4K3AA

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
720
structure length
720
Chain Sequence
GDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
total genus 249
structure length 720
sequence length 720
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k3aA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k3aA04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k3aA02
3EJRA 2F1BA 5DJUB 1Y47A 2KI7B 4HKZH 3BVXA 3BVVA 3D4ZA 2LXBA 1Q2NA 1EDLA 2HR3A 3BVWA 4JBZA 1TQTA 2F7OA 2KIKA 2KS1B 3DDFA 3LVTA 1QX1A 4HB1A 2WYIA 4NPEA 2OTKE 3ZDMA 1HTYA 3BUPA 3BUDA 4GOFA 4ZMDA 3CV5A 3BVUA 1JMBA 1R34A 3BVTA 2I8DA 1OVRA 1TQUA 2P58A 3BUQA 1ZW0A 1OVVA 3BLBA 3DX4A 1EDIA 2F18A 1LT1A 2QVAA 2F7RA 4NPFX 2KUBA 4ASWA 1R33A 1LP1B 2JWDA 1HXKA 2M5AA 3EJUA 3MHVA 3D4YA 3DDGA 3DX2A 1EDKA 2KZIA 4EYYQ 2K3RA 2QRXA 1TQWA 1JM0A 1LP1A 3S1KA 3D51A 3FXDA 4IOIH 3CZNA 3CZSA 1U7MA 1TQSA 3EJSA 4HJGH 1FC2C 2LR2A 3RGUA 1BDCA 1SS1A 2LXCB 1MFTA 4K3AA 2M0BA 3QWOC 1DEEG 3EJPA 3D52A 4BXLA 1O7DD 2M5AB 3DX1A 4GODA 1U7JA 1PS3A 1X0TA 4WWIA 2F7PA 2OW6A 2OW7A 5C39A 5EFWB 1ZXGA 2UWJE 4NPDA 3BUBA 3FXEA 2RKLA 1S3JA 4CPGA 3BUIA 4ASVA 3EJQA 2SPZA 1QWUA 2B89A 3MZWB 1QWNA 2WMMA 4MN4C 2FYVA 1H0TB 4GOEA 2R44A 1EC5A 3D50A 3PH0A 2B87B 1H0TA 4KJMA 2B88A 1OVUA 2F1AA 2ZAEB 2B87A 3DX0A 1HWWA 4K35A 3DX3A 2F7QA 2WYHA 2KZJA 5KBPA 2ALWA 5DJTB 2Q1KA 4ZNCA 5CBNA 1EDJA 1TQVA 5CBOA 3EJTA 5K5GB 1BDDA 1NVOA
chains in the Genus database with same CATH superfamily
3EJRA 4UB6E 4G27B 1LJ2A 1XL6A 3AG2C 2X6AA 3CS5A 1SQFA 3UT5B 1DX7A 1X79B 1HF9A 5TISZ 3STLC 5HFMA 4J7ZA 1OW8A 5LP6B 2HR3A 4XBFA 4IGGA 3N2GB 4JASA 1RP3B 2WVXA 4NPEA 2GDSA 4FZ1A 3AG2B 3W7WA 4DJGA 1GL2B 2UUBB 3H32B 2DYRC 2Q3IA 1MG1A 2N9YB 3HKBB 4HNAA 5CJ0A 3K5NA 1X1HA 3Q4HB 5BMVA 3K0GA 3W67A 5KAIE 2ZNJA 1X4TA 4U3FE 1X1IA 5IWAB 1PNMA 4KTRA 3GW6A 3O65A 1K97A 4FVMA 4CS4A 4U3FD 4B3RB 1A2VA 3C9IA 3H1JH 1GL2D 2DYRB 2KB1A 1YQ3C 1GN3A 4MTGA 2MW2B 4IYIA 2A06E 1R3IC 3CCSP 1BMFG 4CC5A 2R3CA 5CB4A 2ZVOB 3KCXA 1BCCJ 3S4AA 5AW3B 1Z56A 2YXHA 4YJ2A 2Z4EA 1OX3A 5BU5A 4X62B 2Z3YA 2W6BA 2ZDIC 1PD3A 3FB5C 1UI7A 3EJSA 1LWUA 1RKYA 2XDJA 5BR8B 4JQ0D 4JAAA 3VDBA 1S9KE 4K3AA 3TDKA 3H1LD 1DEEG 3FX0A 1JY3N 3FB8C 1O9GA 4F6RA 3T2PA 3ZJZA 4LF8O 3K5BA 4FLVA 1IBLO 1X0TA 3SWYA 2G38A 1KORA 1M90W 5EFWB 1LF9A 4DV5O 2ZNIA 2WDAA 4PDRA 4GKJB 1G1IA 2Y73A 2YO3A 4NPDA 4JYAB 1IFMA 1KFNA 3F89A 2BOCC 3DYPA 2P22C 5H2FE 2OYIA 3L75E 4JAVA 5KLVG 1F4AA 4CPGA 3BUIA 3TETA 3SWFA 2YC0A 2AEJA 3CE2A 4ABMA 1K73Q 1K8AQ 2Y48A 2DW3A 4BTWA 5FNVB 1RE4A 1VIBA 2YKPA 1BE3J 2NLJC 2IBZE 3H1KD 2WLIA 2E75C 3TF5A 3ZMVA 4EB6A 1CSBA 1RF0C 1TVKA 1RWFA 1CW5A 2UXCB 2BTQA 1NAFA 3GMAA 3TK1A 4JF7A 1SFCC 4OPHA 4UB6H 4TQFA 2WSCJ 3CXHE 1VL2A 3D70A 2GUVA 1TAEA 1COWG 5DEDA 2FY8A 4JI0B 1SQBE 3SEPA 2E75B 4B3TB 1SQBD 1SIIA 4DR2O 4FLTA 1E1RG 3P3PA 4QNHB 4DV2B 3D71A 1L7KA 3SJQC 3CYOA 1D6YA 4DXWA 1N7RA 3D6ZA 4YXDC 2GUSA 4LWSB 3L72E 5AW0B 1NSXA 1PL4A 1HWYA 1VF6C 1N73C 1SQVG 4A5UB 4XDKA 3D4ZA 3V2QA 1NKNA 3L73G 2WVYA 1LTGC 1TQTA 3LVTA 2CPBA 2JGUA 3A0RA 4FJCC 3JALA 1BSHA 3CC4V 1IURA 2V1DA 1F51A 1RJOA 3BASA 2LGQA 2A06H 2QM8A 3U11A 3U59A 1N73B 2CAZC 3HD7B 3CMEP 1NSMA 3E1F1 4X88A 2UU9O 1UFIA 4OWFA 1RSOB 2OTLV 1NJIW 1ZAUA 4UCOA 2A45I 1GO3F 1R3KC 3VD7A 2WSFH 2PUSA 1KSIA 4NXNO 3C8VA 2HHHB 1SLQA 3HD7D 1SQXE 5IJ9A 4C7NB 4JF3A 2VRZA 5KLVJ 1G2CB 2FFDB 4LBEC 1KC8W 3ETGA 1JYWA 2IJKA 3OB8A 3B8EB 4N3YB 3BPZA 1USDA 2JS5A 4KFMA 3HRNA 5AW5B 4MVUA 5CBGA 3G4SP 2CH7B 2FMLA 1FC2C 1Q6UA 4X89A 5JVDB 3P8MC 2Z5UA 3PJSK 3RGUA 3L75H 2PI4A 3APQA 1HBWA 4R6ZA 1QLEC 2QDOA 1J0MA 3D3QA 2WOFA 3PGBA 1A02J 2IBZH 1CEZA 2OW7A 1KFMA 2E24A 5LHGA 2DQ3A 3L35A 4PHZA 1NS2A 4I4TB 2UWJE 1QLEB 3CCSV 2ZCEA 1PGPA 1SKVA 1JA8A 2ZD9A 1FDIA 3CXHH 1AVKA 4UCVA 1D5NA 4AQYB 2XV5A 2E76C 1MMUA 1RPOA 4ASVA 2FB5A 1UIXA 2P7JA 3RN4A 2UXBO 1SQVJ 1W59A 4CS2A 4H13D 2R9IA 3L73J 3MI6A 1AILA 2DYSC 2E42A 1IZ3A 2GV9A 2XU6A 3L9DA 4DV1O 3L72H 3T1YB 3ZHRA 1PV3A 3OS7A 1YTFB 5B66E 3AG1C 4FFKA 3DX3A 1SQQE 3A7OA 3CCUP 1WMOA 1BZKA 3L70J 2EJRA 1H89A 2JVDA 1N7QA 3MP7B 3C3TA 3BAAA 3CRRA 2OYHA 5GW7A 2IM9A 3LNMB 1BHBA 2NPSC 3HIGA 1P84D 4LH7A 3JD1A 3KKYA 2FXPA 3IAPA 1Q90D 4LF8B 1ZSPA 3M7MX 2KI7B 4D6TG 2LW1A 2UXNA 2WLLB 2YMKA 1JOCA 1YXBA 4DV5B 2C9LY 1NTKJ 3KN4A 3T4DA 1BSNA 3B71A 1OIPA 2D2CC 1I5YA 1NTME 1BGYG 2K88A 4TV8B 3CWBJ 1SPUA 4RUEA 1SQXH 2OCCC 4FFBB 2XT9A 3H1IE 2BRPA 3HE4A 4PV1D 4N78E 1B3QA 1ULVA 5AW8B 4GT1A 2ZE7A 1RF1C 1WMPA 5EBMC 1PGOA 3NBJA 2CDYA 2K1EA 4K8ZA 2D2CB 1HR0O 2I8DA 1JRQA 1K4CC 4IIJA 5LXTB 1KBHA 2OCCB 4LNUB 1YBKA 3E35A 4K8XA 1OW7A 4EV5A 1G6UA 1KU9A 2LFSA 1LT1A 1MA1A 2UXDO 2QVAA 3CJHB 4WVZA 3DTUB 3VMYA 2F7RA 1AROP 3S4BA 1A32A 3KZIE 3B40A 1VF5C 1NSSA 2RDYA 3T0UA 1W0KG 3NR7A 3QO5A 3SYPA 1EM1A 4DR2B 1QNMA 2Y0DA 4PDVA 1PIXA 4YXWH 3K06A 4CBCA 2WQYC 2YKQA 1GTWA 3CZNA 2YIAA 2QSIA 2Q7GA 1YTZT 2CG0A 1AQTA 4YJ3B 1R6TA 4WFHA 1QAFA 2VRSA 4B86A 5F2VO 1F4HA 3CMEV 2Q4PA 4I0XA 5L3CA 1AJPA 3ZRSA 3G9RA 1W5CE 1F4NA 2IZ1A 2PAJA 1MFTA 4B3SB 3DXRB 2H8PD 2WZSA 5EK0A 3ZN0A 3ABVC 2BCCE 1YI2P 2M5AB 1N7LA 3D3IA 1ZL8A 1P7BA 1GM9A 1V55C 3ML0A 2JJLA 5C39A 1BQ0A 3K03A 1M56B 2RJZA 1M8OB 3BRTB 3L74G 4FM2A 2CFWA 1Y74B 2OOVC 2ODMA 4ZI7A 1MZEA 2GHYA 3BATA 5B66H 2HODB 4U7NA 2F95B 1GH6A 3SJBC 2UU9B 1PV0A 5LGUA 1SQQH 3U10A 2BEZF 3OW2U 1JCCA 1V55B 1R1BA 3V6IA 5APQA 3WA3A 3JCZA 4LCUC 2EULA 3K04A 2OYQA 4NXNB 1M56D 2N1TA 1JZ7A 2PGDA 4O4IA 1OCCC 1KZUB 1DP0A 1LF6A 3VMXA 1WNSA 2K37A 3AEBC 2UXXA 2A45G 1Y8AA 4JPRA 4O4HA 5LOVB 1BGYJ 3RK2C 1FYJA 1N9EA 3M91A 2Q73A 2PP6A 1MZ9A 2B87A 4UB8Z 3M8AA 1OJNA 2H94A 2XOKG 1L4AC 1OACA 5GONA 3IJ4A 1V7VA 1OCCB 2CISA 1DGSA 5CCHD 1ZN5A 3RK2B 1NTMH 3OEEG 5EC2C 3H1IH 1VF7A 2JDIH 4P2ZA 5C8YA 5GTIE 1FZFA 3CRAA 2WLMA 4ZIBA 3N27A 2GBOA 3I5DA 5IJ0B 4WF9V 3USSA 4ASUG 2YS8A 1K73W 1K8AW 1VQ8P 5EYPA 4XE5B 1EDLA 3H25A 3BVWA 4TUYA 5DECA 1NU1E 1FXKC 4BZFA 3KZIH 2A79B 2ZIOA 2ZJSE 3N2KB 3CCUV 1IU7A 3ZCCA 5L8RJ 1XREA 2UXBB 4PI0A 3CX5E 1Q43A 1K9MW 3SPCA 3CXHF 3MDSA 4I55B 1VQ7P 3RW0A 3CXCU 1ZWIC 4IL6E 3MV11 1LTTC 2F4VO 3HUSB 3TNUB 3I55P 5KMGA 5LA6B 2W83C 3Q1MA 4RO2A 4DV1B 2W6JH 1SS3A 1G1XB 3LIEA 1N7SD 1M4UA 3OUSA 4X1YA 2IJIA 2HFED 4PD4H 5B5EZ 3F7VC 3U1AA 3MAQA 2W6AA 4XA4A 1L0NE 1E5WA 2BCCH 3FFQA 3RL0D 5APVA 2EABA 1FBMA 4UVAA 1K3EA 2GSMB 1JM0A 3BRVB 3PHLA 2AHYA 2JEXA 4BIOA 1L0ND 3P7KA 3OMNB 3PRJA 1HH0A 4D6TD 4TTGA 1SC5B 3TGUJ 3ACTA 2V7QG 1DD3A 2E5YA 1NGMB 2PNCA 2X6BA 1RM1C 4JV5O 1BGYD 2H89C 3H1HE 4MT8A 2JGDB 1S5HC 4WWIA 2OQEA 4HZ3A 2Y4TA 3BCCE 5L3EA 2PYJA 1BT8A 1QVFU 1NSUA 1ZXGA 4H44C 5KTBA 5L3GA 1X22A 2XKMA 1RM1B 3SPJA 1HR0B 1SQBK 1FFTB 1YJ9V 2Q5UA 1ZX3A 2QTSA 2UXDB 3GF3A 4H44B 5JJJB 1VQMV 1QVGU 4UXNA 4DOJA 1WRGA 4LF6O 1KV4A 2QWNB 5GTIH 1OVUA 2WW3A 2VWJA 1M7LA 1PP9E 3TXQA 1JCDA 2R3SA 2K9JB 1JB0J 4NR1A 1XL4A 1HNWB 3B5NA 1IC2A 5KLIC 2ALWA 3ACSA 5K1XA 1JJ2U 3X3ZA 1NU1H 5CBFA 1CPYA 3HE5B 5DM6V 2XHNA 3K5MA 1EDJA 2YX9A 2QJ1A 5CBOA 3FGAD 3CX5H 4QE9A 4DW0A 3CCMP 5DJUB 1Y47A 4C7RA 3JASA 4JZGA 2NN4A 1JPXA 3OR7C 3L74D 5KLIB 1I8QA 5KHKA 3T2OA 4IL6H 3BABA 2KNCA 1AJQA 1ZLLA 1PX3A 4BZGA 3JCUE 3LDEA 1KILE 3L71D 3V4QA 2WVXB 3VD3A 5IWAO 5CCHA 2F7OA 5JJEB 2KIKA 1SQXK 2KS1B 2HLDG 1MABG 2HPCA 4WBNA 4RWUA 2WYIA 4I50B 2XUMA 4DR1B 2J5UA 2V7QJ 4TLFA 4U3FG 1XMQO 4HNAB 1OMIA 1WB7A 1QAKA 3SX1A 5BMVB 1THZA 1LOHA 3B09A 3BVUA 1OVRA 4DYLA 1RH5B 3A5TA 2RDCA 1MFZA 4FM1A 2A06G 5TJHA 2CWTA 3FYIB 1J95A 3AE3C 1MNGA 1LTJA 5FPOA 4GLXA 1JTHB 1M1JC 1LWUC 2CTPA 1MOFA 1AJNA 1ZMEC 1UG9A 2KUBA 1P84I 1UJWB 5J2TB 2P1JA 3P8CD 5CB4B 4ZKUA 3G71P 1R33A 3QFZA 1VQ8V 2PFXA 3S4RA 3R66A 4YJ2B 3H1HH 2QEXV 3VD4A 1SQPJ 2QRXA 1USEA 1NI8A 5CBHA 2WPQA 4IOIH 1M1JB 1LWUB 3BCCH 4DR4O 1J1EC 3B8MA 1JYXA 2Q68A 4ZOLA 4JI3O 4BZEA 1NYHA 1K4DC 1F23A 