A;  2R9A A;  4WBA A;  5EBW C;  4FLV A;  1SQV J;  1VF6 C;  1QCE A;  2A45 G;  4DV0 O;  3BCC G;  1FXH A;  3WB1 A;  2CFL A;  2O3J A;  1AB3 A;  2OWO A;  3IAY A;  3FGA D;  2Q69 A;  3H32 A;  1WB7 A;  2WLL A;  4DV7 B;  5KUK A;  3RYC A;  1EZV D;  4J7J A;  1OZ0 A;  4O4H A;  1NU1 J;  4DV5 B;  1X22 A;  2Q0O C;  3A5T A;  1YQ2 A;  1O9H A;  3CCQ P;  2KYV A;  1RWH A;  1L0N J;  5FL7 G;  3RK2 B;  4X9Q A;  1DLB A;  2P22 C;  4J42 A;  3KPE A;  3EFG A;  5AW7 B;  5LOV B;  1K73 W;  1N7S D;  3CCR P;  1LTJ C;  5APX A;  3CXH F;  1NZ6 A;  4DR3 O;  3ETD A;  1CSB A;  1IBK B;  3GHG B;  2D1W A;  1NTZ J;  3S9O A;  2BTO A;  1JOC A;  5KUM A;  1SP4 A;  1V7W A;  4CC6 A;  2VRS A;  3KII A;  4O2A B;  1NKG A;  3DX2 A;  1Y4M A;  5CB4 B;  2BCC J;  1BMF G;  5FPR A;  3AG2 B;  1AI7 A;  1QLE B;  2FY8 A;  1N73 C;  3BCC J;  1SQQ D;  3ZN0 A;  2O01 H;  3AE7 C;  1URQ D;  5EIB D;  3B8M A;  2YO3 A;  1QGK B;  1NWQ A;  2JVD A;  2P7T C;  5HFM A;  3H1L E;  1IUR A;  5DN6 G;  1M5I A;  4Y99 B;  4DXW A;  2WOF A;  3BLC A;  1JOY A;  1GMJ A;  3RN4 A;  3FX0 A;  3CZN A;  1OCZ B;  3FWL A;  3FYE B;  3CC2 P;  2WOH A;  2FXP A;  1KQF B;  1UFI A;  3F5T A;  1AQT A;  2GUS A;  2KI7 B;  1K9M Q;  3JAR A;  1NR1 A;  3IC7 A;  2XAS A;  3AE3 C;  4KHP O;  2E24 A;  3GW6 A;  2A9H A;  1FJG B;  1N32 B;  2YX9 A;  3NBJ A;  1SS1 A;  4U3F E;  3DGE A;  1AVY A;  1BDC A;  2CK3 G;  1HF9 A;  4FNP A;  1MFZ A;  1PPJ H;  2WSE J;  5AW8 B;  2ZYA A;  3VMX A;  1AVM A;  2OTJ P;  1KYO E;  1JYV A;  1EQ7 A;  2P7J A;  3APQ A;  2X7R B;  1VIB A;  1XTG B;  1DTO A;  4G27 B;  2YIA A;  2Q0A A;  3RYI A;  4B3S O;  4JI4 O;  1NS8 A;  4WB4 A;  4WY4 C;  4DR7 O;  4HAM A;  4DW1 A;  1IVS A;  2ZFC A;  1EN5 A;  3JC2 2;  4W4K A;  3RT3 C;  3QH9 A;  2BRV X;  2CFK A;  3B09 A;  2OYQ A;  3T09 A;  1V9P A;  1YI2 V;  1I0H A;  1MFT A;  1N7L A;  3HUS A;  3CJH B;  3ZRW A;  1KSI A;  4B3T B;  4HNA B;  1XNQ B;  1DH3 A;  2Q6A A;  5CBO A;  2GM4 A;  1OJN A;  3EXA A;  2YNY A;  5C39 A;  2MK3 A;  4GZR B;  4R8C A;  1DYU A;  4JI1 O;  3E2E A;  1VQL V;  4I1L A;  1N36 B;  3ALA A;  2E5T A;  1X0T A;  4Z1M G;  5APS A;  3A0H Z;  5BZB A;  2W0Q A;  1FU1 A;  3H1H D;  4LF9 O;  4J9Y