4K3AA

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
720
structure length
720
Chain Sequence
GDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
total genus 249
structure length 720
sequence length 720
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k3aA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k3aA04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k3aA02
3D52A 2KIKA 1EC5A 2KI7B 2M5AA 2RKLA 1HXKA 3BUPA 1X0TA 3MZWB 2LXBA 3BVWA 4HJGH 3S1KA 4HKZH 2F7PA 1QX1A 4GODA 2QVAA 4NPDA 3FXDA 2KZJA 3BVUA 3D4YA 2LXCB 2B88A 2SPZA 2M0BA 3CZSA 1TQUA 3BUBA 3D4ZA 2B87A 2OW7A 2R44A 4EYYQ 1LT1A 5CBNA 4K3AA 2JWDA 5DJTB 1H0TB 4ASWA 4GOEA 1OVUA 1QWNA 3DDFA 2F1BA 3CV5A 3EJQA 1U7MA 1MFTA 1QWUA 3BVXA 1EDKA 3EJRA 4WWIA 1OVRA 1NVOA 2LR2A 1U7JA 1LP1B 1JM0A 1TQTA 2M5AB 5CBOA 4NPEA 1ZXGA 2B87B 1BDCA 4MN4C 3EJTA 1DEEG 1FC2C 2I8DA 1PS3A 3EJUA 2ZAEB 4GOFA 3DX2A 2KS1B 3LVTA 1EDJA 3ZDMA 5DJUB 4ZMDA 2UWJE 1HTYA 3EJPA 1R33A 2WMMA 2P58A 3BLBA 5C39A 1EDLA 1LP1A 4IOIH 4K35A 2F18A 1JMBA 4BXLA 4HB1A 3PH0A 5EFWB 1Q2NA 2QRXA 1TQWA 1ZW0A 2F1AA 3MHVA 2ALWA 1R34A 2OW6A 1BDDA 2KUBA 4ASVA 4ZNCA 3BUQA 3DX4A 2FYVA 1EDIA 4CPGA 5KBPA 2OTKE 1S3JA 3DX3A 3DX1A 2WYIA 3EJSA 2B89A 2F7OA 2HR3A 2Q1KA 3DDGA 3RGUA 3DX0A 1O7DD 3BUIA 2WYHA 2K3RA 3QWOC 3D51A 4NPFX 3CZNA 1OVVA 3BUDA 2F7RA 1HWWA 1H0TA 3BVVA 4JBZA 3BVTA 1Y47A 3FXEA 5K5GB 2F7QA 1TQSA 1SS1A 2KZIA 4KJMA 3D50A 1TQVA
chains in the Genus database with same CATH superfamily
4WVZA 3ML0A 4JI3O 2KOGA 4GX1A 4DV2O 3S4RA 1RF1B 3VDAA 2FYUE 1ZL8A 4IL6X 3X40A 1K9MQ 2WLLA 3CWBG 3BVWA 1WB8A 4MTGA 1NU1E 2WPSA 1QX1A 3CSXA 1JJ2U 3L75J 2A45H 4BRYA 1SQBJ 3H1IH 2AXCA 4DW0A 4E2LA 1PGPA 2QG4A 3JAMN 1R3IC 1YEWA 3WUVA 5AVRB 4DR7O 1VQ6P 3TF5A 4OGQB 2SPZA 1AV4A 1NKGA 5EZYA 2EILC 2M0BA 3ACSA 2EIMB 3JASB 1HVVA 3VMYA 4N23A 2XUMA 2FY8A 4X66B 2R44A 1W2ZA 3CCSV 1AI5A 3AG1C 2OYIC 4B7KA 1VQMV 3L70E 5BMVB 3WU2E 4UFZA 1CSBA 3L72D 2QA4V 2FB5A 3K57A 1N36B 1JYVA 1NQTA 3DC5A 4I7ZB 4U3FG 1FDOA 1ZLZA 1U7MA 1QAFA 2WVXB 3CI9A 2Z5HA 2H88C 4XDJA 1FXKA 2ZDIA 3UQ8A 2QA4P 3R65A 3BRVB 1QBZA 2Y0EA 2G38A 1KKCA 3WFVA 1MA1A 5M1BA 2KSEA 1KILA 4CC5A 1Q43A 4DT0A 2GHYA 2LJ2A 4FJCC 4BWNA 1S72V 1YJNV 4MTOA 3KDPB 3CX5D 3SWKA 2DYRB 3SJCC 2KP8A 4JTAB 5JJEB 1W6GA 3G80A 4RQFA 5KAIZ 1G6UA 4JI6O 3D3QA 1KILC 2QTSA 2E76C 5LHGA 1M56C 4O2BA 3AE7C 3AG3C 3ECQA 3EXAA 2Q5ZA 4PA3A 2Q9IA 2CGOA 1KKDA 3BVOA 4CH4A 1PL4A 4EIJA 3V4QA 3USSA 3HIIA 3CC7P 4JYYA 3MV01 1IBKO 2XAFA 3SJAC 1G2CB 1HBWA 1GO3F 2DW3A 3CMAV 1JY2N 5AW4B 2ZT9D 5C8YA 2HFEC 4F6RB 3H25A 1NSUA 4RESB 5KLVD 4UVBA 5C93A 2HODA 2FYUK 2D2CB 1M1KQ 3D36A 1NYHA 3CXHE 2C11A 4FNRA 1E5WA 1M8OB 3CC4P 1N9EA 3HUSC 1OVVA 3BUDA 3I5CA 5LMUO 2ZXWB 5JJJB 1PV3A 3WB1A 1IFJA 1U97A 2HG5D 1N7SC 1P84E 5HFMA 3L72H 2JK5C 5KMGB 3JD4A 1OCRC 2QJPB 1AR4A 1TQVA 4X9QA 1WNSA 2DMXA 2QKSA 3VD5A 2KIKA 1NTZJ 1SRYA 1EC5A 1TVKA 2E75C 4YPCA 3RK3D 1W6CA 1SQXH 4FFKA 3MZWB 1H8HG 3ZRWA 1SQVG 3OBAA 4FIPC 4ZOLB 1WPXA 3GLMA 2YMYA 4UB6E 5EBWC 1S0VA 1OZ0A 3CCEV 1SQVJ 1B04A 1J5EO 4CS2A 1VDFA 3LNMB 4DR5B 2KZJA 2WSSG 2IJJA 1K9MW 3GVMA 1JOCA 2KSJA 2D1WA 2HG5C 2W6JH 4R50A 3ZHQA 4MVSA 1MSWD 1AQTA 3VMZA 3ASNB 4DR7B 4ZI7B 1J0NA 5JVDB 1L0LJ 2P4VA 1SP4A 2IFMA 2WSEH 4O4IA 1ZL8B 1LUWA 4EFEA 4LF6O 4RAIA 2O1KA 3L71E 4FVMA 1BSHA 4TV9B 3OR7C 3UCSC 1EZVI 1M57C 4KFEA 4L74A 4N78E 2HLOA 2KS1A 1S77D 3FKSG 3MP7B 2OOVC 1DYUA 1LTGC 2Z5IA 3MD0A 1KILD 1KD1Q 3S9OA 4EB6B 1JTHB 2XN2A 2FXMA 1RE4C 1A02J 1YQ2A 1JOVA 4X89A 2B1GA 4JZ2A 4FLTA 1BMFG 1LP1B 3CXHI 1DTOA 2A06H 3BHPA 4DR4O 3F5TA 2Y9YA 1COWG 3IJ4A 1GTOA 3D6YA 1MOFA 2PGGA 2ZKOA 3NTNA 1SLQA 3B5NC 3CYOA 5BMVA 2P06A 3MHHC 4JI0B 1YZBA 3X3YA 2FYUG 3M99B 1GN3A 3CWBE 1MMZA 3CXHD 4EEQA 1NU1G 3VD4A 2UXNA 1NU1J 3OB8A 3K08A 1J1EB 3GB7C 3QFYA 2Y0PA 3BAAA 2UUCO 2W83C 4P9OA 4DXWA 4IOIH 2KG7A 3K5NA 1L8DA 3HKCA 2GTAA 1BCCG 2WGQA 3HE5B 3OMAB 4JGSA 3MWXA 2DQ0A 4CS3A 1BHAA 1CEZA 3N2KB 1QGKB 2Y74A 3VQYA 3B5ND 3DX4A 4BTXA 4YTPC 1WJZA 1YDXA 4RO2A 2ZVNB 3U59A 1RP3B 2ZQMA 4GIFA 4DR5O 3EJSA 3KIIA 2BASA 2EBOA 5L3BA 2ITAA 4IYIA 3B71A 2ZYAA 3LNNA 2WYHA 2D2CD 3Q4HB 5H9CA 3D51A 1Y67A 4O2BB 4GKJB 3A0BH 4JASA 3BRCA 1NSSA 1PNKA 5B3SB 1CP9A 4BWAA 3TNUB 3IC7A 3T97B 1T5EA 3PP5A 1ZN5A 3O6QB 1JY3P 1EN5A 4IL6E 2FYZA 2ZDIC 3JARB 1M57D 1VQLV 3X41A 5IYBO 4MMIA 2N1TA 1FAVA 2WSCJ 3S4BA 1R5LA 2XZRA 3NXSA 2IJHA 2RKLA 2P1JA 1V7WA 4X88A 5E79Z 1N7SA 2YXYA 1D2DA 3RK3B 2VS0A 1KYOI 2CQSA 2P22C 4QGPA 1OFCX 4GODA 5B66H 1SERA 2B9ZA 2OYIA 2JGUA 2VQFO 4O4JB 1Q6IA 1R3KC 1JZ7A 1K73W 1GZLA 2VRZA 4WFHA 1E79H 1K8AW 3GF7A 5J2TB 3HE4A 1EZVG 4FLZA 4GUNA 3OW2U 4OX9B 1XBLA 3BS6A 1D7MA 5JQGA 3RK2C 2AZ0A 1TA8A 3VBBA 1K34A 4H44B 1TGOA 2P6JA 2RQ6A 3TY1A 2K9PA 2Q69A 3ABLC 2WW1A 1NBMG 3ICXA 3NBBA 5GTHZ 4NEIA 2PNCA 1QEXA 1N33O 1D6UA 3HKBA 4GOEA 3MUY1 2FYNC 5KLIB 3MPHA 1X1JA 1EZVD 4DOJA 2WA3A 2UUCB 2ITCC 5B1AC 1MFTA 4U3FD 5B1OA 3B09A 1YQ3C 2PYJA 1PGJA 3ABTA 3MDSA 2AEFA 1W2EA 2WSCH 1OVRA 4WY4C 4J42A 1YHQP 3CXHH 1Y66A 1RF0C 1R1BA 3VP8A 3T0DA 4DR2B 3QVNA 3T1YO 2KS1B 4DW1A 1TU3F 1EDJA 3PN1A 1KBHA 4K8XA 1M1JC 1G1JA 1SQVE 2OTLV 3FGAD 3QDEA 1NH4A 3QTCA 1NSVA 1R33A 3I55P 3B8MA 3ACTA 5KAFZ 1YIJP 5C39A 4W4LA 1KV4A 4HNAA 3EFFK 2F18A 4CC6A 2O01J 4I7ZC 3AEDC 1VQLP 2YKOA 3A0RA 3ZHRA 3SPIA 2YXLA 3SWYA 1OCRB 2JO1A 1URQB 3U1CA 2Y9ZA 1KQSO 3H1JD 2YO3A 3IFMA 1V7XA 2NN4A 2F93B 2L6LA 2OCCC 2CQTA 2Q1FA 4UXNA 1H54A 3H1LE 2M6YA 2H3OA 2K1EA 2YIBD 1RE3A 3NMDA 1NS2A 3T0BA 1GW4A 1SPUA 1YIJV 2QTOA 3K03A 4BIUA 4C7NB 1BGYD 1GAXA 4J7KA 3H1HH 1MZ9A 3DX3A 3PGBA 3P3NA 1M7LA 3RK3C 1RM1B 1OX3A 1N32O 2CPBA 3TYYA 1H88A 4U3FJ 1FOSE 4JYAB 2KG7B 3F7VC 5AW0B 1VQNV 2WITA 1N34O 3H1ID 5KX5B 4M3LA 1K5SA 3VSNA 3KZIE 3N7NA 3EFGA 4FLUA 5K5GB 2G3AA 3LDCA 2YFOA 4KTRA 3T1HB 2EACA 3L70H 5BY1A 1IBLO 1FZCB 2ARHA 4AILC 3IN6A 3SYCA 3HTKA 2GTSA 1M1KW 1IBMO 1PKXA 4QE7A 2BCCG 4TT3H 4LLHA 3KXDA 1PP9H 3KKYA 2O01H 1N73A 3A5TA 1VQ8P 1ZUQA 4UV8A 2IBZE 4B3MO 2JEUA 1DH3A 1DLBA 3B77A 