1JNMA 4WY4A 2H43A 4JYAO 5KJ7C 1W6GA 1JQ0A 1MKMA 5EIBC 3KIIA 1W0JG 1FJKA 5E79Z 1KP2A 2Q9LA 3X2QC 3QVNA 3I55V 5IYBO 3OJAB 1J1EB 3D52A 2OARA 2QE7H 1H38A 1S72P 3SPIA 3FB6C 3ITKA 3L75G 1RE4C 1JZ2A 1VQ5P 2BSKA 5AG2A 2OWOA 3II6A 2OYIB 1I08A 1YEWA 3LDDA 4RESB 1LVNA 4MMHA 5H6RA 2F4VB 1PP9H 2OT5A 3AEIA 1SQQK 2IBZG 1AJYA 1ZR2A 3MPHA 3R65A 1KP3A 3CCQP 2KB7P 3AG7A 1G1JA 1RY3A 1GDTA 3QH9A 5K1PA 3E2EA 3FX7A 4JGSA 4EB6B 3AEEC 2XNDG 4KP4A 4B3TO 4GOEA 3QFYA 1FS0E 3G67A 3WIRA 5LHHA 5AW4B 2EX3A 1SQBG 1NTZH 1NS1A 3K3WA 3H1JD 1GU5A 2B88A 4DW1A 1GK9A 2KSJA 2WVZA 4U3FJ 1QHTA 1EN6A 4K35A 2WSEJ 1ZLZA 2F7QA 2M8RA 4UB6Z 1XUQA 4UV9A 1PGJA 4K0KB 3JCUH 3I3DA 4O4JA 5EC1C 1F7YA 4NXMO 1JY2O 4JV5B 2A9HA 1LR1A 2XAFA 5CJ4A 3KDPB 1OJMA 2XSGA 1BDDA 2WOHA 5IDJA 3SGIA 2DOSA 3K08A 3E8FA 3H1LJ 3BVVA 4KFDA 2XASA 4JZ2A 3QF7A 5IYDO 4UFCA 3UKMA 2P5OA 2LFRA 2XAHA 1OZ0A 1Q86Q 1B6QA 4O2AB 4I5SA 3O6QB 3P32A 3C3SA 5KAIZ 1S2EA 3C1LA 1KMIZ 1O9HA 3J81N 5CCGD 4MTXA 1Z5WA 2YDEA 2QTOA 4NTYA 1HMWA 3NJXA 1GK6A 2N9BA 3RYIB 1SO0A 3BVTA 1SQXG 3BUQA 1WJZA 5LP6C 4LF6B 2PY5A 1LUWA 2CPSA 4ZBMA 3CCEP 2EIJC 3L75J 3DX4A 2LGWA 5IJ9B 3IFXA 2OIGA 3CCMV 3H1KJ 4NPFX 1KILA 3A2FA 3UCSC 1W3YA 1GL2C 2EIKC 4RNLA 5ITZB 3MHVA 3FWNA 1CXZB 5FPRA 2EIJB 1WN7A 1URQD 4UVCA 1JY2P 5AW7B 1NVPB 1M57B 1NH2D 3CZSA 5HFLA 4TSFG 3L36A 1KB9E 1XILA 5B1BC 1SQBJ 2EIKB 3JSVC 4YXWG 3RK3E 3ZMSA 1M93A 1LTBC 2WT7A 2YIDA 1MUUA 4AQYO 1YGAA 3LSSA 4DT0A 3SXXA 1AI5A 1Y67A 3OD4A 2XAJA 5H2FZ 3X3YA 1NVPD 1M57D 3WU2E 1N2DC 2C2AA 1E1QG 5B1BB 1L0LH 2IJHA 3SJAC 3ZHUA 1XMQB 1HJ0A 2RQ6A 2HG5D 3AMOB 5JH7A 1QL2A 2O1JA 2FYUE 5EBLC 2LKMA 3T1YO 2FUQA 4NTWA 2A06D 1Q8IA 1FZCA 1NT2B 4JTDB 4MVMA 2SPZA 3LW5J 1VQNP 1YDXA 3A8TA 2ZYGA 4EV2A 1XHZA 3DYMA 3LIDA 3D50A 1BL8A 3BY6A 3JSLA 5KHJA 1SQQG 4EOTA 4JI1O 1R8EA 4KJMA 3V5BA 3RYFA 1XTCC 3I56P 4F6EA 1S9KD 2F1AA 3M06A 3ZRWB 5DN6G 3W7SA 3ZMZA 4DR4B 4F4LA 3VBBA 4TOIA 4JI3B 2YUAA 1VQ5V 1V7XA 3AE2C 3EFFK 1NU1K 4WB4A 3NXSA 3MUDA 1JZ4A 1CI6A 3GVMA 4L8JA 1MMXA 5AVTB 3TYYA 2BTOA 3JARA 1AFOA 3CCQV 5CBNA 4O4LA 4IT5A 3X3XA 3L75D 1JZ5A 4IHJB 5B1NA 2W0QA 4WFBV 2M6YA 4H0LD 5JQGA 2ADPA 3CLQA 2JDIG 4DR3B 3E7JA 4MVRA 3OGIB 4Z1MG 2IBZD 1P7GA 1LUVA 1SVFA 4JBZA 3VMZA 1T5EA 1IQXA 3HE4B 3IF4A 2L6LA 1XNQB 1FDOA 4R8CA 4DR5B 2L35A 4LF7O 1X1JA 5AW6B 3CD6P 1OCZC 1AVMA 1L0NK 2OTKE 3CXHD 4FNRA 1OJPA 5KUMA 4YIOA 2MKVA 3T97A 4IIJB 3VQWA 1N33O 2O01H 1B04A 3A0BE 4DZOA 1IX9A 1VQ9P 1TQUA 4HBNA 1KYOE 2WVRA 1ENVA 2CQTA 1OCZB 3P3NA 4ZHQA 4EKWA 1KB9H 1W2ZA 2ITAA 1Q3EA 2PYLA 3FAVA 3L72D 4QIWF 2CFGA 3EWKA 2YXQB 5CCGA 3ZRVA 3HD7C 3MGNA 3MV01 4B3SO 1H54A 2W6JG 2W0XA 4NXMB 1DTOA 1TUBA 2EINC 4LP8A 1KECA 2ZYAA 3WU2H 2IJJA 1JZ3A 1MSWD 1SA0A 3NJVA 4RO0A 1TGOA 3RL0g 1GAXA 1AV4A 2A0LA 4I0XB 1TU3F 2LO1A 1H8HG 3NMDA 5CN0A 2FYUH 4HJGH 4J41A 2EINB 2AHZA 3CC7P 2FFDC 2CGOA 1WB8A 3Q1NA 3QWOC 1ZL8B 3CCEV 3T2QA 1BCCE 1ZTEA 3IAYA 1URQA 3K59A 2WO0A 5BXZA 1VP7A 1SQGA 1OXZA 1WP8A 1YIJP 1SQXD 3AG4C 3FYEB 2JK5C 4BRYB 2CQSA 3RVZA 2Q7CA 3J7HA 1Y76A 3RYCA 4U3JA 2N1TB 3OW2O 4O4IB 2IU3A 2CFKA 1AR1B 4X8AA 1AQ5A 2AGAA 2ETNA 4ICGA 4DR7B 3GHGA 3AG4B 1SERA 2GUZB 1EC5A 1EZVE 2I1KA 1JCHA 4H13C 3SYAA 2B87B 3PH0A 3WMM0 1VMGA 3AFJA 1H0TA 2GTAA 3VSNA 2B9BA 3LDCA 3ZBHA 5B3SB 2N1TD 1NOHA 2Q7HA 3DC6A 3CCRP 1W5ZA 4H13B 3N2GA 1KD1Q 1BE3E 2Q67A 5KX5B 3WUUA 1IK9A 1WA8A 2Q8VA 2Q1KA 2QJKB 4G28B 1IVVA 4XDJA 1U97A 5EZYA 1FXVA 3MHHC 2YIBA 3B4SA 3IAQA 4TT3H 4MW8A 4AI8A 1JY3O 1VQNV 1OZHA 1NU1G 5JJNB 1KTMA 3A0BH 3Q5RA 5EYPB 2Q0OC 3QNEA 1S0VA 1WPBA 1KYOH 3K79A 1FJGO 3DGEA 2ZM6B 3PP5A 2IU0A 2IH3C 1IFPA 1GZLA 3OE7G 2Q0AA 3QO7A 3I56V 1E79G 1V54B 1PL5A 2YEVA 3OMAB 3J7AU 1HNXB 4WFFA 2JJ1G 4AHCA 3T08A 1I94B 4DR6O 2RCVA 1EGUA 1M9NA 3M0DA 4FNUA 2QR4A 3ZHVA 4PV1C 1SQQD 3AE9C 3KZIZ 2HVJC 4ZMDA 2JIZG 3VDAA 5FL7G 2POHA 3RWRD 4JI1B 4X1YB 1DD4A 3OGCC 1L0NG 5APUA 2CTRA 5IYZB 4DV4O 2Q6QA 3MHSC 4PV1B 4H33A 1QEXA 1YHQP 2CK3H 2H3OA 1V9PA 5BY1A 1MMYA 1HNZO 1OJOA 4P30A 3D4YA 1HM3A 4FLWA 1BCCH 2ZXQA 1TQWA 4KFFA 3D51A 4KHXA 2VQFO 1N36O 3CD6V 3JD2A 1NTMD 4PJ0E 1XEQA 3W7UA 1U7MA 4FNVA 2NNUA 1Q86W 3H1HG 1PL0A 3H1ID 1LXKA 3VMAA 4ZKPA 5GTHE 1H2KA 4N78D 3UM7A 1BDCA 4O2BA 1VQ9V 2Q1FA 4AQ0A 3EXAA 5KLVE 1VQLP 3SFDC 2FKXA 5BVZA 1US1A 5FNVA 2H8PC 2G8YA 2XZRA 4R4LA 2WLKA 4LF7B 1EZVH 1X8YA 3K9SA 2F7PA 2WA3A 1N8RQ 1SZTA 2EILC 3VP8A 1QVFO 1N33B 2QE7G 3BUBA 4AQRD 1OFCX 3IMHA 3IR9A 1LT9A 4QJFB 1RF0A 1PPJE 3WA2X 1HNWO 2EILB 4Z1VA 3JD3A 1SFCA 1BE3H 5IY5C 1PP9G 1WT6A 2ILMA 2F43G 2ADQB 4DCKA 1M56C 4PD4E 2Q6AA 3JAKB 4LWSA 1DIPA 3K58A 4PD4D 2WSCH 3X40A 5CA0A 4ZKIA 3RYHB 3OTOB 1K1XA 2YSUB 3B5NB 3F5TA 5IY5B 2BCCD 3E8HA 2WYHA 2XN1A 1D7MA 1VARA 2N04A 1SQVE 2R32A 2EIMC 1IBMO 1GKFA 1OHHG 1YIJV 3TY1A 2O01N 3L73E 5CCHC 3L71G 1JZ6A 1L0NJ 4MVQA 1VF6A 3AG3C 5D5QA 1N73A 2PF4E 3EHBB 1GM8A 4DR1O 3JASB 4FZ0A 4KL1A 4BWAA 1J5EB 2KLVA 3B5ND 4D6TJ 1AI6A 5J2UA 2IH1C 3G4SV 2K1AA 2YKOA 2F1BA 2BT3A 2EIMB 3OM3B 3V2RA 3NBBA 1KQFB 2W6IG 4JI8O 3VDCA 3L70E 1SETA 3VD5A 3AG3B 2B1IA 4IL6Z 1CP9A 2R70A 4C7NA 4FM0A 2P67A 3JC22 3H1HJ 1QX1A 4OK2A 1HW7A 1QU7A 1R3JC 1K5SA 2AXTE 3CCRV 3SYOA 5FLXN 3ZDMA 2ZR2A 4OVNF 2Z5IA 2IX7C 1URFA 1KKDA 1NWQA 1NTKE 1NR1A 1EQ7A 1NHLA 4PJ0H 3ZX6A 3IC9A 5JVDA 1XI1A 2F18A 3CWBE 1K33A 2E5LO 4JI2O 5GTHH 1N7SC 5KKZB 3QG0A 2ZQ0A 4I2LC 5KLVH 1JFFB 1FFXA 2HFEC 5AVRB 4AYCA 3EJUA 3JATA 1ORQC 3IC7A 3HUSC 4X9QA 3RL0C 4BTXA 2C0XA 4B08A 1JEKA 1YTZI 4CH4A 2KSDA 2BRWA 2IBZI 3EFGA 1N7SB 1NU1D 4IFDK 4J9ZB 1VPCA 2FYUK 1N0NA 2ZYDA 3U1CA 3CRCA 3CCVP 2HLOA 2KG7B 2ZT9D 3CX5D 3CXHI 3I3BA 3AE4C 3RL0B 1FJGB 2UUCO 2FXOA 1J0NA 1GRJA 4YTPC 1PPJH 3EJPA 2M3EA 4WY4D 1RWCA 1G8MA 3AEAC 3KXDA 3L74J 4X1KB 5BZBA 3O8ZA 1KYOF 2K9YA 4DR6B 1PS3A 3GWKC 1YHQV 2Y0PA 3A0HE 1XDCA 4PA7A 1GD2E 1AP5A 3W68A 4DRXA 1H2GA 1WPXA 4EFBA 3L71J 1MMZA 3ZIAG 3BA9A 4LC1A 4UVBA 1HUCA 4N21A 1JVMA 2KYVA 4DV6O 1K04A 2WPRA 3H1JG 4YIPA 3SWKA 4RUFA 4L75A 2F1MA 1M5IA 3KG2A 1SQVH 4CZZA 1W4NA 4DV4B 4K0KO 3MZWB 1MZFA 4TV9A 1RQUA 3L73H 4LF5O 3VTPC 5AVVB 4U7OA 2R44A 4L74A 1I0HA 2E74D 1HNZB 2QM7A 3TSIA 2JJ2G 4GX2A 5CMUA 1VQLV 1N34O 2WLLA 2QJYB 3CCLP 1H2NA 1FOSE 2HEPA 3S3WA 1MN0A 4LH6A 1JUNA 3DX0A 2VQFB 4DUYO 1N36B 1JYVA 3H1HD 4O4JB 3L70H 2Y9YA 2NPSA 5KBPA 1RFYA 4GYCB 4I1LA 4TV8A 3BCCD 3ETEA 2WW1A 2D1WA 3ZN1A 1H8AA 1UIIA 1T2KD 3HKDA 2WA4A 3JCUZ 3ZEDA 3RSYA 3RBZA 1KKCA 3HKEA 2AXTH 2D73A 1GN4A 3KYQA 5JMFA 3X41A 3Q2YA 4DV3B 5APYA 4X1IB 5LXTA 3IN6A 1DK1A 2OCHA 2CG1A 1NTKH 2WPVB 4M3LA 2JKPA 3DYOA 1Y6XA 2LXBA 2FYZA 1HDJA 3CJHA 1AB3A 1R3LC 1R6NA 2YIUC 1RF1A 2Q69A 3CWBH 1S5LZ 2B5UA 1YI2V 1T3JA 3BRCA 5AVQB 1Q7YQ 3A24A 3S4CA 1K5QA 1NBMG 1PP9D 1HTYA 2ZIMA 3ALAA 1K05A 5IT9N 2YIUB 1UPGA 5LHIA 3AK3A 5B5EE 1Q82Q 1OWAA 3AEFC 4YJ3A 2HP8A 1N7PA 4OGQB 1NTZE 2D3OW 2P58A 1KD1W 1JY2N 3TCUA 1PKXA 4E4EA 2MJZA 2AZ2A 3H01A 4LR3A 1NTZD 4BZHA 3QG5A 1EBOA 2BOBC 3FWLA 1JX9A 4P9PA 4EEQA 1TA8A 1H8EG 3H1JJ 3BLCA 1IBMB 2M5AA 1OCRC 4OGQD 4N6JA 2K3RA 1GTOA 3ASNC 3S1KA 1KILD 3A0HH 2FL4A 2GTSA 1JJOA 3AE6C 2JO1A 1IFIA 1TQSA 5JCOA 3A0OA 1OCRB 4HYTB 3BVHA 4JI8B 1YF2A 3JAMN 1GW4A 2EAEA 3SPGA 3ASNB 1N0JA 2M3BA 2LXCB 4FPPA 3HKCA 2QSAA 2OOVA 5KAFE 2F93B 2FYUG 1GMJA 3H6PA 4BXLA 1HN0A 1OCOB 1FZGA 1O7DD 1ZRTE 2WCOA 2LJ2A 4PA3A 5JH7B 4GKKO 3RFRA 5AVYB 3N4XA 2A3QA 4I7ZC 4RKUJ 3TGUE 3GLMA 3WB0A 3ZHTA 4J5TA 3K5OA 2QIWA 3FXEA 1ZUQA 1KQLA 4X20A 3VQXA 4U7JA 2B1GA 3T1HO 5APXA 2X03A 4I7ZB 1ZP0C 1QWUA 4XFJA 1JR9A 2B89A 2WMMA 2E5LB 4JI2B 3CCVV 3EVKA 4MN4C 1OJHA 1VQ7V 1Q81Q 3D36A 1FU1A 1L4AA 3RYFB 2OYIC 4F6RB 1NSVA 1P49A 2C9NY 1P4RA 3E89A 2IW5A 2RN0A 5KA5A 4WFAV 2R72A 4GX1A 4Q20A 3O9OA 5J9PC 2NRGA 5IJ0A 1QX8A 1K92A 4JI6O 1YITP 3I5CA 1IDSA 1DH3A 2C11A 4DR3O 2KZJA 2OQQA 3ZMTA 5LGNA 3E1RA 4UV8A 2ZFCA 4O4LB 3NFQA 3F5WC 2UUCB 1XNQO 3A2AA 