B;  3VD3 A;  3H1H E;  1LUV A;  2E3C A;  2E5L B;  5EC1 C;  4F6R A;  1US6 A;  1KBH A;  1S2E A;  2UXB B;  1ZXG A;  2R44 A;  3H1J J;  3K5L A;  1NS4 A;  1SQG A;  1VQN V;  1KU9 A;  2F93 B;  2ZXX A;  1PL4 A;  3CRM A;  4LWS B;  1HNX O;  1MA1 A;  1FJK A;  3AEG C;  3H1L H;  3Q5P A;  4RUF A;  2E75 D;  1PGQ A;  2ZIN A;  4X65 B;  5GTH Z;  3F7V C;  1Q90 D;  1RWA A;  4LFB B;  1J1D B;  1L0L D;  4H0L C;  3CCM P;  2XZR A;  1RY3 A;  4FK5 C;  3D50 A;  1AVO A;  1Q43 A;  3RYF B;  1JCD A;  2CWT A;  1LP1 A;  1WN7 A;  5CBN A;  2WW3 A;  4LF6 B;  4Y28 J;  3AED C;  5J2T A;  3AK1 A;  1SQX G;  1YYC A;  4JI2 O;  2FYN B;  3G4S P;  2EIK C;  1OCO B;  1NJI W;  4K3A A;  4AQY B;  1H8H G;  1F1S A;  1GAX A;  1WLE A;  4K0K O;  4FNT A;  4L73 A;  4O9B A;  4MTO A;  3AG1 C;  3BPZ A;  1P49 A;  1M57 C;  1KYO H;  1EKM A;  1DF4 A;  5LL6 Y;  2Y74 A;  4C7U A;  3UO3 A;  2NRG A;  1GL2 C;  1BZK A;  3D8C A;  1FBM A;  1JMB A;  3QO8 A;  2QJP C;  1AQ5 A;  2CH7 B;  4NTW A;  5JVD A;  5GTH E;  3L73 D;  4AHC A;  2QE7 H;  2Y0P A;  1SES A;  5J2U B;  5B5E Z;  2WZS A;  1CI6 A;  2AZ0 A;  3DDG A;  3ML0 A;  1I94 B;  4XE5 B;  2YXL A;  5LP6 B;  3DX0 A;  4B3M O;  1PZQ A;  3DX3 A;  1U96 A;  5A1A A;  1QL1 A;  2QVA A;  1Q6U A;  2PGD A;  1M1J C;  4H13 C;  3BHP A;  4OH8 B;  5CCH C;  3TXS A;  2IM9 A;  5B1B B;  4GOE A;  4OWF A;  1PD3 A;  1S0V A;  4EYY Q;  1PX3 A;  2R32 A;  2VWJ A;  3UCS C;  2YIB D;  3AMO B;  1KV4 A;  3B8N A;  4ICG A;  1PP9 D;  4AIL C;  4I7Z B;  5B1B C;  1E1R G;  2QEX P;  4PDM A;  3AG4 B;  2YFO A;  1WMO A;  3T08 A;  3FB8 C;  4NXM B;  2W6B A;  2H43 A;  3CZS A;  1GW3 A;  1EN4 A;  4I55 B;  3V4Q A;  3L75 E;  3MI6 A;  1M93 A;  1R5L A;  5H2F E;  3KG2 A;  1SQX K;  3K5O A;  1X1J A;  4X66 O;  2WO0 A;  4JI3 O;  3QWO C;  1PNL A;  3JAS B;  2JRI A;  3ABL B;  2QJ1 A;  1IFI A;  3AE1 C;  1A02 J;  3JCZ A;  3PRJ A;  5IYZ A;  3T4Z A;  3A0H H;  4D6T J;  4LFC O;  1H2N A;  1HP8 A;  3GF3 A;  5IJ0 A;  3SX1 A;  3E22 B;  5CA0 A;  1NSX A;  2PY5 A;  2W6J G;  1KIL C;  4IT5 A;  1UJW B;  4LGD E;  2JJL A;  2ZVO B;  4OGQ D;  1K33 A;  2RJZ A;  5CCG C;  3WUU A;  3PHL A;  3OUF A;  1XMQ B;  1YQ4 C;  2IBZ G;  2RMK B;  4NVP