2O57A 3BA8A 1KORA 1BSNA 4HZ3A 2XHNA 2BCCJ 1YF2A 1BCCE 4H13B 5CCGC 3X2QB 3H1HJ 3CJHB 3L4FA 5LBQA 2WLIB 1CXZB 4LWSB 1TU5A 3SPJA 3CPWU 3TGUG 1L0LD 3BCCD 4OX9O 3R4YA 1L0LK 2E22A 3VDCA 2BEQD 4U3FH 2FYUH 1ZX3A 1XI1A 2WPVB 4OK4A 4YIPA 3L71H 2XAHA 3RYIA 4FLWA 4DUZO 2IU0A 5B1NA 5CMUA 4IFFA 4J9ZB 3E35A 3AG2C 5LMNO 4OJZA 3ZRXA 2OYIB 1SQVK 1LNQA 3E1IA 1ORQC 3TGUH 1F23A 4FFBB 2YXQB 4DV5O 1IVUA 2EABA 1KB9F 4O4LA 5JQGB 1MKMA 3VD9A 1Q7YW 1YXBA 1WT6A 3CCMV 2GUSA 1W59A 4DR1B 2NPSC 3X2QC 2OT5A 1FZCC 2ZCEA 1SQQJ 3PLNA 5AW3B 3U0ZA 3E7JA 4BTWA 4N6JA 2Q4PA 4JI1O 3CCVV 3SYPA 1ZTEA 1PP9G 4W7YA 1RPOA 2WLJA 3IAOA 3AE5C 2JEXA 2Y69B 5J9PC 1SQBE 2DQ3A 3L72E 1P84H 2CWUA 1GK4A 3MI6A 3CXHF 5EZYB 1HMUA 2HODB 1NU1D 1FD9A 1HNXO 1SQQD 1WMKA 4N3YB 2HHHB 3IAYA 2FYUJ 1YYCA 3AEEC 2E2VA 2DE0X 3OFNG 1OIPA 3LUTB 3TXQA 2R9IA 4MTXA 1EZVE 1URQD 2ZYDA 1NJIQ 1LTJB 3AG7A 2FKWB 4DV0O 3ZMTA 1ZRTD 2KUBA 4IL6Z 1I5XA 2FYVA 5BU8B 5CBGA 1RWFA 2YICA 3CE2A 3T0UA 4NYKA 1GL2A 3AE9C 3MAQA 3DDGA 3E89A 1M56D 4Z2WA 1D6YA 4JI4B 2AXTE 2CH7B 1NWQA 5IJ9B 2L5GB 2WPRA 1E79G 3CZNA 1R73A 2ZD9A 3FB5C 1KILB 1L0NH 4DV7B 1HWWA 2PI5A 4H0LD 2XNXA 1H0TA 1GK9A 1PPJG 2WZ7A 1WB7A 5IJ0A 4WY4B 1Q82Q 5GONA 2W6AA 3FXEA 2HVKC 1K73Q 1MG1A 3ASNC 3Q1NA 2KZIA 3F89A 2PFXA 5B5EZ 2B1IA 4QPJA 4JI8B 5JVDA 3CD6P 1AFOA 1F4HA 2WLHA 3A7OA 1L2PA 1XHZA 2NNUA 2YI8A 1OJNA 1HXKA 3AK3A 3C9IA 3H1KG 2CK3H 1OJOA 1LTSC 1FFXB 3CPWO 1L0LH 4FZ1A 4HJGH 1ZWIC 3MUDA 1FOSF 2N05A 2PI4A 1QVFU 3K06A 3A0HZ 2QJKB 4U3JA 4LFBB 3EVKA 1OACA 4PD4D 1DIPA 4TQDA 3ABKB 4E4EA 4LF8O 2LXCB 2JJ2G 3VP9A 3ZCCA 1HF9A 3IF4A 4FNUA 4FLXA 1IO4A 2X03A 1R6TA 2JS3A 5IDJA 3QO8A 1FU1A 5B1BB 4DR6B 4P30A 3H1LG 3CZSA 1SESA 2CE4A 1N73B 4DV6B 4ICGA 3B40A 3HD7C 2CTWA 4K3AA 4XDKA 2JWDA 2ATKC 3NJXA 4X1YB 2WA4A 4DUZB 4DR3O 1OVUA 3C8VA 5AW6B 3T2MA 3VQVA 3UM7A 3CCSP 1HNXB 4EV2A 4PV1C 3CCRP 5HFLA 1MABG 3I56P 1EXIA 3AE2C 1XDCA 3E2EA 4WWIA 1ENVA 3OGCC 2WW3A 4LF7B 1JM0A 1PU4A 2Z5UA 4UCRA 3RYFA 5L3EA 2CGNA 2IX7C 3J80N 2B87B 2H7HA 4ZBMA 1Q7YQ 3AG4B 2Q8VA 2YC0A 3D70A 3N2KA 1Z45A 1AJQA 3UKMA 1S76D 1IVVA 1L7KA 1BCCJ 1YGAA 1G1XB 1ZSPA 3BASA 2BCCE 1CI6A 1QCEA 1H8EG 1HUCA 5BVZA 4WBNB 2IBZG 4ZHQA 4CBCA 2HTBA 1I94B 4ZI7A 5CCHA 3O65A 4KP4A 2OIEA 1GU5A 3A2FA 3CCJP 3A3YB 1NS8A 4O4LB 3JATB 2Y4UA 1LVNA 1EM1A 3A24A 3OMIB 4OGQC 1QLNA 4DRXB 3TGUE 1NTKH 4FZ0A 4KFMA 1JCCA 4R4LA 5AW5B 2KNCB 1R34A 4MSWC 5E1QA 4ASVA 1MMXA 1NJIW 3BATA 2ZIMA 1IK9A 2BRPA 3P7KA 1NZ6A 2EIJC 3DX1A 1RSOA 3OM3B 5H5NA 2PTMA 2B89A 1SETA 4AQYO 4XE5B 5EYPB 4ABMA 4I2LC 1S72P 3KQGA 2A0LA 1VQKP 3D71A 1KMIZ 4X8AA 3QWOC 2YDEA 2AHYA 5AW7B 1X22A 4TUYA 1ZR4A 1NTMD 1T3UA 3SYAA 2IM9A 1J1DC 1K05A 2OYHC 3L9DA 3QF7A 3IAPA 2KKWA 1YJWP 4LCUC 1NKZB 2F4VO 3K25A 4QJFB 2QM8A 2PRRA 2EINC 2Y73A 4WFBV 2P7JA 2HPCB 3BCCJ 2YI9A 4IIJB 5CCGA 3ZN1A 4UB8E 2GM4A 1SQPK 1GM9A 3RL0g 1SQPH 3A0BZ 2K9JB 1PP9E 1BSMA 1E1RG 4CH3A 5IJ9A 3Q1MA 1SQBG 1X1IA 4FNQA 1QU7A 2XAJA 3OUFA 3L72G 3WFAA 5TISE 2XKMA 2YIBA 5DEDA 1F4NA 5BR8O 3CCQV 1PIXA 3K5BA 2DJVA 4JYAO 1KP3A 5IJ0B 1RQVA 1N7NA 2ZM6O 1N32B 3AEAC 4Z1VA 1C82A 5EBMC 1IJDB 2XDJA 2Q68A 1RHZB 5D5QA 4PV1D 2V1DA 1YI2V 2EX3A 2K1AA 4GKGA 2J59M 2FL4A 2X7RB 1N8RW 5H2FE 3L74E 1X4TA 2LGWA 2UXDB 4GX5A 3S3WA 2JKVA 3AECC 2CIQA 1RM1C 3TNUA 4ASWA 3SX1A 1FJGO 1NTKD 4R7CA 1SIHA 4OGQD 3H1JE 3HPLC 1NTKK 2YXRB 4DV2B 2RH0A 1B3QA 4NVPA 1JY3N 1J1DB 4OXSA 3JCUH 2EULA 1NVOA 2RDYA 1PPJE 4HNAB 1SZXA 2W0FC 1AVYA 2C9LY 3TETA 1NS0A 4F4LA 4MN4C 1DEEG 4MW3A 5KHJA 4ASUG 3H6PA 1EKMA 1VF5B 1KUQA 1FZBA 2IZ0A 2JWAA 3JAWA 3H1KE 1U96A 1YHQV 1T6AA 4DV1O 2JDIH 2AGAA 1WA8B 2WT7B 1EN6A 1X59A 1N4CA 2WMMA 2NRGA 2H8PC 4LFBO 4Y99C 4AUWA 3HI7A 1PNMA 1TUBA 4LF8B 3I3EA 1K7DA 2Q0AA 3CXCU 5KX5A 4YHHB 3T2PA 2QM4A 1PNLA 3W7XA 4H0LC 1TQWA 1L7JA 1GKFA 4DV0B 2YMKA 3AK2A 4IGGA 1HR0B 3BUQA 3L70D 3HIGA 3VD7A 4EV5A 2E5LO 1URFA 4WFAV 1F4MA 1BL8A 1Z5VA 1VPCA 2WWWA 3VOUA 3K04A 4WBNA 2ZE6A 2E76D 3G6EP 4UB8H 2XASA 1KP2A 3WIQA 3VYIA 1I5YA 2LW1A 1XL4A 2E75D 4DV7O 3W7SA 1KILE 1FKAO 1KB9I 3GHGA 5LGTA 4I0XA 2JVDA 1JY3O 2MW2B 2PAJA 4L87A 1AP6A 1NT2B 1OW8A 3SFDC 1GM8A 2QEXP 1N7LA 2WLIA 4LWSA 1VF6C 1ZRTE 2FXPA 1NI8A 2Q7HA 3NJVA 2BCCH 4TT3G 2P4KA 2YO2A 1BGYE 3I3BA 1V7VA 1QHTA 2CDYA 2QE7G 1YTZI 4MVQA 1YITP 5AW1B 4JV5O 5B5EH 4X20B 2I1JA 3H01A 2HFED 4B3SB 4RJTA 2ZE7A 1K97A 1G1IA 3CWBJ 3PHLA 3WU2Z 4MW8A 5FPOA 4B3RB 4C7NA 2OTLP 5JCOC 4I50A 3N2GB 1ULVA 1GM7A 1CB8A 2JGDB 5KAFH 2V4DA 4JI5O 5KLVE 1WRGA 3ZHVA 2K9JA 1HMWA 1OHHG 3E1F1 2OCHA 4FNTA 1SQXK 3QH9A 2N1TC 3DYMA 1VARA 3BY6A 1M9NA 3WVFA 4KXRA 2E24A 3O8ZA 1M93A 1L1FA 2C0WA 1W2BU 1K1XA 2CWVA 2OQEC 3WG7C 1M56B 1FE6A 5IWAO 3EHBB 1NS7A 1LF6A 1W5CE 1QVFO 1J1EC 2GV9A 1N7PA 3APQA 5B3SC 1MFZA 3DYPA 1Q6HA 1IFMA 1X8YA 4PD4E 4DK0A 2UU9B 1CPYA 3HTKB 4LFAO 2ZR2A 3SR2C 1SFCB 1H2GA 1MV8A 2DOSA 5ITZA 3SYQA 1H2KA 3C3TA 3THOA 1ZXGA 2AEMA 3S4AA 1L0LE 4D6TJ 3RT3C 3ABMB 1FZEA 4Y28J 3J7HA 1PS3A 1JZ3A 2WVZA 5LOVA 1RJOA 1HJ0A 3EJUA 1W7CA 1ZMEC 3SJQC 4O9BA 1P84I 3SGIA 4XFJA 1GL2B 1LGHB 2XU6A 1USEA 2GUVA 3CJHA 4NTYA 3SPCA 1AQ5A 2CAZC 1OMIA 5CA0A 3VN0A 1RKYA 1EXJA 3K5MA 1JMBA 1WMOA 3K59A 1OJPA 2DWDC 2QRXA 1ZV8A 1ZW0A 1DD4A 1JUNA 2ALWA 4LFCB 4MMHA 4WY4A 4YJ2B 2V4HA 1BCCD 2P7TC 3OGIB 3R66A 1SQPG 2JRIA 4G28B 4MVZA 4H13D 3L74G 2ETNA 2F43G 1WA8A 2X0LA 4FFBA 2WYIA 1SQBK 3AE4C 2WOHA 2QSIA 4K0KB 1PGOA 3H1JG 1HNZB 1FXKC 1J5EB 3CLQA 4BAYA 3LDEA 3LSSA 2Q7EA 4PD4H 1XNRB 1Y74B 1HWYA 1AVKA 2LGQA 3P8CE 2E2UA 3OEEG 2UUBO 3L75H 4JF7A 3SSUA 2JKPA 2ZT9B 2Y4TA 5LMUB 4P2ZA 1YTFB 2R3CA 5KLVK 3VSMA 2Q5UA 1RY3A 1S1CX 1AR5A 2YIUC 3W7UA 1M90W 2XT9A 3CRQA 5LGNA 1SQVD 5APSA 1FDMA 1LTJA 3OA7A 4PI2A 5L3DA 2WOFA 2ZR3A 3CS5A 3TSIA 4LF5O 1UI8A 4UCSA 1EFRG 5B5EE 2WW0A 4FM0A 4FNSA 2B5UA 3JSNA 1IU7A 1I8QA 1KYOF 1NTZD 1GN2A 3EQ2A 2B87A 3CMAP 5B66Z 1SIIA 4JI2O 3MGNA 1W4NA 3T2OA 3SYOA 1XOUA 5JCOA 5KAIH 1LT1A 5KJ7C 1IVXA 2HEPA 3OTOB 1YITV 2F4VB 1JY2P 1H0TB 1F4AA 1QWNA 4ZKIA 1WPBA 4JV5B 1FS0G 5GONB 4PDMA 4LFCO 1HGZA 1BCCH 