1Z2GA 4DR5O 1N8RW 4YHHO 3JAWA 3BGAA 2WLIB 3ABLC 2XTAA 4JI4O 5JQGB 1RE3A 1K1YA 5CMZA 1TVKB 2ZE5A 1FXKA 3IGAC 2L91A 1I5XA 2BTQB 5B5EH 1L0LE 3OR6C 4TT3G 3U0ZA 1U96A 3CCJP 1L0LD 2QJPC 4DV6B 2QKSA 2N74A 3ABLB 4PD4F 1WP7A 2KSEA 3OMIB 5CA3A 1L1FA 1IBKO 3A3YB 4CH3A 1IK7A 5AVSB 1Y4MA 2AEMA 1NTMK 5CCGC 4WFEA 4UFZA 3L72G 3CL3D 5E1AC 3BUPA 2DJVA 2YXLA 4LF5B 4GOFA 3ZMUA 3E8GA 1FXHA 2YMYA 2AEFA 2QJPB 3KCYA 1JMBA 1AVOA 1N34B 1I7FA 3LSUA 3FAVB 1DYUA 1NO4A 4DUYB 4JYBA 4AUWA 1TUBB 1AI4A 2WSFJ 1B06A 3T1CA 3JALB 2YICA 3B8NA 1GMGA 5KAFH 3VOUA 3DDGA 3PN1A 1R73A 4EYYQ 4BAYA 5E79E 2CK3G 2IYPA 1URQC 3FXDA 2WWWA 4EI2A 3WU2Z 3TGUH 2G3AA 2A45H 1SZXA 5AW2B 1IZNB 2HJDA 1ROPA 2CFDA 2W27A 1DF5A 4Y28J 1LTIC 4KXRA 1URQB 3WFVA 3MTUE 3JSNA 1DEBA 1FAVA 1SQPE 2L5GB 4J7JA 4YPCA 1FDMA 1D6UA 1NH2B 3C90A 3WB2A 3ZRXA 4EIJA 4B7EA 3DX1A 1M57C 2X7RB 4DR7O 1PM9A 1KQSU 2ZVNB 2IFMA 5JWPA 4FLYA 2H88C 2HG5C 2JP3A 2FUTA 4MS2A 2YXYA 4X66O 2OGUA 1QR9A 4NB5A 4U3JB 1EXIA 2Q3EA 2E43A 2E2VA 1OV9A 1EZVG 2RKLA 1F4MA 4FK5C 1SRYA 1S3JA 1M1KQ 3GHGB 3R2PA 3ZS8C 3HE5A 3F5HA 4B3MO 1H0TB 1KB9D 2HKOA 2ZINA 2BEQD 3CX5F 3RK3D 4CC6A 3IAOA 2DWEC 2CWVA 2M7WA 2E22A 4R50A 5AVUB 1T6AA 1BE3G 3LOYA 3CX5I 5CHXA 2NR5A 3RGBA 3JD4A 3OAAG 4IFMA 3L72J 2H7HA 2JEEA 1HGVA 2JWAA 2WPSA 2OTJP 3CSXA 4NEIA 3G71V 1FE6A 1WA8B 2ZM6O 2KS1A 4MSWC 2P6JA 3BEHA 5EZYB 2UUAO 3SYCA 4I50A 2P7TC 4CS3A 2RH0A 4PELA 1AR4A 3BHPA 1NQTA 1HNXO 2FYUD 3E1IA 2K9PA 2Q7EA 1I94O 1TQVA 4P9OA 3ABMC 4RJTA 3FD9A 1D2DA 4QPJA 3M0DC 2I1JA 1HXKA 4GKKB 1NTKK 1LURA 2P4VA 2BE3A 1HVVA 2OYHC 2X6CA 2YIBD 1SIHA 2YEVB 4H0LC 3A0BZ 1W2BU 1GU4A 2IZ0A 1JTHA 1N86A 3ABMB 1S72V 3THOA 5J2TA 2V7QH 2E3CA 2Y74A 2QM4A 2QWQB 3T1HB 1YITV 2EBOA 3OA7A 4J7KA 4J10A 2OYHB 5KA6A 1FZBA 1SQXJ 1FOSF 1RPRA 4H0LB 3BUDA 3S4DA 1R6KA 2DQ0A 5TISE 3CV5A 2AZ0A 1M1JA 1EFRG 3H1LE 5E79H 1HGZA 3T0BA 2FXMA 1JYNA 2YXRB 3FKSG 2BASA 3ASOC 3BFRA 3ECQA 1Z5VA 1NTMG 4H37A 4JI6B 3M99B 4QMAA 5H6QA 4GKGA 4R4MA 2IPPA 3H1IG 5AVWB 3AK2A 3UO2A 3CCJV 1SQPH 2JKAA 1KUQA 1EDKA 4BWNA 3ASOB 5KJ7A 2Y69C 2CUGA 2P06A 1HN1A 3WB1A 2KKWA 1LP1A 3VQYA 4YHHB 2WTYA 2J58A 4JI4B 3ETQA 4O2BB 1Q7YW 4LFBO 3H1KE 3HTKA 3E22A 4KHPO 2X0LA 2Y69B 1V7WA 4CH5A 4Q6GA 3GF7A 1LT9C 2ITCC 4W7ZA 4PDLA 1Q82W 3CP1A 4X64O 1KYOD 2WZ7A 1K9MQ 1IBKB 1XMOB 4RQFA 4I9QA 2QWRB 2P4KA 2JRIA 2YI9A 3HI7A 1PPJG 5A9GA 2WLHA 1LT9B 1H2MA 1US6A 2WSSH 1XQ8A 1HTLC 3OTOO 2Y0CA 4W80A 1QLNA 1HP8A 4GZRB 1SFCB 1W2EA 3IFMA 4MVZA 1YCIA 4X65O 3EJQA 1SQQJ 2BCCG 5LYJA 4HAMA 2OIEA 1RQVA 1FJPA 4OK4A 2E75D 1KN7A 5CA1A 2ZXWC 5CA0B 2DW4A 1J5EO 3HIIA 5KAIH 3G80A 4U3FH 3DSQA 1SFCD 5L3BA 3SDLA 2WSEH 4GX5A 2N1TC 3SPHA 4ZI7B 3ETDA 1BCCD 4MVSA 4TQDA 3M0AA 1FZAA 2WITA 1SP4A 3AE8C 2ZXWB 4XDLA 1J2JB 3LUTB 4NKGB 4DUZO 4O2AA 1BQZA 3O6QA 1YJWP 3BVOA 3AE1C 3CPWU 1MV8A 5J2UB 4TWKA 1NTMJ 3SJCC 3L70G 2FBWC 3BS6A 5B3SC 3AFLA 5L3FA 2PGGA 5B66Z 1EKMA 3H1IJ 3VQVA 1XTGB 3RYIA 1PGQA 3GG2A 1AP6A 4O4HB 3F7YC 3M9BA 5TISH 1NTZK 1EN5A 3H1LH 1BHAA 4BW5A 3BVXA 1PNKA 2CTWA 4X66B 1EZVD 1WLEA 5GONB 2IYOA 1Q81W 1SNZA 4C7UA 2QJKC 2E2UA 3UT5A 4GX0A 1IFDA 1NTKG 3MD0A 5ITZA 5LP6A 1UI8A 1CB8A 2OTJV 3OTFA 4FNPA 4QE7A 4LFCB 1HWTC 4B3MB 3CWBG 4PA4A 3D6YA 2ZL8A 3KPEA 3N7NA 4WFGA 5C8YB 2ZE6A 2XAQA 3N9HA 5H2FH 1WMKA 1H2SB 1BE3D 1RW9A 1GL2A 3MUZ1 1NAYA 3HB3B 3H32A 4QPKA 1V54C 1OVVA 4PI2A 3HKBA 1EDIA 3H1KH 1IJDB 3Q4HA 1FFXB 2WPDG 3JATB 4PJ0Z 4TUYB 2LW7A 4FLXA 2FYNC 1NKDA 3T0AA 2WLNA 4ASWA 4KUMA 1T8ZA 2OYOA 2FTKA 5GTHZ 2UUAB 2PI5A 1WAZA 1N4CA 1XOUA 2R9RB 4A7PA 4OPAA 2BCCJ 3AMOA 2XNDH 1Y9BA 2FYNB 4W4LA 1SQBH 1NKZB 2AXCA 2XN0A 4BW9A 5KMGB 4PDMA 2R5BA 1K34A 3V2PA 4L73A 3H9VA 3JD0A 1FPOA 1QLED 5KHGA 3WUVA 1ZR4A 2C10A 2R9AA 1VQOP 1FZEA 1IQYA 1JMKC 2E76B 1SF9A 3X42A 4DRXB 3CB2A 4OH8B 4KT0J 2OW6A 1Y66A 2ZDIA 1N32O 3GWOA 3E7KA 3ZRWA 1WMNA 2DYSB 2J59M 2IFNA 3HPLC 3CMAP 2E76D 1P84E 1VDFA 4J42A 3STZC 2OQEC 4TV9B 3LW5H 3AG1B 1JY3P 1YTFD 1AV1A 4CH6A 2RN9A 4UCTA 2FYVA 4N23A 1IBLB 4BR6A 5E1QA 3BCCG 3I3EA 3V4WA 2MK3A 1AI7A 3VOPA 3VN0A 2QKCA 4IHJA 2DMXA 1LNQA 2VQEO 2A7WA 1L0LK 1EZJA 5AVXB 2PZSA 3K5LA 2NPSB 5KLVD 2RMKB 5D5PA 5APWA 4DV3O 1EN4A 3WG7C 1XNRO 1Q6IA 3RT3C 4BIUA 4LFBB 1NS4A 3Q3DA 4PA6A 3HKDB 4HYOA 4KHPB 3HKEB 3DCDA 1FD9A 1PX4A 2ATKC 3Q5SA 4LGDE 1NU1J 3B77A 1RHZB 4JI5O 2V4HA 2YO2A 2F23A 2NPSD 1YQ2A 4LLHA 5C93A 3WG7B 4X64B 2F66C 3B5NC 2CE4A 2KOGA 1PPJD 2AXTZ 4LF4O 1M1KW 1RF1B 1QVGO 3CC7V 1KB9F 1OW6A 4D7SA 4I9WA 2XHBA 2D2CD 1KB9I 5AW9B 2QG4A 2FKWB 1S4XA 2CIQA 1K7DA 2PTMA 4HB1A 5GTIZ 1NTZG 4I6MC 2QWOB 4X65B 1YJ9P 5LL6Y 5A2QN 3RBXA 3WVFA 3DECA 1VF5B 1TU5A 1W7CA 1YJWV 2EZPA 4IYHA 4RAIA 1GM7A 1QGKB 1SQVD 1R34A 1VQMP 3VP9A 1IVUA 3HD7A 3L73D 1ZW0A 1NS7A 4YY3O 2WGQA 4L87A 2KNCB 1S76D 1FAFA 5JCOC 3ABTA 1RSOA 2W90A 1VF5D 3ABKC 1SQPK 2HPCB 4WBNB 1XHXA 2EJ7A 3SR2C 4DUZB 1Z45A 1H2LA 5M1BA 3UIAA 4WCEV 3L70D 3DX2A 1LTJC 3K25A 1BS3A 1AR5A 2FFDA 1G2CA 5KHIA 2O3JA 3ABKB 4JTAB 1L2PA 4FMTA 3BCCJ 4BRYA 2WW0A 3OBAA 3A0HZ 3HKCB 5KKZC 1IFJA 1QBZA 2ZT9C 1LTJB 1P84H 1YVWA 3TGUG 1MMMA 2CH7A 1VQ4P 1BSMA 2KLUA 2HYNA 3SFEC 1NTKD 2GUZA 3T09A 4UUJC 4NYKA 4WY4C 1FKAO 1U7JA 2R5DA 2ZXEB 3M9HA 1MSDA 3D36C 3K0DA 3ZHQA 2XAGA 3CWBD 2ZT9B 2KXPB 2IDBA 1JOVA 4X20B 4UCUA 5LMUO 2LQTA 2EZOA 4LF9O 2RMZA 1QCEA 2P10A 5LBQA 2KP8A 4ZOLB 5BU8B 3SSUA 4WY4B 4I4TA 3KHUA 1PP9J 3MUY1 1L4AB 1L8DA 4OX9O 4MW3A 3G6EP 1GN6A 1SESA 4EFEA 5KX5A 3L37A 1IO4A 3OUFA 3P30A 2GA1A 4Z1MH 1QWNA 1D6ZA 3SYQA 1LTSC 2P90A 3CHXA 3L4FA 2ZKOA 4DV0O 1R5LA 4LFAO 2E74C 3RK2D 1VQOV 2BSKB 2W0FC 1NTZJ 2XNXA 3G3ZA 4UCSA 2QEXP 1L4AD 3B2EE 1RE3C 3AE5C 1JO5A 3AEGC 1HWWA 1GN2A 4DUVA 5L3DA 1KYOI 1R5SA 3NREA 4BTYA 2E74B 1L7JA 4MVOA 1VEWA 1FS0G 3JAWB 5H9CA 1L0LG 1VQKP 4FLUA 3CMAV 5B1AC 2WAMA 3QTCA 1J1DC 1FXKB 4UB8E 1T2KC 1IXMA 2QJYC 3S9OA 4D7TA 3V2NA 4DUXA 5K5GB 1IVXA 1KQGB 1NVOA 4FNQA 4HKZH 4JTCB 1N32B 2RNBA 3CRQA 2DWDC 3ZHSA 5IYZA 5B1AB 1J1DB 1Q2NA 2JKVA 3HR0A 4Z2WA 1N7OA 3DDFA 2JKEA 3E80A 1RWGA 1D5AA 4D6TE 2EACA 4EDFA 1VQPP 1K1WA 4JI7O 2O1KA 1HM2A 3QO8A 4J9YB 2KQXA 2ITDC 4FFBA 2QGNA 1BGYE 3LNNA 1YZBA 3LSQA 2ZQMA 1VQ6P 2VQEB 3NTNA 1HJBA 3E83A 1M90Q 3BLBA 4MMIA 1LGHB 1C82A 3G6BA 4KTPA 3CC2P 2QWPB 4LNUA 1XNRB 1GK4A 2AW9A 1DLBA 5IE9A 1IFNA 2YFNA 2JWDA 3J80N 1H88A 1X59A 4NTXA 2YI8A 1AVLA 5EBWC 2KZIA 5B1OA 4OGQC 4JI5B 1YJNP 5KAFZ 1EZVI 4MTOA 1KILC 1YQ4C 3CI9A 4JYCA 3UQ8A 4JYYA 1SQPG 2ZXXA 1X9VA 2NZ2A 4DK0A 4GIFA 1F1SA 4LF4B 3RVYA 3E86A 1NSRA 4G2KA 2LR2A 3JYCA 1GW3A 1LXMA 4MTFA 4DV7O 1S5JA 2CWUA 2M0BA 1KILB 4GCZA 2DE0X 2P2UA 4GUNA 5LMNO 4GODA 3DXRA 1S77D 3JAKA 1AA0A 1KQSO 4DUWA 4H44D 1ZV8A 3MWXA 1L0LJ 3RYHA 5JMDA 4BIZA 2ARHA 2Y9ZA 3PTZA 1IXBA 1Y74A 4PA9A 2CIRA 4YY3B 1OCOC 1PFIA 1NH4A 3L74E 2Q5ZA 2WT7B 2QA4P 2HODA 2WSSG 4W4KA 3CRMA 4RQEA 2JR8A 3OEHG 2UUBO 1QALA 4AILC 1E79H 3VD9A 1FZCC 3L71E 2Y0EA 1Q5OA 4UB8H 1NZ6A 2QKAA 1VQ4V 4GDOA 1RWHA 1JZ8A 3OAKA 2ZAEB 2W8ZA 4J11A 2Y0IA 4E2LA 5LOVA 5IYCO 4B3RO 1ZOYC 1ZRTD 3T2MA 4IL6X 1FZCB 3S3XA 2JEUA 5AW1B 1NJIQ 3W7XA 5DJTB 3VSMA 2YNYA 1LTAC 1L0NH 3TGUD 2ZR3A 3AECC 4D6TH 3CEIA 3OFNG 1S5LE 4ZNCA 3ABUA 3EJTA 3TJTA 4X62O 3G6EV 1CZQA 4DK1A 3K5TA 3MUDC 1P84F 3PLNA 3P8CE 3WIQA 1BGYH 1KC8Q 3Q5PA 5BR8O 2HTBA 5LMUB 4OXSA 4LF9B 5KHHA 1W2BO 3TXSA 4JAUA 3H1LG 3UO3A 2HVKC 2DN9A 1JFFA 2HJFC 3KQGA 3MIWA 3BA8A 1CI6B 3CZJA 4OX9B 2EADA 1QL1A 2C0WA 3JARB 3WUTA 1PZQA 3OT7A 5AVZB 1T3UA 4GKJO 3N2KA 1N7SA 2O01J 4O9BA 3RRSA 3WFAA 3APOA 4DV0B 1VQKV 4LFAB 3EQ2A 1AVYA 1N7NA 4I55A 4FNTA 3T4ZA 2KG7A 1IVSA 4R7CA 2GM4A 3HUSA 4JPZB 3TNUA 3R4YA 3T0DA 1NS0A 5LA6A 1JMMA 3K9AA 1A02F 2CFLA 1LP1B 4X1KA 3D8CA 2CTQA 1DF4A 3H1KG 1Q6HA 2XN2A 5APSA 3X2QB 3CCLV 2UXCO 3AEDC 2JS3A 4HH2A 3T97B 2E5TA 4WBAA 1QR8A 1XMOO 4IFFA 3HTKB 4PD4I 3E22B 1VQPV 1EXJA 3DC5A 4JI0O 1PNLA 1HMUA 5KUKA 5KJ7D 2PRRA 4ZHQB 5EIBD 2FYUJ 3H1JE 1F9GA 3K57A 1SS1A 1YYCA 3QDEA 4C46A 2V4DA 4UCRA 4DV2O 1VQ6V 2YFOA 3L74H 2ZE8A 1NSZA 5KLVK 1PU4A 2B9ZA 4FIPC 3M9QA 1YSCA 3CC2V 4JI7B 1RWAA 1TXKA 3L71H 1SA0B 1IVWA 3W7TA 2Z0AA 3E8BA 2JGDA 1NS8A 5A1AA 4KFEA 3AK1A 5H5NA 2KK7A 4OJZA 2LP7A 1YJNV 5LYJB 1NR7A 2WW2A 2N05A 2O57A 3ICXA 4L76A 5CA1B 1BCCG 2E2TA 2BRVX 5APTA 4Y99C 3FB7C 4W7YA 1U57A 1JOYA 1XBLA 4DO2A 1S5LH 4FLZA 3RK3C 2HTAA 4X1IA 1QQCA 2VS0A 4B7KA 2CGNA 1G4YB 1SQPD 3GHGC 2Y4UA 4Y99B 3AE7C 3VYIA 3CC4P 4FNSA 2HHHO 1Y76B 3RYCB 1S5LX 2VWKA 3RK3B 4NVPA 2K9JA 4J80A 3CPWO 1W6CA 5LGTA 1SQVK 2Z5HA 1NKGA 4DV7B 3GB7C 2WLJA 2Q9IA 2OTLP 1TUEB 4QGPA 5LMNB 4LFCO 2QA4V 1S1CX