A;  4KUM A;  1NVP D;  2QJY C;  5GTH H;  1VPC A;  4K8Z A;  3PLN A;  1LNQ A;  3SYO A;  1NSM A;  2IH1 C;  2N05 A;  2N04 A;  1K5S A;  3QG5 A;  1PNK A;  1S9K D;  1GM8 A;  1W2B O;  1WPB A;  3MUY 1;  1K1Y A;  5E1Q A;  1P4R A;  5EFW B;  5JMF A;  3M06 A;  2CDY A;  1J5E O;  3HTK A;  1K8A W;  2QM4 A;  3D4Z A;  1KP2 A;  3SDL A;  3A2F A;  3JAT A;  1NHL A;  1YIT V;  2M8R A;  4TQF A;  3OAA G;  1WA8 B;  2EUL A;  3KZI Z;  2B5U A;  1KYO I;  3HKE A;  3RRS A;  2VQE O;  3STL C;  1JY2 N;  1M90 Q;  4DCK A;  4I4T B;  1NTM J;  5TJH A;  3D4Y A;  4ABM A;  5LHH A;  4DV3 O;  5AW6 B;  3CB2 A;  1NTK J;  2NPS B;  1OJH A;  1VF6 A;  1Q3E A;  5AVW B;  5LGU A;  4RQE A;  3L75 H;  3E8B A;  1SQX E;  4DR2 B;  4KHP B;  3G6E P;  3BVH A;  2WLJ A;  4WFH A;  3L72 E;  3NFQ A;  5H2F H;  1RWF A;  3D51 A;  5APV A;  4JYA O;  3T2P A;  2ALW A;  4IFM A;  2C11 A;  1XUQ A;  2CK3 H;  1JMK C;  3I3E A;  5B1A C;  4B3R O;  1SKV A;  1K04 A;  3AEA C;  1IQY A;  3LSQ A;  1HJB A;  1T3J A;  1UII A;  1U57 A;  1FFX B;  4DR7 B;  1V7X A;  3S3W A;  2IYO A;  1H2M A;  3OGI B;  1S72 V;  5CN0 A;  1LTJ A;  3K5M A;  1T8Z A;  3N2G A;  5KJ7 C;  3D36 C;  2R9I A;  4J11 A;  2X0L A;  2KQX A;  4LNU B;  4PJ0 Z;  3DX4 A;  4H37 A;  3K59 A;  1N7S C;  2FXO A;  1HWY A;  4FNR A;  4EFE A;  1B3Q A;  2PI4 A;  1X59 A;  1Z56 A;  1F4H A;  4IL6 Z;  3FKS G;  1MKM A;  4DZO A;  3VBB A;  2M5A B;  1TQU A;  3H32 B;  3SSU A;  1GN4 A;  2WLL B;  3K9A A;  2YMY A;  2P06 A;  3HKC A;  5JQG A;  1N73 A;  4R7C A;  2ZR2 A;  3OEE G;  4O4H B;  1WMP A;  3BA9 A;  3CCU V;  4MN4 C;  1H8A A;  1COW G;  1IDS A;  3VSN A;  2B88 A;  3CPW O;  1X8Y A;  1TU3 F;  3LDD A;  4YHH O;  1URQ C;  2E22 A;  4DUY B;  1S4X A;  1F4N A;  1FYJ A;  5LGT A;  1XL6 A;  1YJ9 P;  1NR7 A;  2Q73 A;  2FFD B;  2E2U A;  1GK6 A;  1JCC A;  4PJ0 E;  1V54 B;  1G8M A;  4DV2 O;  4LCU C;  4RO0 A;  2OQE C;  4BRY A;  3BFR A;  2GUZ A;  3FWN A;  1N0N A;  1PX4 A;  2CGO A;  2CQT A;  4ZHQ A;  3MTU E;  2LW7 A;  5IWA B;  3WVF A;  1SQX H;  3GB7 C;  1AIL A;  4UCS A;  5BY1 A;  1QLN A;  3X3Y A;  3L72 H;  3CCJ V;  4YJ2 A;  1SVF A;  1SQP K;  1RHZ B;  2UU9 B;  2Q7G A;  4K0K B;  3FXD A;  2UUC B;  2JWA