4CH5A 1QWUA 3L70J 1O9GA 2J5UA 4I50B 1YI2P 2IW5A 1BT8A 2QKCA 3AG4C 1QNMA 3V5BA 3T08A 1MMUA 4AHCA 4LR3A 1FFXA 2OOVA 1K4CC 4DRXA 1IVWA 2XTAA 3DXRA 4FK5C 2FBWC 5APTA 1CW5A 3OT7A 2I8DA 2CG0A 3JYCA 4Q6GA 4FNVA 4LC1A 1IZ3A 1BGYG 2KSDA 1VQ5V 2B9BA 3K79A 2WPQA 1OCOB 3A0HE 1FZFA 3RYHA 2IH3C 4WCEV 4WY4D 5EYPA 2ZVOB 5CHXA 4ZKPA 4DCKA 4JTDB 2E42A 1JYXA 4GKJO 2X6BA 1RH5B 1SFCA 5CA3A 3IFXA 4K35A 1KQFB 3HRNA 3OW2O 3CCEP 4BTYA 4HB1A 1XILA 4TUYB 4UCOA 1DD3A 5DM6V 2CUGA 3G9RA 3JC22 2F1AA 4F6EA 3IGAC 1P84F 1VMGA 1V54C 5KLVG 4TSFG 4EFBA 2YEVA 3G71V 2Q9LA 2HPCA 1NSZA 1WMNA 1AJYA 3A8TA 3JALB 4IIJA 1F1SA 2F7OA 2IZ1A 4TLFA 4WBAA 3AE3C 5CA0B 3JD0A 2QWNB 4KTPA 3RYFB 2EZPA 2K3RA 1KD1W 1NTZH 2YS8A 1SQQH 2FMLA 1GTWA 2BRWA 1XNQO 2WCOA 3JCZA 1GD2E 3H1JH 4YJ2A 1UPGA 1L0LG 1AB3A 3L73G 1SQVH 3SXXA 3JCUZ 1AA0A 3BRTB 1VEWA 1SQXG 3D52A 2A45I 3F5WC 1K5QA 3CC7V 2M5AA 4JI1B 3S3XA 3GW6A 3UIAA 3G4SP 1H8AA 3U10A 1HR0O 2OYQA 1AVMA 1X9VA 2FFDC 4OWFA 2K88A 2O3JA 3H1LH 2R32A 1DF5A 1NKDA 3CL3D 2KNCA 3Q3DA 1Y74A 4L8JA 2Y0DA 4YIOA 3VOPA 3ABUA 3FXDA 4HYTB 3CX5E 4MVMA 1AVLA 1X79B 2Y48A 5BZBA 1SQXD 1VQ9V 5C8YB 4F6RA 2UXBO 1YJNP 1SO0A 4BZHA 5TISH 3BFRA 4JI5B 2EAEA 2IDBA 3LDDA 2KB1A 4JI7B 3D4ZA 2ZXXA 1B06A 1SQPE 3G71P 3T2QA 2F66C 3AMOA 4KUMA 1UFIA 5EC1C 1UJWB 2R5DA 3VTPC 4PA6A 2Q3EA 2YSUB 3CCUV 1L0NJ 1PP9D 5CBNA 1K4DC 1KSIA 4BZFA 3OTOO 3K5TA 2Y69C 2GUZA 4GDOA 4K8ZA 2W27A 2ZNJA 1AVOA 1FXVA 2WT7A 1Q90D 3GWOA 3D3IA 3V4WA 3HKDA 1MNGA 2E3CA 1IURA 2EADA 2IYOA 1NSXA 4GT1A 2JP3A 1JZ8A 3FD9A 3L74J 3OS7A 4O2AB 1AJNA 3FX7A 5B66E 1YJWV 1TUBB 5A1AA 3RBZA 1NTME 2XAGA 1BDCA 2XNDG 3I3DA 1XQ8A 1BE3G 3FB6C 1RE4A 2QJPC 1FC2C 2G8YA 2IU3A 4DO2A 3VQWA 3E83A 2YUAA 1AR1B 4LBEC 5AVSB 1Z56A 2A06D 1AP5A 1SNZA 1NTKE 3SPHA 1VQ9P 1JNMA 4JAVA 5JH7A 1AV1A 1RW9A 2HHHO 1R8EA 3ZMUA 1S5LE 1F51A 2DW4A 4O4IB 2WSFH 3X3XA 4PJ0H 5GTIE 2XSGA 2WTYA 4EOTA 1PPJD 1R6KA 4R4MA 5EFWB 2QWOB 3WUTA 3K0GA 3RYCB 4TV9A 2O01N 4AQYB 2ZXEB 1P7GA 1SQQG 2UUAB 2JS5A 3DXRB 3FYIB 1LURA 1HH0A 3CX5I 4WB4A 3V2QA 4JPRA 1IBKB 1FBMA 1JTHA 3UT5A 1HJBA 3D8CA 1RF1C 1SQPD 2V7QJ 4R6ZA 2Y0CA 1OJMA 4I55A 4YJ3A 2M3BA 5L3CA 1D6ZA 4IFMA 4C7RA 4YY3B 3RL0C 2OGUA 1FYJA 3WB2A 1O7DD 3BUIA 4DUVA 1JZ6A 1FS0E 4KL1A 5CB4B 1IFIA 4PA4A 2HYNA 2Q67A 4PV1B 1SQFA 3JAKB 4H37A 1NVPB 4IL6H 4LF9B 3PTZA 3E8GA 3H1IG 4C46A 1THZA 2A45G 2IH1C 4JBZA 2UUBB 3ABVC 3TJTA 1Q6UA 2CFWA 2E5TA 3CCRV 1JO5A 2AHZA 2YIAA 3ETEA 1OCCC 1SF9A 1KYOD 2F23A 3JALA 1HNWB 4G27B 4WFGA 3H1HG 3P8MC 4L75A 5AVQB 3KPEA 5AVWB 2R9RB 2MK3A 2WSFJ 1MZEA 2ZE8A 2RMKB 2IJKA 1KB9H 4IT5A 3CCVP 1N36O 2A06E 2GBOA 2F7PA 1NTKJ 2PF4E 1NHLA 2QVAA 2OIGA 4CS4A 4JI6B 2QWQB 4RWUA 1OV9A 4U7JA 1US6A 1IVSA 1SQGA 3E8HA 2OYHA 3Q5PA 5ITZB 5LYJB 4FNPA 3BUBA 2W0XA 4W80A 1USDA 2WVRA 2EIMC 3A0HH 2ZXQA 1SA0B 3GHGB 2C2AA 1JA8A 1NS4A 2CWTA 4D7TA 3VMXA 3C1LA 3IC9A 3ABLB 2IBZD 1RWGA 4FLYA 4O4HB 3NFQA 4XBFA 3ALAA 4BR6A 1JMMA 3BVXA 2ZXWC 3EJRA 1KFNA 2Z0AA 5EC2C 3IR9A 1H2MA 3T09A 1DEBA 3STLC 1SQPJ 3FFQA 1LT9C 4NPEA 2PUSA 1PGQA 3P30A 3L73E 1NGMB 5KHIA 1HM2A 1LWUA 4JZGA 2ZJSE 4R8CA 1SQXE 4X64B 2Q7CA 3CC2V 3PJSK 4LFAB 5J2UA 1AI4A 5KKZB 4O4JA 2H43A 5KAIE 1T8ZA 4AQ0A 4D7SA 4PA7A 5J2TA 4LH6A 1YTZT 5KJ7A 3IMHA 2JIZG 3N2GA 2KXPB 1M1JA 4J41A 3HKEA 4NXNB 4IHJB 2NR5A 3M9HA 1VQ7V 1H2NA 2P67A 4WFEA 1BE3J 3Q2YA 5LXTB 2PP6A 3H9VA 2RNBA 3ABMC 1BDDA 2OW6A 1MZFA 3T1YB 5KBPA 1XMOO 4UVCA 2JDIG 1XTCC 1S3JA 1AI6A 2QWRB 3ZRVA 4ZKUA 3MUDC 1QLEC 4I9WA 5JH7B 3AFJA 2WLKA 1BQZA 3C90A 4DR6O 2JKAA 4UUJC 1JQ0A 5IY5B 2XNDH 4YXDC 2OTJP 1KYOH 2Q0OC 3V2PA 2N9BA 5CCGD 1SZTA 5AW9B 4H13C 2C9NY 2VRSA 4DK1A 1NTMG 1OWAA 2KYVA 5CA1B 1SS3A 1TQSA 1GMJA 3E22A 4KJMA 3B4SA 1BE3E 2N9YB 2OW7A 1NSRA 4MVOA 3I55V 1SFCD 1V54B 2W8ZA 3CWBD 1FFTB 5BXZA 3FX0A 1R3JC 1X0TA 3HD7D 1URQA 1NTKG 1XTGB 4B3TO 4J10A 3TDKA 2XOKG 4XDLA 2VQFB 1N0JA 4DV3O 1DGSA 1SC5B 2F95B 4NPDA 2ZM6B 2OYOA 3D4YA 1GL2D 3F5HA 3VDBA 4JPZB 2BEZF 1XNQB 3JSVC 2BTOA 4TOIA 1SQQE 2IBZH 5LL6Y 3DCDA 2LQTA 2CISA 1N7RA 3STZC 3L73J 5LP6A 3WU2H 2D73A 1S4XA 4JI4O 1YCIA 2YFNA 2BTQB 4EYYQ 1Q81W 5DECA 2NZ2A 4U7NA 2Q6AA 1UI7A 5KHKA 1Q5OA 4Z1MG 3DSQA 1Z5WA 3FWLA 3MTUE 4QMAA 2ZINA 4QE9A 3B8NA 3CV5A 1YJ9P 3OE7G 3KZIH 4GYCB 1FZCA 2OCCB 4J9YB 4LF9O 2I1KA 3K5OA 3H1IE 1K33A 5LYJA 1QL1A 3QNEA 3ABKC 1T3JA 1VF5C 5KUMA 4UB8Z 2XHBA 1LXKA 2E74B 4RKUJ 1L4AD 1WN7A 3H1HE 5B1BC 2HTAA 3FWNA 1HNZO 1LXMA 5DJUB 1KC8Q 1LTAC 5D5PA 3U11A 5AVYB 3E1RA 3E7KA 5JMFA 3JD3A 2N1TB 4LNUB 2KB7P 2A06G 3T0AA 4I9QA 1KN7A 4I5SA 4TWKA 4GZRB 1N34B 2FYUD 1A2VA 5APXA 4X1KA 1RF0A 2KQXA 1M4UA 4PJ0E 5APWA 5GTIH 1W5ZA 3CZJA 1QL2A 4A7PA 1S5LH 3CMEP 4TV8B 1KU9A 1PL0A 3D36C 1R6NA 1YTFD 1QQCA 2JJ1G 1KYOE 1LTJC 4IFDK 1VF5D 3WUUA 3RYIB 2RN9A 4WF9V 3BEHA 3CMEV 1P84D 1PFIA 4NXMO 2HVJC 1FPOA 1NU1H 1PV0A 1BQ0A 4CPGA 3ZMSA 5CCHC 5A9GA 1IZNB 5TISZ 3JD2A 3SJBC 1J95A 1MMMA 4PDVA 4UCTA 1KC8W 1FZAA 1N33B 3II6A 3FB7C 3RGUA 2P10A 1FAFA 3GMAA 2P2UA 4GX0A 5KHGA 2A9HA 3O9OA 3BABA 3K58A 5BR8B 3MHSC 5AW2B 3CCQP 2R3SA 2GDSA 1JCHA 4IHJA 4EKWA 2Q73A 3KYQA 4DJGA 1VQ7P 3M0DC 1QX8A 5LGUA 3G6EV 4WFFA 2F7QA 2VQEO 2CG1A 1JR9A 5CCHD 3ETDA 3RN4A 1AJPA 3RYHB 2CIRA 3CEIA 1IQXA 1LWUC 2BSKB 3CRMA 4FLVA 3RL0D 4J80A 5APQA 3ZMVA 3LOYA 1IBMB 3BUPA 4GX2A 2YKPA 1P4RA 4OPAA 2K37A 3M0DA 1ZLLA 3MUZ1 4CH6A 1K92A 4HKZH 2YNYA 1GN4A 3MV11 5IYDO 1PX3A 2ZYGA 2LFSA 3OR6C 3E86A 5CBHA 1VQKV 2PZSA 2W6JG 3HKDB 2C10A 4Q20A 3E22B 5H2FZ 1RWCA 5AVUB 3K9SA 5LHHA 5AVXB 4D6TE 1S9KD 1NTMJ 2CH7A 3E8FA 4NR1A 3ZHUA 3W7WA 4NKGB 3NR7A 4DYLA 3JD1A 1GN6A 1HWTC 2EJ7A 4X1IA 4BZEA 2ADPA 3MIWA 1P49A 1NH2D 3B5NA 1F7YA 1VQ4V 1L4AA 1EDKA 2M7WA 3CRCA 1PPJH 4DUYO 1TQTA 2M5AB 3JCUE 2FUQA 5KTBA 4YY3O 2PYLA 4DR1O 3IAQA 4JAUA 4NB5A 3T1HO 4RUFA 1KB9E 1RFYA 2L91A 1OCCB 1S5HC 2M8RA 2EIKB 3RWRD 3L74D 4DUXA 1XHXA 4U3JB 1Z2GA 2YKQA 4KT0J 3ZDMA 4X65B 2QJYB 3J81N 3EJPA 3GHGC 1HW7A 3H32B 2W0QA 4HYOA 3BLBA 3CP1A 4DV3B 1S5LX 2V7QH 5CB4A 4JI7O 4UFCA 1V55C 2AXTZ 1BGYJ 1OCZB 1VIBA 2UU9O 1N7SD 