chains in the Genus database with same CATH topology
3EJRA 2F1BA 5DJUB 1Y47A 2KI7B 4HKZH 3BVXA 3BVVA 3D4ZA 2LXBA 1Q2NA 1EDLA 2HR3A 3BVWA 4JBZA 1TQTA 2F7OA 2KIKA 2KS1B 3DDFA 3LVTA 1QX1A 4HB1A 2WYIA 4NPEA 2OTKE 3ZDMA 1HTYA 3BUPA 3BUDA 4GOFA 4ZMDA 3CV5A 3BVUA 1JMBA 1R34A 3BVTA 2I8DA 1OVRA 1TQUA 2P58A 3BUQA 1ZW0A 1OVVA 3BLBA 3DX4A 1EDIA 2F18A 1LT1A 2QVAA 2F7RA 4NPFX 2KUBA 4ASWA 1R33A 1LP1B 2JWDA 1HXKA 2M5AA 3EJUA 3MHVA 3D4YA 3DDGA 3DX2A 1EDKA 2KZIA 4EYYQ 2K3RA 2QRXA 1TQWA 1JM0A 1LP1A 3S1KA 3D51A 3FXDA 4IOIH 3CZNA 3CZSA 1U7MA 1TQSA 3EJSA 4HJGH 1FC2C 2LR2A 3RGUA 1BDCA 1SS1A 2LXCB 1MFTA 4K3AA 2M0BA 3QWOC 1DEEG 3EJPA 3D52A 4BXLA 1O7DD 2M5AB 3DX1A 4GODA 1U7JA 1PS3A 1X0TA 4WWIA 2F7PA 2OW6A 2OW7A 5C39A 5EFWB 1ZXGA 2UWJE 4NPDA 3BUBA 3FXEA 2RKLA 1S3JA 4CPGA 3BUIA 4ASVA 3EJQA 2SPZA 1QWUA 2B89A 3MZWB 1QWNA 2WMMA 4MN4C 2FYVA 1H0TB 4GOEA 2R44A 1EC5A 3D50A 3PH0A 2B87B 1H0TA 4KJMA 2B88A 1OVUA 2F1AA 2ZAEB 2B87A 3DX0A 1HWWA 4K35A 3DX3A 2F7QA 2WYHA 2KZJA 5KBPA 2ALWA 5DJTB 2Q1KA 4ZNCA 5CBNA 1EDJA 1TQVA 5CBOA 3EJTA 5K5GB 1BDDA 1NVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJR A;  2F1B A;  5DJU B;  1Y47 A;  2KI7 B;  4HKZ H;  3BVX A;  3BVV A;  3D4Z A;  2LXB A;  1Q2N A;  1EDL A;  2HR3 A;  3BVW A;  4JBZ A;  1TQT A;  2F7O A;  2KIK A;  2KS1 B;  3DDF A;  3LVT A;  1QX1 A;  4HB1 A;  2WYI A;  4NPE A;  2OTK E;  3ZDM A;  1HTY A;  3BUP A;  3BUD A;  4GOF A;  4ZMD A;  3CV5 A;  3BVU A;  1JMB A;  1R34 A;  3BVT A;  2I8D A;  1OVR A;  1TQU A;  2P58 A;  3BUQ A;  1ZW0 A;  1OVV A;  3BLB A;  3DX4 A;  1EDI A;  2F18 A;  1LT1 A;  2QVA A;  2F7R A;  4NPF X;  2KUB A;  4ASW A;  1R33 A;  1LP1 B;  2JWD A;  1HXK A;  2M5A A;  3EJU A;  3MHV A;  3D4Y A;  3DDG A;  3DX2 A;  1EDK A;  2KZI A;  4EYY Q;  2K3R A;  2QRX A;  1TQW A;  1JM0 A;  1LP1 A;  3S1K A;  3D51 A;  3FXD A;  4IOI H;  3CZN A;  3CZS A;  1U7M A;  1TQS A;  3EJS A;  4HJG H;  1FC2 C;  2LR2 A;  3RGU A;  1BDC A;  1SS1 A;  2LXC B;  1MFT A;  4K3A A;  2M0B A;  3QWO C;  1DEE G;  3EJP A;  3D52 A;  4BXL A;  1O7D D;  2M5A B;  3DX1 A;  4GOD A;  1U7J A;  1PS3 A;  1X0T A;  4WWI A;  2F7P A;  2OW6 A;  2OW7 A;  5C39 A;  5EFW B;  1ZXG A;  2UWJ E;  4NPD A;  3BUB A;  3FXE A;  2RKL A;  1S3J A;  4CPG A;  3BUI A;  4ASV A;  3EJQ A;  2SPZ A;  1QWU A;  2B89 A;  3MZW B;  1QWN A;  2WMM A;  4MN4 C;  2FYV A;  1H0T B;  4GOE A;  2R44 A;  1EC5 A;  3D50 A;  3PH0 A;  2B87 B;  1H0T A;  4KJM A;  2B88 A;  1OVU A;  2F1A A;  2ZAE B;  2B87 A;  3DX0 A;  1HWW A;  4K35 A;  3DX3 A;  2F7Q A;  2WYH A;  2KZJ A;  5KBP A;  2ALW A;  5DJT B;  2Q1K A;  4ZNC A;  5CBN A;  1EDJ A;  1TQV A;  5CBO A;  3EJT A;  5K5G B;  1BDD A;  1NVO A; 
#chains in the Genus database with same CATH topology
 3EJR A;  4UB6 E;  4G27 B;  1LJ2 A;  1XL6 A;  3AG2 C;  2X6A A;  3CS5 A;  1SQF A;  3UT5 B;  1DX7 A;  1X79 B;  1HF9 A;  5TIS Z;  3STL C;  5HFM A;  4J7Z A;  1OW8 A;  5LP6 B;  2HR3 A;  4XBF A;  4IGG A;  3N2G B;  4JAS A;  1RP3 B;  2WVX A;  4NPE A;  2GDS A;  4FZ1 A;  3AG2 B;  3W7W A;  4DJG A;  1GL2 B;  2UUB B;  3H32 B;  2DYR C;  2Q3I A;  1MG1 A;  2N9Y B;  3HKB B;  4HNA A;  5CJ0 A;  3K5N A;  1X1H A;  3Q4H B;  5BMV A;  3K0G A;  3W67 A;  5KAI E;  2ZNJ A;  1X4T A;  4U3F E;  1X1I A;  5IWA B;  1PNM A;  4KTR A;  3GW6 A;  3O65 A;  1K97 A;  4FVM A;  4CS4 A;  4U3F D;  4B3R B;  1A2V A;  3C9I A;  3H1J H;  1GL2 D;  2DYR B;  2KB1 A;  1YQ3 C;  1GN3 A;  4MTG A;  2MW2 B;  4IYI A;  2A06 E;  1R3I C;  3CCS P;  1BMF G;  4CC5 A;  2R3C A;  5CB4 A;  2ZVO B;  3KCX A;  1BCC J;  3S4A A;  5AW3 B;  1Z56 A;  2YXH A;  4YJ2 A;  2Z4E A;  1OX3 A;  5BU5 A;  4X62 B;  2Z3Y A;  2W6B A;  2ZDI C;  1PD3 A;  3FB5 C;  1UI7 A;  3EJS A;  1LWU A;  1RKY A;  2XDJ A;  5BR8 B;  4JQ0 D;  4JAA A;  3VDB A;  1S9K E;  4K3A A;  3TDK A;  3H1L D;  1DEE G;  3FX0 A;  1JY3 N;  3FB8 C;  1O9G A;  4F6R A;  3T2P A;  3ZJZ A;  4LF8 O;  3K5B A;  4FLV A;  1IBL O;  1X0T A;  3SWY A;  2G38 A;  1KOR A;  1M90 W;  5EFW B;  1LF9 A;  4DV5 O;  2ZNI A;  2WDA A;  4PDR A;  4GKJ B;  1G1I A;  2Y73 A;  2YO3 A;  4NPD A;  4JYA B;  1IFM A;  1KFN A;  3F89 A;  2BOC C;  3DYP A;  2P22 C;  5H2F E;  2OYI A;  3L75 E;  4JAV A;  5KLV G;  1F4A A;  4CPG A;  3BUI A;  3TET A;  3SWF A;  2YC0 A;  2AEJ A;  3CE2 A;  4ABM A;  1K73 Q;  1K8A Q;  2Y48 A;  2DW3 A;  4BTW A;  5FNV B;  1RE4 A;  1VIB A;  2YKP A;  1BE3 J;  2NLJ C;  2IBZ E;  3H1K D;  2WLI A;  2E75 C;  3TF5 A;  3ZMV A;  4EB6 A;  1CSB A;  1RF0 C;  1TVK A;  1RWF A;  1CW5 A;  2UXC B;  2BTQ A;  1NAF A;  3GMA A;  3TK1 A;  4JF7 A;  1SFC C;  4OPH A;  4UB6 H;  4TQF A;  2WSC J;  3CXH E;  1VL2 A;  3D70 A;  2GUV A;  1TAE A;  1COW G;  5DED A;  2FY8 A;  4JI0 B;  1SQB E;  3SEP A;  2E75 B;  4B3T B;  1SQB D;  1SII A;  4DR2 O;  4FLT A;  1E1R G;  3P3P A;  4QNH B;  4DV2 B;  3D71 A;  1L7K A;  3SJQ C;  3CYO A;  1D6Y A;  4DXW A;  1N7R A;  3D6Z A;  4YXD C;  2GUS A;  4LWS B;  3L72 E;  5AW0 B;  1NSX A;  1PL4 A;  1HWY A;  1VF6 C;  1N73 C;  1SQV G;  4A5U B;  4XDK A;  3D4Z A;  3V2Q A;  1NKN A;  3L73 G;  2WVY A;  1LTG C;  1TQT A;  3LVT A;  2CPB A;  2JGU A;  3A0R A;  4FJC C;  3JAL A;  1BSH A;  3CC4 V;  1IUR A;  2V1D A;  1F51 A;  1RJO A;  3BAS A;  2LGQ A;  2A06 H;  2QM8 A;  3U11 A;  3U59 A;  1N73 B;  2CAZ C;  3HD7 B;  3CME P;  1NSM A;  3E1F 1;  4X88 A;  2UU9 O;  1UFI A;  4OWF A;  1RSO B;  2OTL V;  1NJI W;  1ZAU A;  4UCO A;  2A45 I;  1GO3 F;  1R3K C;  3VD7 A;  2WSF H;  2PUS A;  1KSI A;  4NXN O;  3C8V A;  2HHH B;  1SLQ A;  3HD7 D;  1SQX E;  5IJ9 A;  4C7N B;  4JF3 A;  2VRZ A;  5KLV J;  1G2C B;  2FFD B;  4LBE C;  1KC8 W;  3ETG A;  1JYW A;  2IJK A;  3OB8 A;  3B8E B;  4N3Y B;  3BPZ A;  1USD A;  2JS5 A;  4KFM A;  3HRN A;  5AW5 B;  4MVU A;  5CBG A;  3G4S P;  2CH7 B;  2FML A;  1FC2 C;  1Q6U A;  4X89 A;  5JVD B;  3P8M C;  2Z5U A;  3PJS K;  3RGU A;  3L75 H;  2PI4 A;  3APQ A;  1HBW A;  4R6Z A;  1QLE C;  2QDO A;  1J0M A;  3D3Q A;  2WOF A;  3PGB A;  1A02 J;  2IBZ H;  1CEZ A;  2OW7 A;  1KFM A;  2E24 A;  5LHG A;  2DQ3 A;  3L35 A;  4PHZ A;  1NS2 A;  4I4T B;  2UWJ E;  1QLE B;  3CCS V;  2ZCE A;  1PGP A;  1SKV A;  1JA8 A;  2ZD9 A;  1FDI A;  3CXH H;  1AVK A;  4UCV A;  1D5N A;  4AQY B;  2XV5 A;  2E76 C;  1MMU A;  1RPO A;  4ASV A;  2FB5 A;  1UIX A;  2P7J A;  3RN4 A;  2UXB O;  1SQV J;  1W59 A;  4CS2 A;  4H13 D;  2R9I A;  3L73 J;  3MI6 A;  1AIL A;  2DYS C;  2E42 A;  1IZ3 A;  2GV9 A;  2XU6 A;  3L9D A;  4DV1 O;  3L72 H;  3T1Y B;  3ZHR A;  1PV3 A;  3OS7 A;  1YTF B;  5B66 E;  3AG1 C;  4FFK A;  3DX3 A;  1SQQ E;  3A7O A;  3CCU P;  1WMO A;  1BZK A;  3L70 J;  2EJR A;  1H89 A;  2JVD A;  1N7Q A;  3MP7 B;  3C3T A;  3BAA A;  3CRR A;  2OYH A;  5GW7 A;  2IM9 A;  3LNM B;  1BHB A;  2NPS C;  3HIG A;  1P84 D;  4LH7 A;  3JD1 A;  3KKY A;  2FXP A;  3IAP A;  1Q90 D;  4LF8 B;  1ZSP A;  3M7M X;  2KI7 B;  4D6T G;  2LW1 A;  2UXN A;  2WLL B;  2YMK A;  1JOC A;  1YXB A;  4DV5 B;  2C9L Y;  1NTK J;  3KN4 A;  3T4D A;  1BSN A;  3B71 A;  1OIP A;  2D2C C;  1I5Y A;  1NTM E;  1BGY G;  2K88 A;  4TV8 B;  3CWB J;  1SPU A;  4RUE A;  1SQX H;  