A;  2JEX A;  4WY4 A;  2GTA A;  4JI8 O;  1RP3 B;  3T2M A;  2C0W A;  3O9O A;  2EIL C;  1YIJ P;  1BHB A;  1VF5 D;  2CQS A;  2PF4 E;  2JWD A;  1TXK A;  3ABU A;  5B3S C;  4PD4 D;  3KZI H;  2IYP A;  4MTF A;  3TK1 A;  3JAR B;  3TNU A;  1RFY A;  4YY3 B;  1IXB A;  1JTH A;  2E2T A;  1YTZ I;  3EJU A;  2B1G A;  4TT3 G;  3TGU D;  3L74 D;  3C3S A;  1PV0 A;  4MSW C;  1FAV A;  4YPC A;  1BGY J;  1XHX A;  3RGU A;  3JD0 A;  5LYJ A;  5K1X A;  1K05 A;  3VQY A;  2A06 D;  3W67 A;  2JKV A;  4JI7 O;  4JAS A;  1R6T A; 
#chains in the Genus database with same CATH homology
 3BUI A;  3S1K A;  1NVO A;  4CPG A;  3MHV A;  4KJM A;  1OVV A;  4IOI H;  1OVU A;  2OW6 A;  1TQS A;  2SPZ A;  3EJQ A;  4ASV A;  3D51 A;  1LT1 A;  2ALW A;  3CZN A;  3DDG A;  2KUB A;  3BVT A;  4HJG H;  4NPD A;  3DX0 A;  3DX3 A;  2F1A A;  1H0T A;  4NPE A;  2QVA A;  2KI7 B;  1JM0 A;  2KS1 B;  2LR2 A;  2RKL A;  4GOE A;  1R33 A;  2F18 A;  1SS1 A;  4EYY Q;  1HTY A;  4JBZ A;  1BDC A;  3D52 A;  2B87 B;  1R34 A;  2KZI A;  1HXK A;  3DX4 A;  1QWN A;  3BLB A;  2WYH A;  2OW7 A;  3BUP A;  1OVR A;  2HR3 A;  2F7P A;  2P58 A;  3BUQ A;  3ZDM A;  1BDD A;  2LXC B;  2UWJ E;  2M5A B;  1TQU A;  1QWU A;  2ZAE B;  3CZS A;  1MFT A;  2QRX A;  4MN4 C;  4K35 A;  4NPF X;  4ZMD A;  1TQV A;  5CBO A;  3QWO C;  4HB1 A;  2B88 A;  2B89 A;  3EJS A;  1FC2 C;  5C39 A;  2F7Q A;  3BVW A;  5KBP A;  2B87 A;  1Y47 A;  2F1B A;  3DDF A;  1LP1 B;  3EJR A;  1X0T A;  1TQW A;  4ASW A;  3CV5 A;  1O7D D;  4BXL A;  2R44 A;  1ZXG A;  1U7J A;  5DJT B;  3BVU A;  3BVX A;  1S3J A;  2Q1K A;  1Q2N A;  1PS3 A;  5K5G B;  2F7R A;  3BVV A;  4WWI A;  1EDJ A;  3EJT A;  3LVT A;  2F7O A;  1U7M A;  3EJP A;  4HKZ H;  2OTK E;  3FXD A;  3BUD A;  2WYI A;  1ZW0 A;  2M0B A;  2I8D A;  3MZW B;  3D50 A;  5EFW B;  4GOD A;  1LP1 A;  5CBN A;  2KZJ A;  3BUB A;  3PH0 A;  2JWD A;  4GOF A;  1EDL A;  3D4Z A;  1H0T B;  2LXB A;  4K3A A;  3DX2 A;  4ZNC A;  1EDI A;  1HWW A;  2M5A A;  1QX1 A;  1TQT A;  3EJU A;  1EC5 A;  2KIK A;  1DEE G;  2WMM A;  2K3R A;  3RGU A;  2FYV A;  3DX1 A;  5DJU B;  3FXE A;  1EDK A;  3D4Y A;  1JMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...