3OMNB 1J2JB 1NTMK 3AK1A 3LIDA 1F9GA 3ZMZA 4Z1MH 3LW5H 3P3PA 3DC6A 1P7BA 1OZHA 3DGEA 4C7UA 3OUSA 1KFMA 3OD4A 1J0MA 4I4TA 3T4ZA 3QFZA 5LP6C 3ZBHA 3AEBC 1IFDA 2WQYC 1GU4A 2N74A 3AFLA 3CX5F 4DUWA 4JAAA 4LH7A 4PJ0Z 4O2AA 1GH6A 2ZNIA 4X1KB 4B3MB 5KKZC 5CJ4A 3BCCH 5GTHE 3CC2P 2FXOA 3CCLP 1H38A 4N78D 2HLDG 5JMDA 2K9YA 3CRAA 1I0HA 4NTXA 3CB2A 1Q8IA 3BVVA 1OJHA 1URQC 1K8AQ 1Y47A 1LT9B 1Y6XA 3BPZA 5L3GA 1N73C 5E79E 3K0DA 1DK1A 5KJ7D 3ZHTA 1N7OA 1SS1A 1R3LC 2CTRA 1FDIA 1AROP 1W0KG 4DV6O 3A2AA 3K5LA 4PD4I 5IYZB 1GDTA 1K3EA 4X66O 4J11A 2LO1A 3A0OA 1UIIA 2KI7B 1JZ4A 3WG7B 2PY5A 1D5AA 3R2PA 4BIOA 3RL0B 1OCOC 4AI8A 2D2CC 4QIWF 2UXBB 1H89A 2E75B 3M8AA 3RYCA 4YHHO 1QVGU 3ZHSA 5IWAB 1BZKA 2XV5A 4GKKB 1W0JG 4L73A 4N21A 3V2NA 1NOHA 4O4HA 3AE8C 1VL2A 1XEQA 2NPSD 4RUEA 1JX9A 4DV5B 3UT5B 1L0NK 4H0LB 1IX9A 1CZQA 2BOCC 1KQGB 1IFPA 4I55B 4YJ3B 3FAVB 5CN0A 1TAEA 2EZOA 2IYPA 1UG9A 3N27A 1NO4A 1GW3A 1W3YA 1MN0A 3ZJZA 2IFNA 4ZIBA 4OPHA 1NAYA 3LIEA 1LWUB 4JI8O 1H2LA 1RE3C 4YXWG 2CTPA 3JAKA 3I5DA 4OVNF 2W90A 5APVA 1QR9A 3CCUP 2A3QA 3H1JJ 1VQOP 3DDFA 1SVFA 1LR1A 3I56V 4B3TB 1XL6A 5K1XA 1HNWO 2OQQA 3HUSB 2D3OW 4Y99B 1RWHA 1PL5A 2FFDB 3X42A 2QIWA 1U7JA 1T2KC 1VQOV 3L71J 5AVZB 1VF6A 4J7JA 2QSAA 3HD7A 5CBOA 2EIKC 3Q5RA 1FZGA 2DWEC 4X62B 5FPRA 4AQRD 3EJTA 4GOFA 3P32A 1JVMA 3RK2B 2ZIOA 4PD4F 4DV4B 1UIXA 3CCMP 4TTGA 2RDCA 3BLCA 3ETGA 3B5NB 1PX4A 2E74D 1IBLB 1NKNA 4AYCA 4B86A 4HAMA 1IQYA 2OYHB 1V55B 1PD3A 2FKXA 3L35A 5IYCO 1VQ4P 1XMQO 2DYSC 3HB3B 2PGDA 2WLLB 1HN1A 1XNRO 1NTZE 1Q2NA 1SA0A 2W6BA 5TJHA 1NS1A 1VQPP 1WMPA 3M06A 4D6TG 2KK7A 4JYBA 3QO5A 1JYNA 5CA1A 1RQUA 3CD6V 4B3RO 2BE3A 2R70A 2IPPA 3SEPA 2LFRA 4J5TA 2E74C 3W68A 1M57B 1M90Q 1NSMA 1KB9D 4A5UB 1Q86Q 3SDLA 4MVRA 1OW6A 2WSEJ 1B6QA 1IDSA 4PA9A 4UCUA 5FL7G 3D6ZA 1JOYA 3L36A 1N86A 1PZQA 2X6AA 3CCLV 3AEFC 5EIBD 1LUVA 4X1YA 1Q82W 3WA3A 2RJZA 1ZOYC 3TCUA 1HDJA 2ADQB 5J2UB 1VQ8V 1HGVA 4L76A 4W7ZA 1DX7A 4UV9A 4U7OA 3ZIAG 3G6BA 3KZIZ 1WP7A 2QE7H 2QM7A 2WVXA 4LP8A 1OXZA 2CFLA 5LP6B 3ASOB 2NPSA 1HM3A 1M1JB 4IYHA 3HKEB 5KLVH 2BTQA 3ZS8C 1I08A 5KAFE 4PDLA 2LXBA 1LTIC 3H1KD 5LXTA 2N1TD 5EIBC 1Y76B 2DYSB 3ZX6A 3V2RA 1CI6B 1AILA 1LT9A 1XMOB 2L35A 4FMTA 2ILMA 2B88A 3BCCG 4ZHQB 3E8BA 1AI7A 2QGNA 5IYZA 1L4AC 1RF1A 1BE3D 2ZQ0A 1M5IA 2QJYC 2WAMA 4MS2A 3ZN0A 3JATA 4TQFA 1SQBH 4DV4O 3H1IJ 1QAKA 1EN4A 3AEIA 1NR1A 4I0XB 2UXCB 2VQEB 2KLUA 5DJTB 4YXWH 1GL2C 3N4XA 4BRYB 4GCZA 3QO7A 2F1BA 1G2CA 5IE9A 2EJRA 1H2SB 3RBXA 1Y8AA 1RSOB 2CFDA 3RVZA 2WO0A 2V7QG 3FAVA 1SQQK 3ITKA 4DR3B 1KQLA 1NTZK 3KCYA 4TV8A 5CBFA 5KLVJ 1N8RQ 1Q86W 1WP8A 3QG5A 3M91A 1QLEB 2IBZI 4X20A 2RCVA 3RRSA 3SFEC 4DR2O 2R72A 2ZAEB 2BOBC 2HKOA 3RK2D 4RQEA 1JY2O 5KMGA 4G2KA 4ZMDA 3RFRA 3L75E 2R5BA 1XUQA 2AZ2A 1K1WA 1YJ9V 1BS3A 1EDLA 1FXKB 2QJKC 4UB6Z 2WSSH 2YXHA 2CFGA 2JKEA 3T1CA 1HTLC 2M3EA 3ZRWB 2YIDA 5KA6A 4ZOLA 2WVYA 3DTUB 2WZSA 1NR7A 1JFFB 1IC2A 4J7ZA 1RPRA 3H1KH 4JI3B 3KCXA 3CRRA 4GLXA 2E2TA 2R9AA 5EBLC 1GMGA 2AEJA 3W67A 2BSKA 4PDRA 3S4CA 2DN9A 1YVWA 2P5OA 4W4KA 1VQ5P 5KA5A 4JI2B 1EGUA 3NREA 3M9BA 3OEHG 5F2VO 4NPFX 5EK0A 2BT3A 1VQNP 3BA9A 4X65O 2WLNA 2EILB 1L0NG 4PHZA 2JR8A 5LOVB 4NXNO 3BVTA 1JRQA 2QKAA 1W2BO 4H44C 2YX9A 3ASOC 3TK1A 3L37A 1Y9BA 2N04A 2QJ1A 3L73D 4LNUA 4MVUA 2KLVA 2HJDA 3ZRSA 4FM2A 4JYCA 5H6QA 3APOA 2RN0A 2EINB 4MTFA 5JWPA 5CJ0A 4BW9A 3SWFA 1NVPD 1Q3EA 4JTCB 3UO2A 3S1KA 5FLXN 2YIUB 3M0AA 3SPGA 1BE3H 2O1JA 5GW7A 1K1YA 2X6CA 4JF3A 2DYRC 1K04A 3L72J 1JB0J 1GRJA 2C0XA 2OTJV 1SQBD 3TGUD 3JAWB 3OTFA 3H1KJ 4RO0A 1KTMA 1L4AB 1G8MA 1NTZG 3AE6C 1HP8A 1TUEB 1IXMA 1SQXJ 4P9PA 4PI0A 4H33A 3KN4A 1R5SA 2NPSB 2AXTH 3GF3A 4KHPO 2WLMA 1JPXA 1EQ7A 2CK3G 3HE5A 3U1AA 2GA1A 2UXCO 4NTWA 3L75D 1Y76A 2Y0IA 5FNVA 2ITDC 1S2EA 3JSLA 1VF7A 1D5NA 5AW8B 3RVYA 3AG2B 4NXMB 3G3ZA 2P90A 4RNLA 4JI0O 1KQSU 4OH8B 3BGAA 1KECA 1IK7A 4OK2A 2Z4EA 4X62O 2H89C 1S9KE 3VD3A 1LTTC 5AVVB 4X64O 1EZJA 3P8CD 3F7YC 2QWPB 1YQ4C 1BGYH 3DX2A 2BRVX 2QDOA 3K9AA 4XA4A 2Z3YA 4I4TB 2FUTA 3B8EB 4K0KO 1FXHA 4EB6A 5AVTB 3LW5J 3X3ZA 3S4DA 2ZL8A 1NAFA 2P58A 5IT9N 1WLEA 3L73H 3WMM0 1LP1A 3K3WA 1L0ND 1PP9J 3B2EE 4LF5B 2QEXV 4DZOA 1JZ2A 3PH0A 4CZZA 1GK6A 3AE1C 5LA6A 4H44D 3BCCE 5GTHH 2UXDO 3KG2A 1TXKA 4LF4B 5GTIZ 1OCZC 4X1IB 1WAZA 3RGBA 1SFCC 4ZNCA 4D6TD 2ZFCA 1JMKC 4PELA 3RW0A 5AG2A 5A2QN 3L70G 1QR8A 4DR4B 1QVGO 3VMAA 2JGDA 3M7MX 1PM9A 3DX0A 1O9HA 3VQXA 1JYWA 4U3FE 1IXBA 2W6IG 3OJAB 3HKCB 2BCCD 5E79H 2F7RA 3HR0A 3FB8C 1A32A 2H8PD 1LOHA 5IY5C 1JFFA 1FJGB 1Q81Q 3LSQA 1NH2B 3H1LJ 3UO3A 1I94O 3A0BE 2ZE5A 1XMQB 1U57A 3TGUJ 3E80A 3OAKA 4LF6B 3H32A 3JASA 1US1A 1N0NA 3T4DA 2A79B 2H94A 4DUYB 5H6RA 5LHIA 1IFNA 2E5YA 3L71D 1QALA 2XN1A 3H1HD 1FJPA 1OW7A 3Q4HA 3W7TA 3L75G 4LF4O 3WIRA 3RSYA 3T97A 5B1AB 3G67A 2VWJA 3OAAG 1RWAA 3BVUA 2YEVB 2AW9A 1V9PA 1Y4MA 4BIZA 4LF7O 3O6QA 3PRJA 1A02F 3J7AU 2XAQA 3GWKC 1G4YB 3JARA 2NLJC 3WA2X 1N2DC 5DN6G 2JJLA 4JQ0D 1ZP0C 5L8RJ 2FFDA 1XREA 2Q3IA 3HD7B 1TQUA 2OQEA 2GSMB 1S5JA 3GG2A 3DYOA 5KHHA 1ZAUA 1LTBC 4B7EA 1N7SB 3L74H 2MKVA 2LW7A 5H2FH 3CWBH 2IJIA 2UUAO 3QG0A 4HBNA 1ROPA 4UVAA 5K1PA 1NU1K 1EBOA 3AG1B 2MJZA 1S5LZ 5APYA 3EJQA 4I6MC 2E43A 2VWKA 2CPSA 5BU5A 5APUA 5L3FA 4FM1A 1L0NE 3HE4B 1MMYA 1I7FA 3V6IA 2LR2A 2FTKA 2HP8A 2F1MA 4BZGA 2Q6QA 1LF9A 2HJFC 4LGDE 2A7WA 2WDAA 3H1LD 2ZT9C 4KHPB 2XN0A 4GKKO 3TXSA 2LKMA 3LVTA 3HKBB 1JEKA 1X1HA 5FNVB 3M9QA 1QLED 2UWJE 2E76B 1HTYA 2CFKA 1T2KD 3BVHA 1FJKA 1EZVH 3AG3B 2OARA 4EI2A 4KFDA 4D6TH 1VP7A 1YSCA 3EWKA 3WB0A 2E5LB 3NBJA 1NTMH 1JCDA 5KUKA 3FYEB 4KFFA 4BXLA 4EDFA 3AMOB 4HH2A 3RK3E 1MSDA 4B3SO 2OWOA 3MHVA 2JEEA 5CMZA 1VQMP 2J58A 4I1LA 1LJ2A 2EIJB 3DECA 1DF4A 4UCVA 2GUZB 2UXXA 2ODMA 1KZUB 4UB6H 1EDIA 3C3SA 2OTKE 3L71G 3HUSA 5E1AC 2WPDG 4FPPA 1JZ5A 1JJOA 1SKVA 4BW5A 1TVKB 2HR3A 4DV1B 3LSUA 2QR4A 2Q1KA 1VQ6V 2FYNB 4KHXA 5KLIC 4QPKA 3N9HA 5JJNB 3KHUA 1E1QG 3ZEDA 1ZR2A 2CTQA 5LA6B 2POHA 1MUUA 3CC4V 1N7QA 2RMZA 4B08A 4QNHB 1VQPV 1YBKA 2WW2A 1BHBA 2LP7A 3CX5H 2Q7GA 3ETQA 1HN0A 3AEGC 1DP0A 3CHXA 3G4SV 5LMNB 3Q5SA 3D50A 3CCJV 4MT8A