2OCC C;  4FFB B;  2XT9 A;  3H1I E;  2BRP A;  3HE4 A;  4PV1 D;  4N78 E;  1B3Q A;  1ULV A;  5AW8 B;  4GT1 A;  2ZE7 A;  1RF1 C;  1WMP A;  5EBM C;  1PGO A;  3NBJ A;  2CDY A;  2K1E A;  4K8Z A;  2D2C B;  1HR0 O;  2I8D A;  1JRQ A;  1K4C C;  4IIJ A;  5LXT B;  1KBH A;  2OCC B;  4LNU B;  1YBK A;  3E35 A;  4K8X A;  1OW7 A;  4EV5 A;  1G6U A;  1KU9 A;  2LFS A;  1LT1 A;  1MA1 A;  2UXD O;  2QVA A;  3CJH B;  4WVZ A;  3DTU B;  3VMY A;  2F7R A;  1ARO P;  3S4B A;  1A32 A;  3KZI E;  3B40 A;  1VF5 C;  1NSS A;  2RDY A;  3T0U A;  1W0K G;  3NR7 A;  3QO5 A;  3SYP A;  1EM1 A;  4DR2 B;  1QNM A;  2Y0D A;  4PDV A;  1PIX A;  4YXW H;  3K06 A;  4CBC A;  2WQY C;  2YKQ A;  1GTW A;  3CZN A;  2YIA A;  2QSI A;  2Q7G A;  1YTZ T;  2CG0 A;  1AQT A;  4YJ3 B;  1R6T A;  4WFH A;  1QAF A;  2VRS A;  4B86 A;  5F2V O;  1F4H A;  3CME V;  2Q4P A;  4I0X A;  5L3C A;  1AJP A;  3ZRS A;  3G9R A;  1W5C E;  1F4N A;  2IZ1 A;  2PAJ A;  1MFT A;  4B3S B;  3DXR B;  2H8P D;  2WZS A;  5EK0 A;  3ZN0 A;  3ABV C;  2BCC E;  1YI2 P;  2M5A B;  1N7L A;  3D3I A;  1ZL8 A;  1P7B A;  1GM9 A;  1V55 C;  3ML0 A;  2JJL A;  5C39 A;  1BQ0 A;  3K03 A;  1M56 B;  2RJZ A;  1M8O B;  3BRT B;  3L74 G;  4FM2 A;  2CFW A;  1Y74 B;  2OOV C;  2ODM A;  4ZI7 A;  1MZE A;  2GHY A;  3BAT A;  5B66 H;  2HOD B;  4U7N A;  2F95 B;  1GH6 A;  3SJB C;  2UU9 B;  1PV0 A;  5LGU A;  1SQQ H;  3U10 A;  2BEZ F;  3OW2 U;  1JCC A;  1V55 B;  1R1B A;  3V6I A;  5APQ A;  3WA3 A;  3JCZ A;  4LCU C;  2EUL A;  3K04 A;  2OYQ A;  4NXN B;  1M56 D;  2N1T A;  1JZ7 A;  2PGD A;  4O4I A;  1OCC C;  1KZU B;  1DP0 A;  1LF6 A;  3VMX A;  1WNS A;  2K37 A;  3AEB C;  2UXX A;  2A45 G;  1Y8A A;  4JPR A;  4O4H A;  5LOV B;  1BGY J;  3RK2 C;  1FYJ A;  1N9E A;  3M91 A;  2Q73 A;  2PP6 A;  1MZ9 A;  2B87 A;  4UB8 Z;  3M8A A;  1OJN A;  2H94 A;  2XOK G;  1L4A C;  1OAC A;  5GON A;  3IJ4 A;  1V7V A;  1OCC B;  2CIS A;  1DGS A;  5CCH D;  1ZN5 A;  3RK2 B;  1NTM H;  3OEE G;  5EC2 C;  3H1I H;  1VF7 A;  2JDI H;  4P2Z A;  5C8Y A;  5GTI E;  1FZF A;  3CRA A;  2WLM A;  4ZIB A;  3N27 A;  2GBO A;  3I5D A;  5IJ0 B;  4WF9 V;  3USS A;  4ASU G;  2YS8 A;  1K73 W;  1K8A W;  1VQ8 P;  5EYP A;  4XE5 B;  1EDL A;  3H25 A;  3BVW A;  4TUY A;  5DEC A;  1NU1 E;  1FXK C;  4BZF A;  3KZI H;  2A79 B;  2ZIO A;  2ZJS E;  3N2K B;  3CCU V;  1IU7 A;  3ZCC A;  5L8R J;  1XRE A;  2UXB B;  4PI0 A;  3CX5 E;  1Q43 A;  1K9M W;  3SPC A;  3CXH F;  3MDS A;  4I55 B;  1VQ7 P;  3RW0 A;  3CXC U;  1ZWI C;  4IL6 E;  3MV1 1;  1LTT C;  2F4V O;  3HUS B;  3TNU B;  3I55 P;  5KMG A;  5LA6 B;  2W83 C;  3Q1M A;  4RO2 A;  4DV1 B;  2W6J H;  1SS3 A;  1G1X B;  3LIE A;  1N7S D;  1M4U A;  3OUS A;  4X1Y A;  2IJI A;  2HFE D;  4PD4 H;  5B5E Z;  3F7V C;  3U1A A;  3MAQ A;  2W6A A;  4XA4 A;  1L0N E;  1E5W A;  2BCC H;  3FFQ A;  3RL0 D;  5APV A;  2EAB A;  1FBM A;  4UVA A;  1K3E A;  2GSM B;  1JM0 A;  3BRV B;  3PHL A;  2AHY A;  2JEX A;  4BIO A;  1L0N D;  3P7K A;  3OMN B;  3PRJ A;  1HH0 A;  4D6T D;  4TTG A;  1SC5 B;  3TGU J;  3ACT A;  2V7Q G;  1DD3 A;  2E5Y A;  1NGM B;  2PNC A;  2X6B A;  1RM1 C;  4JV5 O;  1BGY D;  2H89 C;  3H1H E;  4MT8 A;  2JGD B;  1S5H C;  4WWI A;  2OQE A;  4HZ3 A;  2Y4T A;  3BCC E;  5L3E A;  2PYJ A;  1BT8 A;  1QVF U;  1NSU A;  1ZXG A;  4H44 C;  5KTB A;  5L3G A;  1X22 A;  2XKM A;  1RM1 B;  3SPJ A;  1HR0 B;  1SQB K;  1FFT B;  1YJ9 V;  2Q5U A;  1ZX3 A;  2QTS A;  2UXD B;  3GF3 A;  4H44 B;  5JJJ B;  1VQM V;  1QVG U;  4UXN A;  4DOJ A;  1WRG A;  4LF6 O;  1KV4 A;  2QWN B;  5GTI H;  1OVU A;  2WW3 A;  2VWJ A;  1M7L A;  1PP9 E;  3TXQ A;  1JCD A;  2R3S A;  2K9J B;  1JB0 J;  4NR1 A;  1XL4 A;  1HNW B;  3B5N A;  1IC2 A;  5KLI C;  2ALW A;  3ACS A;  5K1X A;  1JJ2 U;  3X3Z A;  1NU1 H;  5CBF A;  1CPY A;  3HE5 B;  5DM6 V;  2XHN A;  3K5M A;  1EDJ A;  2YX9 A;  2QJ1 A;  5CBO A;  3FGA D;  3CX5 H;  4QE9 A;  4DW0 A;  3CCM P;  5DJU B;  1Y47 A;  4C7R A;  3JAS A;  4JZG A;  2NN4 A;  1JPX A;  3OR7 C;  3L74 D;  5KLI B;  1I8Q A;  5KHK A;  3T2O A;  4IL6 H;  3BAB A;  2KNC A;  1AJQ A;  1ZLL A;  1PX3 A;  4BZG A;  3JCU E;  3LDE A;  1KIL E;  3L71 D;  3V4Q A;  2WVX B;  3VD3 A;  5IWA O;  5CCH A;  2F7O A;  5JJE B;  2KIK A;  1SQX K;  2KS1 B;  2HLD G;  1MAB G;  2HPC A;  4WBN A;  4RWU A;  2WYI A;  4I50 B;  2XUM A;  4DR1 B;  2J5U A;  2V7Q J;  4TLF A;  4U3F G;  1XMQ O;  4HNA B;  1OMI A;  1WB7 A;  1QAK A;  3SX1 A;  5BMV B;  1THZ A;  1LOH A;  3B09 A;  3BVU A;  1OVR A;  4DYL A;  1RH5 B;  3A5T A;  2RDC A;  1MFZ A;  4FM1 A;  2A06 G;  5TJH A;  2CWT A;  3FYI B;  1J95 A;  3AE3 C;  1MNG A;  1LTJ A;  5FPO A;  4GLX A;  1JTH B;  1M1J C;  1LWU C;  2CTP A;  1MOF A;  1AJN A;  1ZME C;  1UG9 A;  2KUB A;  1P84 I;  1UJW B;  5J2T B;  2P1J A;  3P8C D;  5CB4 B;  4ZKU A;  3G71 P;  1R33 A;  3QFZ A;  1VQ8 V;  2PFX A;  3S4R A;  3R66 A;  4YJ2 B;  3H1H H;  2QEX V;  3VD4 A;  1SQP J;  2QRX A;  1USE A;  1NI8 A;  5CBH A;  2WPQ A;  4IOI H;  1M1J B;  1LWU B;  3BCC H;  4DR4 O;  1J1E C;  3B8M A;  1JYX A;  2Q68 A;  4ZOL A;  4JI3 O;  4BZE A;  1NYH A;  1K4D C;  1F23 A;  1JNM A;  4WY4 A;  2H43 A;  4JYA O;  5KJ7 C;  1W6G A;  1JQ0 A;  1MKM A;  5EIB C;  3KII A;  1W0J G;  1FJK A;  5E79 Z;  1KP2 A;  2Q9L A;  3X2Q C;  3QVN A;  3I55 V;  5IYB O;  3OJA B;  1J1E B;  3D52 A;  2OAR A;  2QE7 H;  1H38 A;  1S72 P;  3SPI A;  3FB6 C;  3ITK A;  3L75 G;  1RE4 C;  1JZ2 A;  1VQ5 P;  2BSK A;  5AG2 A;  2OWO A;  3II6 A;  2OYI B;  1I08 A;  1YEW A;  3LDD A;  4RES B;  1LVN A;  4MMH A;  5H6R A;  2F4V B;  1PP9 H;  2OT5 A;  3AEI A;  1SQQ K;  2IBZ G;  1AJY A;  1ZR2 A;  3MPH A;  3R65 A;  1KP3 A;  3CCQ P;  2KB7 P;  3AG7 A;  1G1J A;  1RY3 A;  1GDT A;  3QH9 A;  5K1P A;  3E2E A;  3FX7 A;  4JGS A;  4EB6 B;  3AEE C;  2XND G;  4KP4 A;  4B3T O;  4GOE A;  3QFY A;  1FS0 E;  3G67 A;  3WIR A;  5LHH A;  5AW4 B;  2EX3 A;  1SQB G;  1NTZ H;  1NS1 A;  3K3W A;  3H1J D;  1GU5 A;  2B88 A;  4DW1 A;  1GK9 A;  2KSJ A;  2WVZ A;  4U3F J;  1QHT A;  1EN6 A;  4K35 A;  2WSE J;  1ZLZ A;  2F7Q A;  2M8R A;  4UB6 Z;  1XUQ A;  4UV9 A;  1PGJ A;  4K0K B;  3JCU H;  3I3D A;  4O4J A;  5EC1 C;  1F7Y A;  4NXM O;  1JY2 O;  4JV5 B;  2A9H A;  1LR1 A;  2XAF A;  5CJ4 A;  3KDP B;  1OJM A;  2XSG A;  1BDD A;  2WOH A;  5IDJ A;  3SGI A;  2DOS A;  3K08 A;  3E8F A;  3H1L J;  3BVV A;  4KFD A;  2XAS A;  4JZ2 A;  3QF7 A;  5IYD O;  4UFC A;  3UKM A;  2P5O A;  2LFR A;  2XAH A;  1OZ0 A;  1Q86 Q;  1B6Q A;  4O2A B;  4I5S A;  3O6Q B;  3P32 A;  3C3S A;  5KAI Z;  1S2E A;  3C1L A;  1KMI Z;  1O9H A;  3J81 N;  5CCG D;  4MTX A;  1Z5W A;  2YDE A;  2QTO A;  4NTY A;  1HMW A;  3NJX A;  1GK6 A;  2N9B A;  3RYI B;  1SO0 A;  3BVT A;  1SQX G;  3BUQ A;  1WJZ A;  5LP6 C;  4LF6 B;  2PY5 A;  1LUW A;  2CPS A;  4ZBM A;  3CCE P;  2EIJ C;  3L75 J;  3DX4 A;  2LGW A;  5IJ9 B;  3IFX A;  2OIG A;  3CCM V;  3H1K J;  4NPF X;  1KIL A;  3A2F A;  3UCS C;  1W3Y A;  1GL2 C;  2EIK C;  4RNL A;  5ITZ B;  3MHV A;  3FWN A;  1CXZ B;  5FPR A;  2EIJ B;  1WN7 A;  1URQ D;  4UVC A;  1JY2 P;  5AW7 B;  1NVP B;  1M57 B;  1NH2 D;  3CZS A;  5HFL A;  4TSF G;  3L36 A;  1KB9 E;  1XIL A;  5B1B C;  1SQB J;  2EIK B;  3JSV C;  4YXW G;  3RK3 E;  3ZMS A;  1M93 A;  1LTB C;  2WT7 A;  2YID A;  1MUU A;  4AQY O;  1YGA A;  3LSS A;  4DT0 A;  3SXX A;  1AI5 A;  1Y67 A;  3OD4 A;  2XAJ A;  5H2F Z;  3X3Y A;  1NVP D;  1M57 D;  3WU2 E;  1N2D C;  2C2A A;  1E1Q G;  5B1B B;  1L0L H;  2IJH A;  3SJA C;  3ZHU A;  1XMQ B;  1HJ0 A;  2RQ6 A;  2HG5 D;  3AMO B;  5JH7 A;  1QL2 A;  2O1J A;  2FYU E;  5EBL C;  2LKM A;  3T1Y O;  2FUQ A;  4NTW A;  2A06 D;  1Q8I A;  1FZC A;  1NT2 B;  4JTD B;  4MVM A;  2SPZ A;  3LW5 J;  1VQN P;  1YDX A;  3A8T A;  2ZYG A;  4EV2 A;  1XHZ A;  3DYM A;  3LID A;  3D50 A;  1BL8 A;  3BY6 A;  3JSL A;  5KHJ A;  1SQQ G;  4EOT