chains in the Genus database with same CATH topology
3D52A 2KIKA 1EC5A 2KI7B 2M5AA 2RKLA 1HXKA 3BUPA 1X0TA 3MZWB 2LXBA 3BVWA 4HJGH 3S1KA 4HKZH 2F7PA 1QX1A 4GODA 2QVAA 4NPDA 3FXDA 2KZJA 3BVUA 3D4YA 2LXCB 2B88A 2SPZA 2M0BA 3CZSA 1TQUA 3BUBA 3D4ZA 2B87A 2OW7A 2R44A 4EYYQ 1LT1A 5CBNA 4K3AA 2JWDA 5DJTB 1H0TB 4ASWA 4GOEA 1OVUA 1QWNA 3DDFA 2F1BA 3CV5A 3EJQA 1U7MA 1MFTA 1QWUA 3BVXA 1EDKA 3EJRA 4WWIA 1OVRA 1NVOA 2LR2A 1U7JA 1LP1B 1JM0A 1TQTA 2M5AB 5CBOA 4NPEA 1ZXGA 2B87B 1BDCA 4MN4C 3EJTA 1DEEG 1FC2C 2I8DA 1PS3A 3EJUA 2ZAEB 4GOFA 3DX2A 2KS1B 3LVTA 1EDJA 3ZDMA 5DJUB 4ZMDA 2UWJE 1HTYA 3EJPA 1R33A 2WMMA 2P58A 3BLBA 5C39A 1EDLA 1LP1A 4IOIH 4K35A 2F18A 1JMBA 4BXLA 4HB1A 3PH0A 5EFWB 1Q2NA 2QRXA 1TQWA 1ZW0A 2F1AA 3MHVA 2ALWA 1R34A 2OW6A 1BDDA 2KUBA 4ASVA 4ZNCA 3BUQA 3DX4A 2FYVA 1EDIA 4CPGA 5KBPA 2OTKE 1S3JA 3DX3A 3DX1A 2WYIA 3EJSA 2B89A 2F7OA 2HR3A 2Q1KA 3DDGA 3RGUA 3DX0A 1O7DD 3BUIA 2WYHA 2K3RA 3QWOC 3D51A 4NPFX 3CZNA 1OVVA 3BUDA 2F7RA 1HWWA 1H0TA 3BVVA 4JBZA 3BVTA 1Y47A 3FXEA 5K5GB 2F7QA 1TQSA 1SS1A 2KZIA 4KJMA 3D50A 1TQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D52 A;  2KIK A;  1EC5 A;  2KI7 B;  2M5A A;  2RKL A;  1HXK A;  3BUP A;  1X0T A;  3MZW B;  2LXB A;  3BVW A;  4HJG H;  3S1K A;  4HKZ H;  2F7P A;  1QX1 A;  4GOD A;  2QVA A;  4NPD A;  3FXD A;  2KZJ A;  3BVU A;  3D4Y A;  2LXC B;  2B88 A;  2SPZ A;  2M0B A;  3CZS A;  1TQU A;  3BUB A;  3D4Z A;  2B87 A;  2OW7 A;  2R44 A;  4EYY Q;  1LT1 A;  5CBN A;  4K3A A;  2JWD A;  5DJT B;  1H0T B;  4ASW A;  4GOE A;  1OVU A;  1QWN A;  3DDF A;  2F1B A;  3CV5 A;  3EJQ A;  1U7M A;  1MFT A;  1QWU A;  3BVX A;  1EDK A;  3EJR A;  4WWI A;  1OVR A;  1NVO A;  2LR2 A;  1U7J A;  1LP1 B;  1JM0 A;  1TQT A;  2M5A B;  5CBO A;  4NPE A;  1ZXG A;  2B87 B;  1BDC A;  4MN4 C;  3EJT A;  1DEE G;  1FC2 C;  2I8D A;  1PS3 A;  3EJU A;  2ZAE B;  4GOF A;  3DX2 A;  2KS1 B;  3LVT A;  1EDJ A;  3ZDM A;  5DJU B;  4ZMD A;  2UWJ E;  1HTY A;  3EJP A;  1R33 A;  2WMM A;  2P58 A;  3BLB A;  5C39 A;  1EDL A;  1LP1 A;  4IOI H;  4K35 A;  2F18 A;  1JMB A;  4BXL A;  4HB1 A;  3PH0 A;  5EFW B;  1Q2N A;  2QRX A;  1TQW A;  1ZW0 A;  2F1A A;  3MHV A;  2ALW A;  1R34 A;  2OW6 A;  1BDD A;  2KUB A;  4ASV A;  4ZNC A;  3BUQ A;  3DX4 A;  2FYV A;  1EDI A;  4CPG A;  5KBP A;  2OTK E;  1S3J A;  3DX3 A;  3DX1 A;  2WYI A;  3EJS A;  2B89 A;  2F7O A;  2HR3 A;  2Q1K A;  3DDG A;  3RGU A;  3DX0 A;  1O7D D;  3BUI A;  2WYH A;  2K3R A;  3QWO C;  3D51 A;  4NPF X;  3CZN A;  1OVV A;  3BUD A;  2F7R A;  1HWW A;  1H0T A;  3BVV A;  4JBZ A;  3BVT A;  1Y47 A;  3FXE A;  5K5G B;  2F7Q A;  1TQS A;  1SS1 A;  2KZI A;  4KJM A;  3D50 A;  1TQV A; 
#chains in the Genus database with same CATH topology
 4WVZ A;  3ML0 A;  4JI3 O;  2KOG A;  4GX1 A;  4DV2 O;  3S4R A;  1RF1 B;  3VDA A;  2FYU E;  1ZL8 A;  4IL6 X;  3X40 A;  1K9M Q;  2WLL A;  3CWB G;  3BVW A;  1WB8 A;  4MTG A;  1NU1 E;  2WPS A;  1QX1 A;  3CSX A;  1JJ2 U;  3L75 J;  2A45 H;  4BRY A;  1SQB J;  3H1I H;  2AXC A;  4DW0 A;  4E2L A;  1PGP A;  2QG4 A;  3JAM N;  1R3I C;  1YEW A;  3WUV A;  5AVR B;  4DR7 O;  1VQ6 P;  3TF5 A;  4OGQ B;  2SPZ A;  1AV4 A;  1NKG A;  5EZY A;  2EIL C;  2M0B A;  3ACS A;  2EIM B;  3JAS B;  1HVV A;  3VMY A;  4N23 A;  2XUM A;  2FY8 A;  4X66 B;  2R44 A;  1W2Z A;  3CCS V;  1AI5 A;  3AG1 C;  2OYI C;  4B7K A;  1VQM V;  3L70 E;  5BMV B;  3WU2 E;  4UFZ A;  1CSB A;  3L72 D;  2QA4 V;  2FB5 A;  3K57 A;  1N36 B;  1JYV A;  1NQT A;  3DC5 A;  4I7Z B;  4U3F G;  1FDO A;  1ZLZ A;  1U7M A;  1QAF A;  2WVX B;  3CI9 A;  2Z5H A;  2H88 C;  4XDJ A;  1FXK A;  2ZDI A;  3UQ8 A;  2QA4 P;  3R65 A;  3BRV B;  1QBZ A;  2Y0E A;  2G38 A;  1KKC A;  3WFV A;  1MA1 A;  5M1B A;  2KSE A;  1KIL A;  4CC5 A;  1Q43 A;  4DT0 A;  2GHY A;  2LJ2 A;  4FJC C;  4BWN A;  1S72 V;  1YJN V;  4MTO A;  3KDP B;  3CX5 D;  3SWK A;  2DYR B;  3SJC C;  2KP8 A;  4JTA B;  5JJE B;  1W6G A;  3G80 A;  4RQF A;  5KAI Z;  1G6U A;  4JI6 O;  3D3Q A;  1KIL C;  2QTS A;  2E76 C;  5LHG A;  1M56 C;  4O2B A;  3AE7 C;  3AG3 C;  3ECQ A;  3EXA A;  2Q5Z A;  4PA3 A;  2Q9I A;  2CGO A;  1KKD A;  3BVO A;  4CH4 A;  1PL4 A;  4EIJ A;  3V4Q A;  3USS A;  3HII A;  3CC7 P;  4JYY A;  3MV0 1;  1IBK O;  2XAF A;  3SJA C;  1G2C B;  1HBW A;  1GO3 F;  2DW3 A;  3CMA V;  1JY2 N;  5AW4 B;  2ZT9 D;  5C8Y A;  2HFE C;  4F6R B;  3H25 A;  1NSU A;  4RES B;  5KLV D;  4UVB A;  5C93 A;  2HOD A;  2FYU K;  2D2C B;  1M1K Q;  3D36 A;  1NYH A;  3CXH E;  2C11 A;  4FNR A;  1E5W A;  1M8O B;  3CC4 P;  1N9E A;  3HUS C;  1OVV A;  3BUD A;  3I5C A;  5LMU O;  2ZXW B;  5JJJ B;  1PV3 A;  3WB1 A;  1IFJ A;  1U97 A;  2HG5 D;  1N7S C;  1P84 E;  5HFM A;  3L72 H;  2JK5 C;  5KMG B;  3JD4 A;  1OCR C;  2QJP B;  1AR4 A;  1TQV A;  4X9Q A;  1WNS A;  2DMX A;  2QKS A;  3VD5 A;  2KIK A;  1NTZ J;  1SRY A;  1EC5 A;  1TVK A;  2E75 C;  4YPC A;  3RK3 D;  1W6C A;  1SQX H;  4FFK A;  3MZW B;  1H8H G;  3ZRW A;  1SQV G;  3OBA A;  4FIP C;  4ZOL B;  1WPX A;  3GLM A;  2YMY A;  4UB6 E;  5EBW C;  1S0V A;  1OZ0 A;  3CCE V;  1SQV J;  1B04 A;  1J5E O;  4CS2 A;  1VDF A;  3LNM B;  4DR5 B;  2KZJ A;  2WSS G;  2IJJ A;  1K9M W;  3GVM A;  1JOC A;  2KSJ A;  2D1W A;  2HG5 C;  2W6J H;  4R50 A;  3ZHQ A;  4MVS A;  1MSW D;  1AQT A;  3VMZ A;  3ASN B;  4DR7 B;  4ZI7 B;  1J0N A;  5JVD B;  1L0L J;  2P4V A;  1SP4 A;  2IFM A;  2WSE H;  4O4I A;  1ZL8 B;  1LUW A;  4EFE A;  4LF6 O;  4RAI A;  2O1K A;  3L71 E;  4FVM A;  1BSH A;  4TV9 B;  3OR7 C;  3UCS C;  1EZV I;  1M57 C;  4KFE A;  4L74 A;  4N78 E;  2HLO A;  2KS1 A;  1S77 D;  3FKS G;  3MP7 B;  2OOV C;  1DYU A;  1LTG C;  2Z5I A;  3MD0 A;  1KIL D;  1KD1 Q;  3S9O A;  4EB6 B;  1JTH B;  2XN2 A;  2FXM A;  1RE4 C;  1A02 J;  1YQ2 A;  1JOV A;  4X89 A;  2B1G A;  4JZ2 A;  4FLT A;  1BMF G;  1LP1 B;  3CXH I;  1DTO A;  2A06 H;  3BHP A;  4DR4 O;  3F5T A;  2Y9Y A;  1COW G;  3IJ4 A;  1GTO A;  3D6Y A;  1MOF A;  2PGG A;  2ZKO A;  3NTN A;  1SLQ A;  3B5N C;  3CYO A;  5BMV A;  2P06 A;  3MHH C;  4JI0 B;  1YZB A;  3X3Y A;  2FYU G;  3M99 B;  1GN3 A;  3CWB E;  1MMZ A;  3CXH D;  4EEQ A;  1NU1 G;  3VD4 A;  2UXN A;  1NU1 J;  3OB8 A;  3K08 A;  1J1E B;  3GB7 C;  3QFY A;  2Y0P A;  3BAA A;  2UUC O;  2W83 C;  4P9O A;  4DXW A;  4IOI H;  2KG7 A;  3K5N A;  1L8D A;  3HKC A;  2GTA A;  1BCC G;  2WGQ A;  3HE5 B;  3OMA B;  4JGS A;  3MWX A;  2DQ0 A;  4CS3 A;  1BHA A;  1CEZ A;  3N2K B;  1QGK B;  2Y74 A;  3VQY A;  3B5N D;  3DX4 A;  4BTX A;  4YTP C;  1WJZ A;  1YDX A;  4RO2 A;  2ZVN B;  3U59 A;  1RP3 B;  2ZQM A;  4GIF A;  4DR5 O;  3EJS A;  3KII A;  2BAS A;  2EBO A;  5L3B A;  2ITA A;  4IYI A;  3B71 A;  2ZYA A;  3LNN A;  2WYH A;  2D2C D;  3Q4H B;  5H9C A;  3D51 A;  1Y67 A;  4O2B B;  4GKJ B;  3A0B H;  4JAS A;  3BRC A;  1NSS A;  1PNK A;  5B3S B;  1CP9 A;  4BWA A;  3TNU B;  3IC7 A;  3T97 B;  1T5E A;  3PP5 A;  1ZN5 A;  3O6Q B;  1JY3 P;  1EN5 A;  4IL6 E;  2FYZ A;  2ZDI C;  3JAR B;  1M57 D;  1VQL V;  3X41 A;  5IYB O;  4MMI A;  2N1T A;  1FAV A;  2WSC J;  3S4B A;  1R5L A;  2XZR A;  3NXS A;  2IJH A;  2RKL A;  2P1J A;  1V7W A;  4X88 A;  5E79 Z;  1N7S A;  2YXY A;  1D2D A;  3RK3 B;  2VS0 A;  1KYO I;  2CQS A;  2P22 C;  4QGP A;  1OFC X;  4GOD A;  5B66 H;  1SER A;  2B9Z A;  2OYI A;  2JGU A;  2VQF O;  4O4J B;  1Q6I A;  1R3K C;  1JZ7 A;  1K73 W;  1GZL A;  2VRZ A;  4WFH A;  1E79 H;  1K8A W;  3GF7 A;  5J2T B;  3HE4 A;  1EZV G;  4FLZ A;  4GUN A;  3OW2 U;  4OX9 B;  1XBL A;  3BS6 A;  1D7M A;  5JQG A;  3RK2 C;  2AZ0 A;  1TA8 A;  3VBB A;  1K34 A;  4H44 B;  1TGO A;  2P6J A;  2RQ6 A;  3TY1 A;  2K9P A;  2Q69 A;  3ABL C;  2WW1 A;  1NBM G;  3ICX A;  3NBB A;  5GTH Z;  4NEI A;  2PNC A;  1QEX A;  1N33 O;  1D6U A;  3HKB A;  4GOE A;  3MUY 1;  2FYN C;  5KLI B;  3MPH A;  1X1J A;  1EZV D;  4DOJ A;  2WA3 A;  2UUC B;  2ITC C;  5B1A C;  1MFT A;  4U3F D;  5B1O A;  3B09 A;  1YQ3 C;  2PYJ A;  1PGJ A;  3ABT A;  3MDS A;  2AEF A;  1W2E A;  2WSC H;  1OVR A;  4WY4 C;  4J42 A;  1YHQ P;  3CXH H;  1Y66 A;  1RF0 C;  1R1B A;  3VP8 A;  3T0D A;  4DR2 B;  3QVN A;  3T1Y O;  2KS1 B;  4DW1 A;  1TU3 F;  1EDJ A;  3PN1 A;  1KBH A;  4K8X A;  1M1J C;  1G1J A;  1SQV E;  2OTL V;  3FGA D;  3QDE A;  1NH4 A;  3QTC A;  1NSV A;  1R33 A;  3I55 P;  3B8M A;  3ACT A;  5KAF Z;  1YIJ P;  5C39 A;  4W4L A;  1KV4 A;  4HNA A;  3EFF K;  2F18 A;  4CC6 A;  2O01 J;  4I7Z C;  3AED C;  1VQL P;  2YKO A;  3A0R A;  3ZHR A;  3SPI A;  2YXL A;  3SWY A;  1OCR B;  2JO1 A;  1URQ B;  3U1C A;  2Y9Z A;  1KQS O;  3H1J D;  2YO3 A;  3IFM A;  1V7X A;  2NN4 A;  2F93 B;  2L6L A;  2OCC C;  2CQT A;  2Q1F A;  4UXN A;  1H54 A;  3H1L E;  2M6Y A;  2H3O A;  2K1E A;  2YIB D;  1RE3 A;  3NMD A;  1NS2 A;  3T0B A;  1GW4 A;  1SPU A;  1YIJ V;  2QTO A;  3K03 A;  4BIU A;  4C7N B;  1BGY D;  1GAX A;  4J7K A;  3H1H H;  1MZ9 A;  3DX3 A;  3PGB A;  3P3N A;  1M7L A;  3RK3 C;  1RM1 B;  1OX3 A;  1N32 O;  2CPB A;  3TYY A;  1H88 A;  4U3F J;  1FOS E;  4JYA B;  2KG7 B;  3F7V C;  5AW0 B;  1VQN V;  2WIT A;  1N34 O;  3H1I D;  5KX5 B;  4M3L A;  1K5S A;  3VSN A;  3KZI E;  3N7N A;  3EFG A;  4FLU A;  5K5G B;  2G3A A;  3LDC A;  2YFO A;  4KTR A;  3T1H B;  2EAC A;  3L70 H;  5BY1 A;  1IBL O;  1FZC B;  2ARH A;  4AIL C;  3IN6 A;  3SYC A;  3HTK A;  2GTS A;  1M1K W;  1IBM O;  1PKX A;  4QE7 A;  2BCC G;  4TT3 H;  4LLH A;  3KXD A;  1PP9 H;  3KKY A;  2O01 H;  1N73 A;  3A5T A;  1VQ8 P;  1ZUQ A;  4UV8 A;  2IBZ E;  4B3M O;  2JEU A;  1DH3 A;  1DLB A;  3B77 A;  2O57 A;  3BA8 A;  1KOR A;  1BSN A;  4HZ3 A;  2XHN A;  2BCC J;  1YF2 A;  1BCC E;  4H13 B;  5CCG C;  3X2Q B;  3H1H J;  3CJH B;  3L4F A;  5LBQ A;  2WLI B;  1CXZ B;  4LWS B;  1TU5 A;  3SPJ A;  3CPW U;  3TGU G;  1L0L D;  3BCC D;  4OX9 O;  3R4Y A;  1L0L K;  2E22 A;  3VDC A;  2BEQ D;  4U3F H;  2FYU H;  1ZX3 A;  1XI1 A;  2WPV B;  4OK4 A;  4YIP A;  3L71 H;  2XAH A;  3RYI A;  4FLW A;  4DUZ O;  2IU0 A;  5B1N A;  5CMU A;  4IFF A;  4J9Z B;  3E35 A;  3AG2 C;  5LMN O;  4OJZ A;  3ZRX A;  2OYI B;  1SQV K;  1LNQ A;  3E1I A;  1ORQ C;  3TGU H;  1F23 A;  4FFB B;  2YXQ B;  4DV5 O;  1IVU A;  2EAB A;  1KB9 F;  4O4L A;  5JQG B;  1MKM A;  3VD9 A;  1Q7Y W;  1YXB A;  1WT6 A;  3CCM V;  2GUS A;  1W59 A;  4DR1 B;  2NPS C;  3X2Q C;  2OT5 A;  1FZC C;  2ZCE A;  1SQQ J;  3PLN A;  5AW3 B;  3U0Z A;  3E7J A;  4BTW A;  4N6J A;  2Q4P A;  4JI1 O;  3CCV V;  3SYP A;  1ZTE A;  1PP9 G;  4W7Y A;  1RPO A;  2WLJ A;  3IAO A;  3AE5 C;  2JEX A;  2Y69 B;  5J9P C;  1SQB E;  2DQ3 A;  3L72 E;  1P84 H;  2CWU A;  1GK4 A;  3MI6 A;  3CXH F;  5EZY B;  1HMU A;  2HOD B;  1NU1 D;  1FD9 A;  1HNX O;  1SQQ D;  1WMK A;  4N3Y B;  2HHH B;  3IAY A;  2FYU J;  1YYC A;  3AEE C;  2E2V A;  2DE0 X;  3OFN G;  1OIP A;  3LUT B;  3TXQ A;  2R9I A;  4MTX A;  1EZV E;  1URQ D;  2ZYD A;  1NJI Q;  1LTJ B;  3AG7 A;  2FKW B;  4DV0 O;  3ZMT A;  1ZRT D;  2KUB A;  4IL6 Z;  1I5X A;  2FYV A;  5BU8 B;  5CBG A;  1RWF A;  2YIC A;  3CE2 A;  3T0U A;  4NYK A;  1GL2 A;  3AE9 C;  3MAQ A;  3DDG A;  3E89 A;  1M56 D;  4Z2W A;  1D6Y A;  4JI4 B;  2AXT E;  2CH7 B;  1NWQ A;  5IJ9 B;  2L5G B;  2WPR A;  1E79 G;  3CZN A;  1R73 A;  2ZD9 A;  3FB5 C;  1KIL B;  1L0N H;  4DV7 B;  1HWW A;  2PI5 A;  4H0L D;  2XNX A;  1H0T A;  1GK9 A;  1PPJ G;  2WZ7 A;  1WB7 A;  5IJ0 A;  4WY4 B;  1Q82 Q;  5GON A;  2W6A A;  3FXE A;  2HVK C;  1K73 Q;  1MG1 A;  3ASN C;  3Q1N A;  2KZI A;  3F89 A;  2PFX A;  5B5E Z;  2B1I A;  4QPJ A;  4JI8 B;  5JVD A;  3CD6 P;  1AFO A;  1F4H A;  2WLH A;  3A7O A;  1L2P A;  1XHZ A;  2NNU A;  2YI8 A;  1OJN A;  1HXK A;  3AK3 A;  3C9I A;  3H1K G;  2CK3 H;  1OJO A;  1LTS C;  1FFX B;  3CPW O;  1L0L H;  4FZ1 A;  4HJG H;  1ZWI C;  3MUD A;  1FOS F;  2N05 A;  2PI4 A;  1QVF U;  3K06 A;  3A0H Z;  2QJK B;  4U3J A;  4LFB B;  3EVK A;  1OAC A;  4PD4 D;  1DIP A;  4TQD A;  3ABK B;  4E4E A;  4LF8 O;  2LXC B;  2JJ2 G;  3VP9 A;  3ZCC A;  1HF9 A;  3IF4 A;  4FNU A;  4FLX A;  1IO4 