A;  4JI1 O;  1R8E A;  4KJM A;  3V5B A;  3RYF A;  1XTC C;  3I56 P;  4F6E A;  1S9K D;  2F1A A;  3M06 A;  3ZRW B;  5DN6 G;  3W7S A;  3ZMZ A;  4DR4 B;  4F4L A;  3VBB A;  4TOI A;  4JI3 B;  2YUA A;  1VQ5 V;  1V7X A;  3AE2 C;  3EFF K;  1NU1 K;  4WB4 A;  3NXS A;  3MUD A;  1JZ4 A;  1CI6 A;  3GVM A;  4L8J A;  1MMX A;  5AVT B;  3TYY A;  2BTO A;  3JAR A;  1AFO A;  3CCQ V;  5CBN A;  4O4L A;  4IT5 A;  3X3X A;  3L75 D;  1JZ5 A;  4IHJ B;  5B1N A;  2W0Q A;  4WFB V;  2M6Y A;  4H0L D;  5JQG A;  2ADP A;  3CLQ A;  2JDI G;  4DR3 B;  3E7J A;  4MVR A;  3OGI B;  4Z1M G;  2IBZ D;  1P7G A;  1LUV A;  1SVF A;  4JBZ A;  3VMZ A;  1T5E A;  1IQX A;  3HE4 B;  3IF4 A;  2L6L A;  1XNQ B;  1FDO A;  4R8C A;  4DR5 B;  2L35 A;  4LF7 O;  1X1J A;  5AW6 B;  3CD6 P;  1OCZ C;  1AVM A;  1L0N K;  2OTK E;  3CXH D;  4FNR A;  1OJP A;  5KUM A;  4YIO A;  2MKV A;  3T97 A;  4IIJ B;  3VQW A;  1N33 O;  2O01 H;  1B04 A;  3A0B E;  4DZO A;  1IX9 A;  1VQ9 P;  1TQU A;  4HBN A;  1KYO E;  2WVR A;  1ENV A;  2CQT A;  1OCZ B;  3P3N A;  4ZHQ A;  4EKW A;  1KB9 H;  1W2Z A;  2ITA A;  1Q3E A;  2PYL A;  3FAV A;  3L72 D;  4QIW F;  2CFG A;  3EWK A;  2YXQ B;  5CCG A;  3ZRV A;  3HD7 C;  3MGN A;  3MV0 1;  4B3S O;  1H54 A;  2W6J G;  2W0X A;  4NXM B;  1DTO A;  1TUB A;  2EIN C;  4LP8 A;  1KEC A;  2ZYA A;  3WU2 H;  2IJJ A;  1JZ3 A;  1MSW D;  1SA0 A;  3NJV A;  4RO0 A;  1TGO A;  3RL0 g;  1GAX A;  1AV4 A;  2A0L A;  4I0X B;  1TU3 F;  2LO1 A;  1H8H G;  3NMD A;  5CN0 A;  2FYU H;  4HJG H;  4J41 A;  2EIN B;  2AHZ A;  3CC7 P;  2FFD C;  2CGO A;  1WB8 A;  3Q1N A;  3QWO C;  1ZL8 B;  3CCE V;  3T2Q A;  1BCC E;  1ZTE A;  3IAY A;  1URQ A;  3K59 A;  2WO0 A;  5BXZ A;  1VP7 A;  1SQG A;  1OXZ A;  1WP8 A;  1YIJ P;  1SQX D;  3AG4 C;  3FYE B;  2JK5 C;  4BRY B;  2CQS A;  3RVZ A;  2Q7C A;  3J7H A;  1Y76 A;  3RYC A;  4U3J A;  2N1T B;  3OW2 O;  4O4I B;  2IU3 A;  2CFK A;  1AR1 B;  4X8A A;  1AQ5 A;  2AGA A;  2ETN A;  4ICG A;  4DR7 B;  3GHG A;  3AG4 B;  1SER A;  2GUZ B;  1EC5 A;  1EZV E;  2I1K A;  1JCH A;  4H13 C;  3SYA A;  2B87 B;  3PH0 A;  3WMM 0;  1VMG A;  3AFJ A;  1H0T A;  2GTA A;  3VSN A;  2B9B A;  3LDC A;  3ZBH A;  5B3S B;  2N1T D;  1NOH A;  2Q7H A;  3DC6 A;  3CCR P;  1W5Z A;  4H13 B;  3N2G A;  1KD1 Q;  1BE3 E;  2Q67 A;  5KX5 B;  3WUU A;  1IK9 A;  1WA8 A;  2Q8V A;  2Q1K A;  2QJK B;  4G28 B;  1IVV A;  4XDJ A;  1U97 A;  5EZY A;  1FXV A;  3MHH C;  2YIB A;  3B4S A;  3IAQ A;  4TT3 H;  4MW8 A;  4AI8 A;  1JY3 O;  1VQN V;  1OZH A;  1NU1 G;  5JJN B;  1KTM A;  3A0B H;  3Q5R A;  5EYP B;  2Q0O C;  3QNE A;  1S0V A;  1WPB A;  1KYO H;  3K79 A;  1FJG O;  3DGE A;  2ZM6 B;  3PP5 A;  2IU0 A;  2IH3 C;  1IFP A;  1GZL A;  3OE7 G;  2Q0A A;  3QO7 A;  3I56 V;  1E79 G;  1V54 B;  1PL5 A;  2YEV A;  3OMA B;  3J7A U;  1HNX B;  4WFF A;  2JJ1 G;  4AHC A;  3T08 A;  1I94 B;  4DR6 O;  2RCV A;  1EGU A;  1M9N A;  3M0D A;  4FNU A;  2QR4 A;  3ZHV A;  4PV1 C;  1SQQ D;  3AE9 C;  3KZI Z;  2HVJ C;  4ZMD A;  2JIZ G;  3VDA A;  5FL7 G;  2POH A;  3RWR D;  4JI1 B;  4X1Y B;  1DD4 A;  3OGC C;  1L0N G;  5APU A;  2CTR A;  5IYZ B;  4DV4 O;  2Q6Q A;  3MHS C;  4PV1 B;  4H33 A;  1QEX A;  1YHQ P;  2CK3 H;  2H3O A;  1V9P A;  5BY1 A;  1MMY A;  1HNZ O;  1OJO A;  4P30 A;  3D4Y A;  1HM3 A;  4FLW A;  1BCC H;  2ZXQ A;  1TQW A;  4KFF A;  3D51 A;  4KHX A;  2VQF O;  1N36 O;  3CD6 V;  3JD2 A;  1NTM D;  4PJ0 E;  1XEQ A;  3W7U A;  1U7M A;  4FNV A;  2NNU A;  1Q86 W;  3H1H G;  1PL0 A;  3H1I D;  1LXK A;  3VMA A;  4ZKP A;  5GTH E;  1H2K A;  4N78 D;  3UM7 A;  1BDC A;  4O2B A;  1VQ9 V;  2Q1F A;  4AQ0 A;  3EXA A;  5KLV E;  1VQL P;  3SFD C;  2FKX A;  5BVZ A;  1US1 A;  5FNV A;  2H8P C;  2G8Y A;  2XZR A;  4R4L A;  2WLK A;  4LF7 B;  1EZV H;  1X8Y A;  3K9S A;  2F7P A;  2WA3 A;  1N8R Q;  1SZT A;  2EIL C;  3VP8 A;  1QVF O;  1N33 B;  2QE7 G;  3BUB A;  4AQR D;  1OFC X;  3IMH A;  3IR9 A;  1LT9 A;  4QJF B;  1RF0 A;  1PPJ E;  3WA2 X;  1HNW O;  2EIL B;  4Z1V A;  3JD3 A;  1SFC A;  1BE3 H;  5IY5 C;  1PP9 G;  1WT6 A;  2ILM A;  2F43 G;  2ADQ B;  4DCK A;  1M56 C;  4PD4 E;  2Q6A A;  3JAK B;  4LWS A;  1DIP A;  3K58 A;  4PD4 D;  2WSC H;  3X40 A;  5CA0 A;  4ZKI A;  3RYH B;  3OTO B;  1K1X A;  2YSU B;  3B5N B;  3F5T A;  5IY5 B;  2BCC D;  3E8H A;  2WYH A;  2XN1 A;  1D7M A;  1VAR A;  2N04 A;  1SQV E;  2R32 A;  2EIM C;  1IBM O;  1GKF A;  1OHH G;  1YIJ V;  3TY1 A;  2O01 N;  3L73 E;  5CCH C;  3L71 G;  1JZ6 A;  1L0N J;  4MVQ A;  1VF6 A;  3AG3 C;  5D5Q A;  1N73 A;  2PF4 E;  3EHB B;  1GM8 A;  4DR1 O;  3JAS B;  4FZ0 A;  4KL1 A;  4BWA A;  1J5E B;  2KLV A;  3B5N D;  4D6T J;  1AI6 A;  5J2U A;  2IH1 C;  3G4S V;  2K1A A;  2YKO A;  2F1B A;  2BT3 A;  2EIM B;  3OM3 B;  3V2R A;  3NBB A;  1KQF B;  2W6I G;  4JI8 O;  3VDC A;  3L70 E;  1SET A;  3VD5 A;  3AG3 B;  2B1I A;  4IL6 Z;  1CP9 A;  2R70 A;  4C7N A;  4FM0 A;  2P67 A;  3JC2 2;  3H1H J;  1QX1 A;  4OK2 A;  1HW7 A;  1QU7 A;  1R3J C;  1K5S A;  2AXT E;  3CCR V;  3SYO A;  5FLX N;  3ZDM A;  2ZR2 A;  4OVN F;  2Z5I A;  2IX7 C;  1URF A;  1KKD A;  1NWQ A;  1NTK E;  1NR1 A;  1EQ7 A;  1NHL A;  4PJ0 H;  3ZX6 A;  3IC9 A;  5JVD A;  1XI1 A;  2F18 A;  3CWB E;  1K33 A;  2E5L O;  4JI2 O;  5GTH H;  1N7S C;  5KKZ B;  3QG0 A;  2ZQ0 A;  4I2L C;  5KLV H;  1JFF B;  1FFX A;  2HFE C;  5AVR B;  4AYC A;  3EJU A;  3JAT A;  1ORQ C;  3IC7 A;  3HUS C;  4X9Q A;  3RL0 C;  4BTX A;  2C0X A;  4B08 A;  1JEK A;  1YTZ I;  4CH4 A;  2KSD A;  2BRW A;  2IBZ I;  3EFG A;  1N7S B;  1NU1 D;  4IFD K;  4J9Z B;  1VPC A;  2FYU K;  1N0N A;  2ZYD A;  3U1C A;  3CRC A;  3CCV P;  2HLO A;  2KG7 B;  2ZT9 D;  3CX5 D;  3CXH I;  3I3B A;  3AE4 C;  3RL0 B;  1FJG B;  2UUC O;  2FXO A;  1J0N A;  1GRJ A;  4YTP C;  1PPJ H;  3EJP A;  2M3E A;  4WY4 D;  1RWC A;  1G8M A;  3AEA C;  3KXD A;  3L74 J;  4X1K B;  5BZB A;  3O8Z A;  1KYO F;  2K9Y A;  4DR6 B;  1PS3 A;  3GWK C;  1YHQ V;  2Y0P A;  3A0H E;  1XDC A;  4PA7 A;  1GD2 E;  1AP5 A;  3W68 A;  4DRX A;  1H2G A;  1WPX A;  4EFB A;  3L71 J;  1MMZ A;  3ZIA G;  3BA9 A;  4LC1 A;  4UVB A;  1HUC A;  4N21 A;  1JVM A;  2KYV A;  4DV6 O;  1K04 A;  2WPR A;  3H1J G;  4YIP A;  3SWK A;  4RUF A;  4L75 A;  2F1M A;  1M5I A;  3KG2 A;  1SQV H;  4CZZ A;  1W4N A;  4DV4 B;  4K0K O;  3MZW B;  1MZF A;  4TV9 A;  1RQU A;  3L73 H;  4LF5 O;  3VTP C;  5AVV B;  4U7O A;  2R44 A;  4L74 A;  1I0H A;  2E74 D;  1HNZ B;  2QM7 A;  3TSI A;  2JJ2 G;  4GX2 A;  5CMU A;  1VQL V;  1N34 O;  2WLL A;  2QJY B;  3CCL P;  1H2N A;  1FOS E;  2HEP A;  3S3W A;  1MN0 A;  4LH6 A;  1JUN A;  3DX0 A;  2VQF B;  4DUY O;  1N36 B;  1JYV A;  3H1H D;  4O4J B;  3L70 H;  2Y9Y A;  2NPS A;  5KBP A;  1RFY A;  4GYC B;  4I1L A;  4TV8 A;  3BCC D;  3ETE A;  2WW1 A;  2D1W A;  3ZN1 A;  1H8A A;  1UII A;  1T2K D;  3HKD A;  2WA4 A;  3JCU Z;  3ZED A;  3RSY A;  3RBZ A;  1KKC A;  3HKE A;  2AXT H;  2D73 A;  1GN4 A;  3KYQ A;  5JMF A;  3X41 A;  3Q2Y A;  4DV3 B;  5APY A;  4X1I B;  5LXT A;  3IN6 A;  1DK1 A;  2OCH A;  2CG1 A;  1NTK H;  2WPV B;  4M3L A;  2JKP A;  3DYO A;  1Y6X A;  2LXB A;  2FYZ A;  1HDJ A;  3CJH A;  1AB3 A;  1R3L C;  1R6N A;  2YIU C;  1RF1 A;  2Q69 A;  3CWB H;  1S5L Z;  2B5U A;  1YI2 V;  1T3J A;  3BRC A;  5AVQ B;  1Q7Y Q;  3A24 A;  3S4C A;  1K5Q A;  1NBM G;  1PP9 D;  1HTY A;  2ZIM A;  3ALA A;  1K05 A;  5IT9 N;  2YIU B;  1UPG A;  5LHI A;  3AK3 A;  5B5E E;  1Q82 Q;  1OWA A;  3AEF C;  4YJ3 A;  2HP8 A;  1N7P A;  4OGQ B;  1NTZ E;  2D3O W;  2P58 A;  1KD1 W;  1JY2 N;  3TCU A;  1PKX A;  4E4E A;  2MJZ A;  2AZ2 A;  3H01 A;  4LR3 A;  1NTZ D;  4BZH A;  3QG5 A;  1EBO A;  2BOB C;  3FWL A;  1JX9 A;  4P9P A;  4EEQ A;  1TA8 A;  1H8E G;  3H1J J;  3BLC A;  1IBM B;  2M5A A;  1OCR C;  4OGQ D;  4N6J A;  2K3R A;  1GTO A;  3ASN C;  3S1K A;  1KIL D;  3A0H H;  2FL4 