A;  2X03 A;  1R6T A;  2JS3 A;  5IDJ A;  3QO8 A;  1FU1 A;  5B1B B;  4DR6 B;  4P30 A;  3H1L G;  3CZS A;  1SES A;  2CE4 A;  1N73 B;  4DV6 B;  4ICG A;  3B40 A;  3HD7 C;  2CTW A;  4K3A A;  4XDK A;  2JWD A;  2ATK C;  3NJX A;  4X1Y B;  2WA4 A;  4DUZ B;  4DR3 O;  1OVU A;  3C8V A;  5AW6 B;  3T2M A;  3VQV A;  3UM7 A;  3CCS P;  1HNX B;  4EV2 A;  4PV1 C;  3CCR P;  5HFL A;  1MAB G;  3I56 P;  1EXI A;  3AE2 C;  1XDC A;  3E2E A;  4WWI A;  1ENV A;  3OGC C;  2WW3 A;  4LF7 B;  1JM0 A;  1PU4 A;  2Z5U A;  4UCR A;  3RYF A;  5L3E A;  2CGN A;  2IX7 C;  3J80 N;  2B87 B;  2H7H A;  4ZBM A;  1Q7Y Q;  3AG4 B;  2Q8V A;  2YC0 A;  3D70 A;  3N2K A;  1Z45 A;  1AJQ A;  3UKM A;  1S76 D;  1IVV A;  1L7K A;  1BCC J;  1YGA A;  1G1X B;  1ZSP A;  3BAS A;  2BCC E;  1CI6 A;  1QCE A;  1H8E G;  1HUC A;  5BVZ A;  4WBN B;  2IBZ G;  4ZHQ A;  4CBC A;  2HTB A;  1I94 B;  4ZI7 A;  5CCH A;  3O65 A;  4KP4 A;  2OIE A;  1GU5 A;  3A2F A;  3CCJ P;  3A3Y B;  1NS8 A;  4O4L B;  3JAT B;  2Y4U A;  1LVN A;  1EM1 A;  3A24 A;  3OMI B;  4OGQ C;  1QLN A;  4DRX B;  3TGU E;  1NTK H;  4FZ0 A;  4KFM A;  1JCC A;  4R4L A;  5AW5 B;  2KNC B;  1R34 A;  4MSW C;  5E1Q A;  4ASV A;  1MMX A;  1NJI W;  3BAT A;  2ZIM A;  1IK9 A;  2BRP A;  3P7K A;  1NZ6 A;  2EIJ C;  3DX1 A;  1RSO A;  3OM3 B;  5H5N A;  2PTM A;  2B89 A;  1SET A;  4AQY O;  4XE5 B;  5EYP B;  4ABM A;  4I2L C;  1S72 P;  3KQG A;  2A0L A;  1VQK P;  3D71 A;  1KMI Z;  4X8A A;  3QWO C;  2YDE A;  2AHY A;  5AW7 B;  1X22 A;  4TUY A;  1ZR4 A;  1NTM D;  1T3U A;  3SYA A;  2IM9 A;  1J1D C;  1K05 A;  2OYH C;  3L9D A;  3QF7 A;  3IAP A;  2KKW A;  1YJW P;  4LCU C;  1NKZ B;  2F4V O;  3K25 A;  4QJF B;  2QM8 A;  2PRR A;  2EIN C;  2Y73 A;  4WFB V;  2P7J A;  2HPC B;  3BCC J;  2YI9 A;  4IIJ B;  5CCG A;  3ZN1 A;  4UB8 E;  2GM4 A;  1SQP K;  1GM9 A;  3RL0 g;  1SQP H;  3A0B Z;  2K9J B;  1PP9 E;  1BSM A;  1E1R G;  4CH3 A;  5IJ9 A;  3Q1M A;  1SQB G;  1X1I A;  4FNQ A;  1QU7 A;  2XAJ A;  3OUF A;  3L72 G;  3WFA A;  5TIS E;  2XKM A;  2YIB A;  5DED A;  1F4N A;  5BR8 O;  3CCQ V;  1PIX A;  3K5B A;  2DJV A;  4JYA O;  1KP3 A;  5IJ0 B;  1RQV A;  1N7N A;  2ZM6 O;  1N32 B;  3AEA C;  4Z1V A;  1C82 A;  5EBM C;  1IJD B;  2XDJ A;  2Q68 A;  1RHZ B;  5D5Q A;  4PV1 D;  2V1D A;  1YI2 V;  2EX3 A;  2K1A A;  4GKG A;  2J59 M;  2FL4 A;  2X7R B;  1N8R W;  5H2F E;  3L74 E;  1X4T A;  2LGW A;  2UXD B;  4GX5 A;  3S3W A;  2JKV A;  3AEC C;  2CIQ A;  1RM1 C;  3TNU A;  4ASW A;  3SX1 A;  1FJG O;  1NTK D;  4R7C A;  1SIH A;  4OGQ D;  3H1J E;  3HPL C;  1NTK K;  2YXR B;  4DV2 B;  2RH0 A;  1B3Q A;  4NVP A;  1JY3 N;  1J1D B;  4OXS A;  3JCU H;  2EUL A;  1NVO A;  2RDY A;  1PPJ E;  4HNA B;  1SZX A;  2W0F C;  1AVY A;  2C9L Y;  3TET A;  1NS0 A;  4F4L A;  4MN4 C;  1DEE G;  4MW3 A;  5KHJ A;  4ASU G;  3H6P A;  1EKM A;  1VF5 B;  1KUQ A;  1FZB A;  2IZ0 A;  2JWA A;  3JAW A;  3H1K E;  1U96 A;  1YHQ V;  1T6A A;  4DV1 O;  2JDI H;  2AGA A;  1WA8 B;  2WT7 B;  1EN6 A;  1X59 A;  1N4C A;  2WMM A;  2NRG A;  2H8P C;  4LFB O;  4Y99 C;  4AUW A;  3HI7 A;  1PNM A;  1TUB A;  4LF8 B;  3I3E A;  1K7D A;  2Q0A A;  3CXC U;  5KX5 A;  4YHH B;  3T2P A;  2QM4 A;  1PNL A;  3W7X A;  4H0L C;  1TQW A;  1L7J A;  1GKF A;  4DV0 B;  2YMK A;  3AK2 A;  4IGG A;  1HR0 B;  3BUQ A;  3L70 D;  3HIG A;  3VD7 A;  4EV5 A;  2E5L O;  1URF A;  4WFA V;  1F4M A;  1BL8 A;  1Z5V A;  1VPC A;  2WWW A;  3VOU A;  3K04 A;  4WBN A;  2ZE6 A;  2E76 D;  3G6E P;  4UB8 H;  2XAS A;  1KP2 A;  3WIQ A;  3VYI A;  1I5Y A;  2LW1 A;  1XL4 A;  2E75 D;  4DV7 O;  3W7S A;  1KIL E;  1FKA O;  1KB9 I;  3GHG A;  5LGT A;  4I0X A;  2JVD A;  1JY3 O;  2MW2 B;  2PAJ A;  4L87 A;  1AP6 A;  1NT2 B;  1OW8 A;  3SFD C;  1GM8 A;  2QEX P;  1N7L A;  2WLI A;  4LWS A;  1VF6 C;  1ZRT E;  2FXP A;  1NI8 A;  2Q7H A;  3NJV A;  2BCC H;  4TT3 G;  2P4K A;  2YO2 A;  1BGY E;  3I3B A;  1V7V A;  1QHT A;  2CDY A;  2QE7 G;  1YTZ I;  4MVQ A;  1YIT P;  5AW1 B;  4JV5 O;  5B5E H;  4X20 B;  2I1J A;  3H01 A;  2HFE D;  4B3S B;  4RJT A;  2ZE7 A;  1K97 A;  1G1I A;  3CWB J;  3PHL A;  3WU2 Z;  4MW8 A;  5FPO A;  4B3R B;  4C7N A;  2OTL P;  5JCO C;  4I50 A;  3N2G B;  1ULV A;  1GM7 A;  1CB8 A;  2JGD B;  5KAF H;  2V4D A;  4JI5 O;  5KLV E;  1WRG A;  3ZHV A;  2K9J A;  1HMW A;  1OHH G;  3E1F 1;  2OCH A;  4FNT A;  1SQX K;  3QH9 A;  2N1T C;  3DYM A;  1VAR A;  3BY6 A;  1M9N A;  3WVF A;  4KXR A;  2E24 A;  3O8Z A;  1M93 A;  1L1F A;  2C0W A;  1W2B U;  1K1X A;  2CWV A;  2OQE C;  3WG7 C;  1M56 B;  1FE6 A;  5IWA O;  3EHB B;  1NS7 A;  1LF6 A;  1W5C E;  1QVF O;  1J1E C;  2GV9 A;  1N7P A;  3APQ A;  5B3S C;  1MFZ A;  3DYP A;  1Q6H A;  1IFM A;  1X8Y A;  4PD4 E;  4DK0 A;  2UU9 B;  1CPY A;  3HTK B;  4LFA O;  2ZR2 A;  3SR2 C;  1SFC B;  1H2G A;  1MV8 A;  2DOS A;  5ITZ A;  3SYQ A;  1H2K A;  3C3T A;  3THO A;  1ZXG A;  2AEM A;  3S4A A;  1L0L E;  4D6T J;  3RT3 C;  3ABM B;  1FZE A;  4Y28 J;  3J7H A;  1PS3 A;  1JZ3 A;  2WVZ A;  5LOV A;  1RJO A;  1HJ0 A;  3EJU A;  1W7C A;  1ZME C;  3SJQ C;  4O9B A;  1P84 I;  3SGI A;  4XFJ A;  1GL2 B;  1LGH B;  2XU6 A;  1USE A;  2GUV A;  3CJH A;  4NTY A;  3SPC A;  1AQ5 A;  2CAZ C;  1OMI A;  5CA0 A;  3VN0 A;  1RKY A;  1EXJ A;  3K5M A;  1JMB A;  1WMO A;  3K59 A;  1OJP A;  2DWD C;  2QRX A;  1ZV8 A;  1ZW0 A;  1DD4 A;  1JUN A;  2ALW A;  4LFC B;  4MMH A;  4WY4 A;  4YJ2 B;  2V4H A;  1BCC D;  2P7T C;  3OGI B;  3R66 A;  1SQP G;  2JRI A;  4G28 B;  4MVZ A;  4H13 D;  3L74 G;  2ETN A;  2F43 G;  1WA8 A;  2X0L A;  4FFB A;  2WYI A;  1SQB K;  3AE4 C;  2WOH A;  2QSI A;  4K0K B;  1PGO A;  3H1J G;  1HNZ B;  1FXK C;  1J5E B;  3CLQ A;  4BAY A;  3LDE A;  3LSS A;  2Q7E A;  4PD4 H;  1XNR B;  1Y74 B;  1HWY A;  1AVK A;  2LGQ A;  3P8C E;  2E2U A;  3OEE G;  2UUB O;  3L75 H;  4JF7 A;  3SSU A;  2JKP A;  2ZT9 B;  2Y4T A;  5LMU B;  4P2Z A;  1YTF B;  2R3C A;  5KLV K;  3VSM A;  2Q5U A;  1RY3 A;  1S1C X;  1AR5 A;  2YIU C;  3W7U A;  1M90 W;  2XT9 A;  3CRQ A;  5LGN A;  1SQV D;  