A;  2GTS A;  1JJO A;  3AE6 C;  2JO1 A;  1IFI A;  1TQS A;  5JCO A;  3A0O A;  1OCR B;  4HYT B;  3BVH A;  4JI8 B;  1YF2 A;  3JAM N;  1GW4 A;  2EAE A;  3SPG A;  3ASN B;  1N0J A;  2M3B A;  2LXC B;  4FPP A;  3HKC A;  2QSA A;  2OOV A;  5KAF E;  2F93 B;  2FYU G;  1GMJ A;  3H6P A;  4BXL A;  1HN0 A;  1OCO B;  1FZG A;  1O7D D;  1ZRT E;  2WCO A;  2LJ2 A;  4PA3 A;  5JH7 B;  4GKK O;  3RFR A;  5AVY B;  3N4X A;  2A3Q A;  4I7Z C;  4RKU J;  3TGU E;  3GLM A;  3WB0 A;  3ZHT A;  4J5T A;  3K5O A;  2QIW A;  3FXE A;  1ZUQ A;  1KQL A;  4X20 A;  3VQX A;  4U7J A;  2B1G A;  3T1H O;  5APX A;  2X03 A;  4I7Z B;  1ZP0 C;  1QWU A;  4XFJ A;  1JR9 A;  2B89 A;  2WMM A;  2E5L B;  4JI2 B;  3CCV V;  3EVK A;  4MN4 C;  1OJH A;  1VQ7 V;  1Q81 Q;  3D36 A;  1FU1 A;  1L4A A;  3RYF B;  2OYI C;  4F6R B;  1NSV A;  1P49 A;  2C9N Y;  1P4R A;  3E89 A;  2IW5 A;  2RN0 A;  5KA5 A;  4WFA V;  2R72 A;  4GX1 A;  4Q20 A;  3O9O A;  5J9P C;  2NRG A;  5IJ0 A;  1QX8 A;  1K92 A;  4JI6 O;  1YIT P;  3I5C A;  1IDS A;  1DH3 A;  2C11 A;  4DR3 O;  2KZJ A;  2OQQ A;  3ZMT A;  5LGN A;  3E1R A;  4UV8 A;  2ZFC A;  4O4L B;  3NFQ A;  3F5W C;  2UUC B;  1XNQ O;  3A2A A;  1Z2G A;  4DR5 O;  1N8R W;  4YHH O;  3JAW A;  3BGA A;  2WLI B;  3ABL C;  2XTA A;  4JI4 O;  5JQG B;  1RE3 A;  1K1Y A;  5CMZ A;  1TVK B;  2ZE5 A;  1FXK A;  3IGA C;  2L91 A;  1I5X A;  2BTQ B;  5B5E H;  1L0L E;  3OR6 C;  4TT3 G;  3U0Z A;  1U96 A;  3CCJ P;  1L0L D;  2QJP C;  4DV6 B;  2QKS A;  2N74 A;  3ABL B;  4PD4 F;  1WP7 A;  2KSE A;  3OMI B;  5CA3 A;  1L1F A;  1IBK O;  3A3Y B;  4CH3 A;  1IK7 A;  5AVS B;  1Y4M A;  2AEM A;  1NTM K;  5CCG C;  4WFE A;  4UFZ A;  3L72 G;  3CL3 D;  5E1A C;  3BUP A;  2DJV A;  2YXL A;  4LF5 B;  4GOF A;  3ZMU A;  3E8G A;  1FXH A;  2YMY A;  2AEF A;  2QJP B;  3KCY A;  1JMB A;  1AVO A;  1N34 B;  1I7F A;  3LSU A;  3FAV B;  1DYU A;  1NO4 A;  4DUY B;  4JYB A;  4AUW A;  1TUB B;  1AI4 A;  2WSF J;  1B06 A;  3T1C A;  3JAL B;  2YIC A;  3B8N A;  1GMG A;  5KAF H;  3VOU A;  3DDG A;  3PN1 A;  1R73 A;  4EYY Q;  4BAY A;  5E79 E;  2CK3 G;  2IYP A;  1URQ C;  3FXD A;  2WWW A;  4EI2 A;  3WU2 Z;  3TGU H;  2G3A A;  2A45 H;  1SZX A;  5AW2 B;  1IZN B;  2HJD A;  1ROP A;  2CFD A;  2W27 A;  1DF5 A;  4Y28 J;  1LTI C;  4KXR A;  1URQ B;  3WFV A;  3MTU E;  3JSN A;  1DEB A;  1FAV A;  1SQP E;  2L5G B;  4J7J A;  4YPC A;  1FDM A;  1D6U A;  1NH2 B;  3C90 A;  3WB2 A;  3ZRX A;  4EIJ A;  4B7E A;  3DX1 A;  1M57 C;  2X7R B;  4DR7 O;  1PM9 A;  1KQS U;  2ZVN B;  2IFM A;  5JWP A;  4FLY A;  2H88 C;  2HG5 C;  2JP3 A;  2FUT A;  4MS2 A;  2YXY A;  4X66 O;  2OGU A;  1QR9 A;  4NB5 A;  4U3J B;  1EXI A;  2Q3E A;  2E43 A;  2E2V A;  1OV9 A;  1EZV G;  2RKL A;  1F4M A;  4FK5 C;  1SRY A;  1S3J A;  1M1K Q;  3GHG B;  3R2P A;  3ZS8 C;  3HE5 A;  3F5H A;  4B3M O;  1H0T B;  1KB9 D;  2HKO A;  2ZIN A;  2BEQ D;  3CX5 F;  3RK3 D;  4CC6 A;  3IAO A;  2DWE C;  2CWV A;  2M7W A;  2E22 A;  4R50 A;  5AVU B;  1T6A A;  1BE3 G;  3LOY A;  3CX5 I;  5CHX A;  2NR5 A;  3RGB A;  3JD4 A;  3OAA G;  4IFM A;  3L72 J;  2H7H A;  2JEE A;  1HGV A;  2JWA A;  2WPS A;  2OTJ P;  3CSX A;  4NEI A;  3G71 V;  1FE6 A;  1WA8 B;  2ZM6 O;  2KS1 A;  4MSW C;  2P6J A;  3BEH A;  5EZY B;  2UUA O;  3SYC A;  4I50 A;  2P7T C;  4CS3 A;  2RH0 A;  4PEL A;  1AR4 A;  3BHP A;  1NQT A;  1HNX O;  2FYU D;  3E1I A;  2K9P A;  2Q7E A;  1I94 O;  1TQV A;  4P9O A;  3ABM C;  4RJT A;  3FD9 A;  1D2D A;  4QPJ A;  3M0D C;  2I1J A;  1HXK A;  4GKK B;  1NTK K;  1LUR A;  2P4V A;  2BE3 A;  1HVV A;  2OYH C;  2X6C A;  2YIB D;  1SIH A;  2YEV B;  4H0L C;  3A0B Z;  1W2B U;  1GU4 A;  2IZ0 A;  1JTH A;  1N86 A;  3ABM B;  1S72 V;  3THO A;  5J2T A;  2V7Q H;  2E3C A;  2Y74 A;  2QM4 A;  2QWQ B;  3T1H B;  1YIT V;  2EBO A;  3OA7 A;  4J7K A;  4J10 A;  2OYH B;  5KA6 A;  1FZB A;  1SQX J;  1FOS F;  1RPR A;  4H0L B;  3BUD A;  3S4D A;  1R6K A;  2DQ0 A;  5TIS E;  3CV5 A;  2AZ0 A;  1M1J A;  1EFR G;  3H1L E;  5E79 H;  1HGZ A;  3T0B A;  2FXM A;  1JYN A;  2YXR B;  3FKS G;  2BAS A;  3ASO C;  3BFR A;  3ECQ A;  1Z5V A;  1NTM G;  4H37 A;  4JI6 B;  3M99 B;  4QMA A;  5H6Q A;  4GKG A;  4R4M A;  2IPP A;  3H1I G;  5AVW B;  3AK2 A;  3UO2 A;  3CCJ V;  1SQP H;  2JKA A;  1KUQ A;  1EDK A;  4BWN A;  3ASO B;  5KJ7 A;  2Y69 C;  2CUG A;  2P06 A;  1HN1 A;  3WB1 A;  2KKW A;  1LP1 A;  3VQY A;  4YHH B;  2WTY A;  2J58 A;  4JI4 B;  3ETQ A;  4O2B B;  1Q7Y W;  4LFB O;  3H1K E;  3HTK A;  3E22 A;  4KHP O;  2X0L A;  2Y69 B;  1V7W A;  4CH5 A;  4Q6G A;  3GF7 A;  1LT9 C;  2ITC C;  4W7Z A;  4PDL A;  1Q82 W;  3CP1 A;  4X64 O;  1KYO D;  2WZ7 A;  1K9M Q;  1IBK B;  1XMO B;  4RQF A;  4I9Q A;  2QWR B;  2P4K A;  2JRI A;  2YI9 A;  3HI7 A;  1PPJ G;  5A9G A;  2WLH A;  1LT9 B;  1H2M A;  1US6 A;  2WSS H;  1XQ8 A;  1HTL C;  3OTO O;  2Y0C A;  4W80 A;  1QLN A;  1HP8 A;  4GZR B;  1SFC B;  1W2E A;  3IFM A;  4MVZ A;  1YCI A;  4X65 O;  3EJQ A;  1SQQ J;  2BCC G;  5LYJ A;  4HAM A;  2OIE A;  1RQV A;  1FJP A;  4OK4 A;  2E75 D;  1KN7 A;  5CA1 A;  2ZXW C;  5CA0 B;  2DW4 A;  1J5E O;  3HII A;  5KAI H;  3G80 A;  4U3F H;  3DSQ A;  1SFC D;  5L3B A;  3SDL A;  2WSE H;  4GX5 A;  2N1T C;  3SPH A;  4ZI7 B;  3ETD A;  1BCC D;  4MVS A;  4TQD A;  3M0A A;  1FZA A;  2WIT A;  1SP4 A;  3AE8 C;  2ZXW B;  4XDL A;  1J2J B;  3LUT B;  4NKG B;  4DUZ O;  4O2A A;  1BQZ A;  3O6Q A;  1YJW P;  3BVO A;  3AE1 C;  3CPW U;  1MV8 A;  5J2U B;  4TWK A;  1NTM J;  3SJC C;  3L70 G;  2FBW C;  3BS6 A;  5B3S C;  3AFL A;  5L3F A;  2PGG A;  5B66 Z;  1EKM A;  3H1I J;  3VQV A;  1XTG B;  3RYI A;  1PGQ A;  3GG2 A;  1AP6 A;  4O4H B;  3F7Y C;  3M9B A;  5TIS H;  1NTZ K;  1EN5 A;  3H1L H;  1BHA A;  4BW5 A;  3BVX A;  1PNK A;  2CTW A;  4X66 B;  1EZV D;  1WLE A;  5GON B;  2IYO A;  1Q81 W;  1SNZ A;  4C7U A;  2QJK C;  2E2U A;  3UT5 A;  4GX0 A;  1IFD A;  1NTK G;  3MD0 A;  5ITZ A;  5LP6 A;  1UI8 A;  1CB8 A;  2OTJ V;  3OTF A;  4FNP A;  4QE7 A;  4LFC B;  1HWT C;  4B3M B;  3CWB G;  4PA4 A;  3D6Y A;  2ZL8 A;  3KPE A;  3N7N A;  4WFG A;  5C8Y B;  2ZE6 A;  2XAQ A;  3N9H A;  5H2F H;  1WMK A;  1H2S B;  1BE3 D;  1RW9 A;  1GL2 A;  3MUZ 1;  1NAY A;  3HB3 B;  3H32 A;  4QPK A;  1V54 C;  1OVV A;  4PI2 A;  3HKB A;  1EDI A;  3H1K H;  1IJD B;  3Q4H A;  1FFX B;  2WPD G;  3JAT B;  4PJ0 Z;  4TUY B;  2LW7 A;  4FLX A;  2FYN C;  1NKD A;  3T0A A;  2WLN A;  4ASW A;  4KUM A;  1T8Z A;  2OYO A;  2FTK A;  5GTH Z;  2UUA B;  2PI5 A;  1WAZ A;  1N4C A;  1XOU A;  2R9R B;  4A7P A;  4OPA A;  2BCC J;  3AMO A;  2XND H;  1Y9B A;  2FYN B;  4W4L A;  1SQB H;  1NKZ B;  2AXC A;  2XN0 A;  4BW9 A;  5KMG B;  4PDM A;  2R5B A;  1K34 A;  3V2P A;  4L73 A;  3H9V A;  3JD0 A;  1FPO A;  1QLE D;  5KHG A;  3WUV A;  1ZR4 A;  2C10 A;  2R9A A;  1VQO P;  1FZE A;  1IQY A;  1JMK C;  2E76 B;  1SF9 A;  3X42 A;  4DRX B;  3CB2 A;  4OH8 B;  4KT0 J;  2OW6 A;  1Y66 A;  2ZDI A;  1N32 O;  3GWO A;  3E7K A;  3ZRW A;  1WMN A;  2DYS B;  2J59 M;  2IFN A;  3HPL C;  3CMA P;  2E76 D;  1P84 E;  1VDF A;  4J42 A;  3STZ C;  2OQE C;  4TV9 B;  3LW5 H;  3AG1 B;  1JY3 P;  1YTF D;  1AV1 A;  4CH6 A;  2RN9 A;  4UCT A;  2FYV A;  4N23 A;  1IBL B;  4BR6 A;  5E1Q A;  3BCC G;  3I3E A;  3V4W A;  2MK3 A;  1AI7 A;  3VOP A;  3VN0 A;  2QKC A;  4IHJ A;  2DMX A;  1LNQ A;  2VQE O;  2A7W A;  1L0L K;  1EZJ A;  5AVX B;  2PZS A;  3K5L A;  2NPS B;  5KLV D;  2RMK B;  5D5P A;  5APW A;  4DV3 O;  1EN4 A;  3WG7 C;  1XNR O;  1Q6I A;  3RT3 C;  4BIU A;  4LFB B;  1NS4 A;  3Q3D A;  4PA6 A;  3HKD B;  4HYO A;  4KHP B;  3HKE B;  3DCD A;  1FD9 A;  1PX4 A;  2ATK C;  3Q5S A;  4LGD E;  1NU1 J;  3B77 A;  1RHZ B;  4JI5 O;  2V4H A;  2YO2 A;  2F23 A;  2NPS D;  1YQ2 A;  4LLH A;  5C93 A;  3WG7 B;  4X64 B;  2F66 C;  3B5N C;  2CE4 A;  2KOG A;  1PPJ D;  2AXT Z;  4LF4 O;  1M1K W;  1RF1 B;  1QVG O;  3CC7 V;  1KB9 F;  1OW6 A;  4D7S A;  4I9W A;  2XHB A;  2D2C D;  1KB9 I;  5AW9 B;  2QG4 A;  2FKW B;  1S4X A;  2CIQ A;  1K7D A;  2PTM A;  4HB1 A;  5GTI Z;  1NTZ G;  4I6M C;  2QWO B;  4X65 B;  1YJ9 P;  5LL6 Y;  5A2Q N;  3RBX A;  3WVF A;  3DEC A;  1VF5 B;  1TU5 A;  1W7C A;  1YJW V;  2EZP A;  4IYH A;  4RAI A;  1GM7 A;  1QGK B;  1SQV D;  1R34 A;  1VQM P;  3VP9 A;  1IVU A;  3HD7 A;  3L73 D;  1ZW0 A;  1NS7 A;  4YY3 O;  2WGQ A;  4L87 A;  2KNC B;  1S76 D;  1FAF A;  5JCO C;  3ABT A;  1RSO A;  2W90 A;  1VF5 D;  3ABK C;  1SQP K;  2HPC B;  4WBN B;  1XHX A;  2EJ7 A;  3SR2 C;  4DUZ B;  1Z45 A;  1H2L A;  5M1B A;  3UIA A;  4WCE V;  3L70 D;  3DX2 A;  1LTJ C;  3K25 A;  1BS3 A;  1AR5 A;  2FFD A;  1G2C A;  5KHI A;  2O3J A;  3ABK B;  4JTA B;  1L2P A;  4FMT A;  3BCC J;  4BRY A;  2WW0 A;  3OBA A;  3A0H Z;  3HKC B;  5KKZ C;  1IFJ A;  1QBZ A;  2ZT9 C;  1LTJ B;  1P84 H;  1YVW A;  3TGU G;  1MMM A;  2CH7 A;  1VQ4 P;  1BSM A;  2KLU A;  2HYN A;  3SFE C;  1NTK D;  2GUZ A;  3T09 A;  4UUJ C;  4NYK A;  4WY4 C;  1FKA O;  1U7J A;  2R5D A;  2ZXE B;  3M9H A;  1MSD A;  3D36 C;  3K0D A;  3ZHQ A;  2XAG A;  3CWB D;  2ZT9 B;  2KXP B;  2IDB A;  1JOV A;  4X20 B;  4UCU A;  5LMU O;  2LQT A;  2EZO A;  4LF9 O;  2RMZ A;  1QCE A;  2P10 A;  5LBQ A;  2KP8 A;  4ZOL B;  5BU8 B;  3SSU A;  4WY4 B;  4I4T A;  3KHU A;  1PP9 J;  3MUY 1;  1L4A B;  1L8D A;  4OX9 O;  4MW3 A;  3G6E P;  1GN6 A;  1SES A;  4EFE A;  5KX5 A;  3L37 A;  1IO4 A;  3OUF A;  3P30 A;  2GA1 A;  4Z1M H;  1QWN A;  1D6Z A;  3SYQ A;  1LTS C;  2P90 A;  3CHX A;  3L4F A;  2ZKO A;  4DV0 O;  1R5L A;  4LFA O;  2E74 C;  3RK2 D;  1VQO V;  2BSK B;  2W0F C;  1NTZ J;  2XNX A;  3G3Z A;  4UCS A;  2QEX P;  1L4A D;  3B2E E;  1RE3 C;  3AE5 C;  1JO5 A;  3AEG C;  1HWW A;  1GN2 A;  4DUV A;  5L3D A;  1KYO I;  1R5S A;  3NRE A;  4BTY A;  2E74 B;  1L7J A;  4MVO A;  1VEW A;  1FS0 G;  3JAW B;  5H9C A;  1L0L G;  1VQK P;  4FLU A;  3CMA V;  5B1A C;  2WAM A;  3QTC A;  1J1D C;  1FXK B;  4UB8 E;  1T2K C;  1IXM A;  2QJY C;  3S9O A;  4D7T A;  3V2N A;  4DUX A;  5K5G B;  1IVX A;  1KQG B;  1NVO A;  4FNQ A;  4HKZ H;  4JTC B;  1N32 B;  2RNB A;  3CRQ A;  2DWD C;  3ZHS A;  5IYZ A;  5B1A B;  1J1D B;  1Q2N A;  2JKV A;  3HR0 A;  4Z2W A;  1N7O A;  3DDF A;  2JKE A;  3E80 A;  1RWG A;  1D5A A;  4D6T E;  2EAC A;  4EDF A;  1VQP P;  1K1W A;  4JI7 O;  2O1K A;  1HM2 A;  3QO8 A;  4J9Y B;  2KQX A;  2ITD C;  4FFB A;  2QGN A;  1BGY E;  3LNN A;  1YZB A;  3LSQ A;  2ZQM A;  1VQ6 P;  2VQE B;  3NTN A;  1HJB A;  3E83 A;  1M90 Q;  3BLB A;  4MMI A;  1LGH B;  1C82 A;  3G6B A;  4KTP A;  3CC2 P;  2QWP B;  4LNU A;  1XNR B;  1GK4 A;  2AW9 A;  1DLB A;  5IE9 A;  1IFN A;  2YFN A;  2JWD A;  3J80 N;  1H88 A;  1X59 A;  4NTX A;  2YI8 A;  1AVL A;  5EBW C;  2KZI A;  5B1O A;  4OGQ C;  4JI5 B;  1YJN P;  5KAF Z;  1EZV I;  4MTO A;  1KIL C;  1YQ4 C;  3CI9 A;  4JYC A;  3UQ8 A;  4JYY A;  1SQP G;  2ZXX A;  1X9V A;  2NZ2 A;  4DK0 A;  4GIF A;  1F1S A;  4LF4 B;  3RVY A;  3E86 A;  1NSR A;  4G2K A;  2LR2 A;  3JYC A;  1GW3 A;  1LXM A;  4MTF A;  4DV7 O;  1S5J A;  2CWU A;  2M0B A;  1KIL B;  4GCZ A;  2DE0 X;  2P2U A;  4GUN A;  5LMN O;  4GOD A;  3DXR A;  1S77 D;  3JAK A;  1AA0 A;  1KQS O;  4DUW A;  4H44 D;  1ZV8 A;  3MWX A;  1L0L J;  3RYH A;  5JMD A;  4BIZ A;  2ARH A;  2Y9Z A;  3PTZ A;  1IXB A;  1Y74 A;  4PA9 A;  2CIR A;  4YY3 B;  1OCO C;  1PFI A;  1NH4 A;  3L74 E;  2Q5Z A;  2WT7 B;  2QA4 P;  2HOD A;  2WSS G;  4W4K A;  3CRM A;  4RQE A;  2JR8 A;  3OEH G;  2UUB O;  1QAL A;  4AIL C;  1E79 H;  3VD9 A;  1FZC C;  3L71 E;  2Y0E A;  1Q5O A;  4UB8 H;  1NZ6 A;  2QKA A;  1VQ4 V;  4GDO A;  1RWH A;  1JZ8 A;  3OAK A;  2ZAE B;  2W8Z A;  4J11 A;  2Y0I A;  4E2L A;  5LOV A;  5IYC O;  4B3R O;  1ZOY C;  1ZRT D;  3T2M A;  4IL6 X;  1FZC B;  3S3X A;  2JEU A;  5AW1 B;  1NJI Q;  3W7X A;  5DJT B;  3VSM A;  2YNY A;  1LTA C;  1L0N H;  3TGU D;  2ZR3 A;  3AEC C;  4D6T H;  3CEI A;  3OFN G;  1S5L E;  4ZNC A;  3ABU A;  3EJT A;  3TJT A;  4X62 O;  3G6E V;  1CZQ A;  4DK1 A;  3K5T A;  3MUD C;  1P84 F;  3PLN A;  3P8C E;  3WIQ A;  1BGY H;  1KC8 Q;  3Q5P A;  5BR8 O;  2HTB A;  5LMU B;  4OXS A;  4LF9 B;  5KHH A;  1W2B O;  3TXS A;  4JAU A;  3H1L G;  3UO3 A;  2HVK C;  2DN9 A;  1JFF A;  2HJF C;  3KQG A;  3MIW A;  3BA8 A;  1CI6 B;  3CZJ A;  4OX9 B;  2EAD A;  1QL1 A;  2C0W A;  3JAR B;  3WUT A;  1PZQ A;  3OT7 A;  5AVZ B;  1T3U A;  4GKJ O;  3N2K A;  1N7S A;  2O01 J;  4O9B A;  3RRS A;  3WFA A;  3APO A;  4DV0 B;  1VQK V;  4LFA B;  3EQ2 A;  1AVY A;  1N7N A;  4I55 A;  4FNT A;  3T4Z A;  2KG7 A;  1IVS A;  4R7C A;  2GM4 A;  3HUS A;  4JPZ B;  3TNU A;  3R4Y A;  3T0D A;  1NS0 A;  5LA6 A;  1JMM A;  3K9A A;  1A02 F;  2CFL A;  1LP1 B;  4X1K A;  3D8C A;  2CTQ A;  1DF4 A;  3H1K G;  1Q6H A;  2XN2 A;  5APS A;  3X2Q B;  3CCL V;  2UXC O;  3AED C;  2JS3 A;  4HH2 A;  3T97 B;  2E5T A;  4WBA A;  1QR8 A;  1XMO O;  4IFF A;  3HTK B;  4PD4 I;  3E22 B;  1VQP V;  1EXJ A;  3DC5 A;  4JI0 O;  1PNL A;  1HMU A;  5KUK A;  5KJ7 D;  2PRR A;  4ZHQ B;  5EIB D;  2FYU J;  3H1J E;  1F9G A;  3K57 A;  1SS1 A;  1YYC A;  3QDE A;  4C46 A;  2V4D A;  4UCR A;  4DV2 O;  1VQ6 V;  2YFO A;  3L74 H;  2ZE8 A;  1NSZ A;  5KLV K;  1PU4 A;  2B9Z A;  4FIP C;  3M9Q A;  1YSC A;  3CC2 V;  4JI7 B;  1RWA A;  1TXK A;  3L71 H;  1SA0 B;  1IVW A;  3W7T A;  2Z0A A;  3E8B A;  2JGD A;  1NS8 A;  5A1A A;  4KFE A;  3AK1 A;  5H5N A;  2KK7 A;  4OJZ A;  2LP7 A;  1YJN V;  5LYJ B;  1NR7 A;  2WW2 A;  2N05 A;  2O57 A;  3ICX A;  4L76 A;  5CA1 B;  1BCC G;  2E2T A;  2BRV X;  5APT A;  4Y99 C;  3FB7 C;  4W7Y A;  1U57 A;  1JOY A;  1XBL A;  4DO2 A;  1S5L H;  4FLZ A;  3RK3 C;  2HTA A;  4X1I A;  1QQC A;  2VS0 A;  4B7K A;  2CGN A;  1G4Y B;  1SQP D;  3GHG C;  2Y4U A;  4Y99 B;  3AE7 C;  3VYI A;  3CC4 P;  4FNS A;  2HHH O;  1Y76 B;  3RYC B;  1S5L X;  2VWK A;  3RK3 B;  4NVP A;  2K9J A;  4J80 A;  3CPW O;  1W6C A;  5LGT A;  1SQV K;  2Z5H A;  1NKG A;  4DV7 B;  3GB7 C;  2WLJ A;  2Q9I A;  2OTL P;  1TUE B;  4QGP A;  5LMN B;  4LFC O;  2QA4 V;  1S1C X; 
#chains in the Genus database with same CATH homology
 3EJR A;  2F1B A;  5DJU B;  1Y47 A;  2KI7 B;  4HKZ H;  3BVX A;  3BVV A;  3D4Z A;  2LXB A;  1Q2N A;  1EDL A;  2HR3 A;  3BVW A;  4JBZ A;  1TQT A;  2F7O A;  2KIK A;  2KS1 B;  3DDF A;  3LVT A;  1QX1 A;  4HB1 A;  2WYI A;  4NPE A;  2OTK E;  3ZDM A;  1HTY A;  3BUP A;  3BUD A;  4GOF A;  4ZMD A;  3CV5 A;  3BVU A;  1JMB A;  1R34 A;  3BVT A;  2I8D A;  1OVR A;  1TQU A;  2P58 A;  3BUQ A;  1ZW0 A;  1OVV A;  3BLB A;  3DX4 A;  1EDI A;  2F18 A;  1LT1 A;  2QVA A;  2F7R A;  4NPF X;  2KUB A;  4ASW A;  1R33 A;  1LP1 B;  2JWD A;  1HXK A;  2M5A A;  3EJU A;  3MHV A;  3D4Y A;  3DDG A;  3DX2 A;  1EDK A;  2KZI A;  4EYY Q;  2K3R A;  2QRX A;  1TQW A;  1JM0 A;  1LP1 A;  3S1K A;  3D51 A;  3FXD A;  4IOI H;  3CZN A;  3CZS A;  1U7M A;  1TQS A;  3EJS A;  4HJG H;  1FC2 C;  2LR2 A;  3RGU A;  1BDC A;  1SS1 A;  2LXC B;  1MFT A;  4K3A A;  2M0B A;  3QWO C;  1DEE G;  3EJP A;  3D52 A;  4BXL A;  1O7D D;  2M5A B;  3DX1 A;  4GOD A;  1U7J A;  1PS3 A;  1X0T A;  4WWI A;  2F7P A;  2OW6 A;  2OW7 A;  5C39 A;  5EFW B;  1ZXG A;  2UWJ E;  4NPD A;  3BUB A;  3FXE A;  2RKL A;  1S3J A;  4CPG A;  3BUI A;  4ASV A;  3EJQ A;  2SPZ A;  1QWU A;  2B89 A;  3MZW B;  1QWN A;  2WMM A;  4MN4 C;  2FYV A;  1H0T B;  4GOE A;  2R44 A;  1EC5 A;  3D50 A;  3PH0 A;  2B87 B;  1H0T A;  4KJM A;  2B88 A;  1OVU A;  2F1A A;  2ZAE B;  2B87 A;  3DX0 A;  1HWW A;  4K35 A;  3DX3 A;  2F7Q A;  2WYH A;  2KZJ A;  5KBP A;  2ALW A;  5DJT B;  2Q1K A;  4ZNC A;  5CBN A;  1EDJ A;  1TQV A;  5CBO A;  3EJT A;  5K5G B;  1BDD A;  1NVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...