5APS A;  1FDM A;  1LTJ A;  3OA7 A;  4PI2 A;  5L3D A;  2WOF A;  2ZR3 A;  3CS5 A;  3TSI A;  4LF5 O;  1UI8 A;  4UCS A;  1EFR G;  5B5E E;  2WW0 A;  4FM0 A;  4FNS A;  2B5U A;  3JSN A;  1IU7 A;  1I8Q A;  1KYO F;  1NTZ D;  1GN2 A;  3EQ2 A;  2B87 A;  3CMA P;  5B66 Z;  1SII A;  4JI2 O;  3MGN A;  1W4N A;  3T2O A;  3SYO A;  1XOU A;  5JCO A;  5KAI H;  1LT1 A;  5KJ7 C;  1IVX A;  2HEP A;  3OTO B;  1YIT V;  2F4V B;  1JY2 P;  1H0T B;  1F4A A;  1QWN A;  4ZKI A;  1WPB A;  4JV5 B;  1FS0 G;  5GON B;  4PDM A;  4LFC O;  1HGZ A;  1BCC H;  4CH5 A;  1QWU A;  3L70 J;  1O9G A;  2J5U A;  4I50 B;  1YI2 P;  2IW5 A;  1BT8 A;  2QKC A;  3AG4 C;  1QNM A;  3V5B A;  3T08 A;  1MMU A;  4AHC A;  4LR3 A;  1FFX A;  2OOV A;  1K4C C;  4DRX A;  1IVW A;  2XTA A;  3DXR A;  4FK5 C;  2FBW C;  5APT A;  1CW5 A;  3OT7 A;  2I8D A;  2CG0 A;  3JYC A;  4Q6G A;  4FNV A;  4LC1 A;  1IZ3 A;  1BGY G;  2KSD A;  1VQ5 V;  2B9B A;  3K79 A;  2WPQ A;  1OCO B;  3A0H E;  1FZF A;  3RYH A;  2IH3 C;  4WCE V;  4WY4 D;  5EYP A;  2ZVO B;  5CHX A;  4ZKP A;  4DCK A;  4JTD B;  2E42 A;  1JYX A;  4GKJ O;  2X6B A;  1RH5 B;  1SFC A;  5CA3 A;  3IFX A;  4K35 A;  1KQF B;  3HRN A;  3OW2 O;  3CCE P;  4BTY A;  4HB1 A;  1XIL A;  4TUY B;  4UCO A;  1DD3 A;  5DM6 V;  2CUG A;  3G9R A;  3JC2 2;  2F1A A;  4F6E A;  3IGA C;  1P84 F;  1VMG A;  1V54 C;  5KLV G;  4TSF G;  4EFB A;  2YEV A;  3G71 V;  2Q9L A;  2HPC A;  1NSZ A;  1WMN A;  1AJY A;  3A8T A;  3JAL B;  4IIJ A;  1F1S A;  2F7O A;  2IZ1 A;  4TLF A;  4WBA A;  3AE3 C;  5CA0 B;  3JD0 A;  2QWN B;  4KTP A;  3RYF B;  2EZP A;  2K3R A;  1KD1 W;  1NTZ H;  2YS8 A;  1SQQ H;  2FML A;  1GTW A;  2BRW A;  1XNQ O;  2WCO A;  3JCZ A;  1GD2 E;  3H1J H;  4YJ2 A;  1UPG A;  1L0L G;  1AB3 A;  3L73 G;  1SQV H;  3SXX A;  3JCU Z;  1AA0 A;  3BRT B;  1VEW A;  1SQX G;  3D52 A;  2A45 I;  3F5W C;  1K5Q A;  3CC7 V;  2M5A A;  4JI1 B;  3S3X A;  3GW6 A;  3UIA A;  3G4S P;  1H8A A;  3U10 A;  1HR0 O;  2OYQ A;  1AVM A;  1X9V A;  2FFD C;  4OWF A;  2K88 A;  2O3J A;  3H1L H;  2R32 A;  1DF5 A;  1NKD A;  3CL3 D;  2KNC A;  3Q3D A;  1Y74 A;  4L8J A;  2Y0D A;  4YIO A;  3VOP A;  3ABU A;  3FXD A;  4HYT B;  3CX5 E;  4MVM A;  1AVL A;  1X79 B;  2Y48 A;  5BZB A;  1SQX D;  1VQ9 V;  5C8Y B;  4F6R A;  2UXB O;  1YJN P;  1SO0 A;  4BZH A;  5TIS H;  3BFR A;  4JI5 B;  2EAE A;  2IDB A;  3LDD A;  2KB1 A;  4JI7 B;  3D4Z A;  2ZXX A;  1B06 A;  1SQP E;  3G71 P;  3T2Q A;  2F66 C;  3AMO A;  4KUM A;  1UFI A;  5EC1 C;  1UJW B;  2R5D A;  3VTP C;  4PA6 A;  2Q3E A;  2YSU B;  3CCU V;  1L0N J;  1PP9 D;  5CBN A;  1K4D C;  1KSI A;  4BZF A;  3OTO O;  3K5T A;  2Y69 C;  2GUZ A;  4GDO A;  4K8Z A;  2W27 A;  2ZNJ A;  1AVO A;  1FXV A;  2WT7 A;  1Q90 D;  3GWO A;  3D3I A;  3V4W A;  3HKD A;  1MNG A;  2E3C A;  1IUR A;  2EAD A;  2IYO A;  1NSX A;  4GT1 A;  2JP3 A;  1JZ8 A;  3FD9 A;  3L74 J;  3OS7 A;  4O2A B;  1AJN A;  3FX7 A;  5B66 E;  1YJW V;  1TUB B;  5A1A A;  3RBZ A;  1NTM E;  2XAG A;  1BDC A;  2XND G;  3I3D A;  1XQ8 A;  1BE3 G;  3FB6 C;  1RE4 A;  2QJP C;  1FC2 C;  2G8Y A;  2IU3 A;  4DO2 A;  3VQW A;  3E83 A;  2YUA A;  1AR1 B;  4LBE C;  5AVS B;  1Z56 A;  2A06 D;  1AP5 A;  1SNZ A;  1NTK E;  3SPH A;  1VQ9 P;  1JNM A;  4JAV A;  5JH7 A;  1AV1 A;  1RW9 A;  2HHH O;  1R8E A;  3ZMU A;  1S5L E;  1F51 A;  2DW4 A;  4O4I B;  2WSF H;  3X3X A;  4PJ0 H;  5GTI E;  2XSG A;  2WTY A;  4EOT A;  1PPJ D;  1R6K A;  4R4M A;  5EFW B;  2QWO B;  3WUT A;  3K0G A;  3RYC B;  4TV9 A;  2O01 N;  4AQY B;  2ZXE B;  1P7G A;  1SQQ G;  2UUA B;  2JS5 A;  3DXR B;  3FYI B;  1LUR A;  1HH0 A;  3CX5 I;  4WB4 A;  3V2Q A;  4JPR A;  1IBK B;  1FBM A;  1JTH A;  3UT5 A;  1HJB A;  3D8C A;  1RF1 C;  1SQP D;  2V7Q J;  4R6Z A;  2Y0C A;  1OJM A;  4I55 A;  4YJ3 A;  2M3B A;  5L3C A;  1D6Z A;  4IFM A;  4C7R A;  4YY3 B;  3RL0 C;  2OGU A;  1FYJ A;  3WB2 A;  1O7D D;  3BUI A;  4DUV A;  1JZ6 A;  1FS0 E;  4KL1 A;  5CB4 B;  1IFI A;  4PA4 A;  2HYN A;  2Q67 A;  4PV1 B;  1SQF A;  3JAK B;  4H37 A;  1NVP B;  4IL6 H;  4LF9 B;  3PTZ A;  3E8G A;  3H1I G;  4C46 A;  1THZ A;  2A45 G;  2IH1 C;  4JBZ A;  2UUB B;  3ABV C;  3TJT A;  1Q6U A;  2CFW A;  2E5T A;  3CCR V;  1JO5 A;  2AHZ A;  2YIA A;  3ETE A;  1OCC C;  1SF9 A;  1KYO D;  2F23 A;  3JAL A;  1HNW B;  4G27 B;  4WFG A;  3H1H G;  3P8M C;  4L75 A;  5AVQ B;  3KPE A;  5AVW B;  2R9R B;  2MK3 A;  2WSF J;  1MZE A;  2ZE8 A;  2RMK B;  2IJK A;  1KB9 H;  4IT5 A;  3CCV P;  1N36 O;  2A06 E;  2GBO A;  2F7P A;  1NTK J;  2PF4 E;  1NHL A;  2QVA A;  2OIG A;  4CS4 A;  4JI6 B;  2QWQ B;  4RWU A;  1OV9 A;  4U7J A;  1US6 A;  1IVS A;  1SQG A;  3E8H A;  2OYH A;  3Q5P A;  5ITZ B;  5LYJ B;  4FNP A;  3BUB A;  2W0X A;  4W80 A;  1USD A;  2WVR A;  2EIM C;  3A0H H;  2ZXQ A;  1SA0 B;  3GHG B;  2C2A A;  1JA8 A;  1NS4 A;  2CWT A;  4D7T A;  3VMX A;  3C1L A;  3IC9 A;  3ABL B;  2IBZ D;  1RWG A;  4FLY A;  4O4H B;  3NFQ A;  4XBF A;  3ALA A;  4BR6 A;  1JMM A;  3BVX A;  2ZXW C;  3EJR A;  1KFN A;  2Z0A A;  5EC2 C;  3IR9 A;  1H2M A;  3T09 A;  1DEB A;  3STL C;  1SQP J;  3FFQ A;  1LT9 C;  4NPE A;  2PUS A;  1PGQ A;  3P30 A;  3L73 E;  1NGM B;  5KHI A;  1HM2 A;  1LWU A;  4JZG A;  2ZJS E;  4R8C A;  1SQX E;  4X64 B;  2Q7C A;  3CC2 V;  3PJS K;  4LFA B;  5J2U A;  1AI4 A;  5KKZ B;  4O4J A;  2H43 A;  5KAI E;  1T8Z A;  4AQ0 A;  4D7S A;  4PA7 A;  5J2T A;  4LH6 A;  1YTZ T;  5KJ7 A;  3IMH A;  2JIZ G;  3N2G A;  2KXP B;  1M1J A;  4J41 A;  3HKE A;  4NXN B;  4IHJ B;  2NR5 A;  3M9H A;  1VQ7 V;  1H2N A;  2P67 A;  4WFE A;  1BE3 J;  3Q2Y A;  5LXT B;  2PP6 A;  3H9V A;  2RNB A;  3ABM C;  1BDD A;  2OW6 A;  1MZF A;  3T1Y B;  5KBP A;  1XMO O;  4UVC A;  2JDI G;  1XTC C;  1S3J A;  1AI6 A;  2QWR B;  3ZRV A;  4ZKU A;  3MUD C;  1QLE C;  4I9W A;  5JH7 B;  3AFJ A;  2WLK A;  1BQZ A;  3C90 A;  4DR6 O;  2JKA A;  4UUJ C;  1JQ0 A;  5IY5 B;  2XND H;  4YXD C;  2OTJ P;  1KYO H;  2Q0O C;  3V2P A;  2N9B A;  5CCG D;  1SZT A;  5AW9 B;  4H13 C;  2C9N Y;  2VRS A;  4DK1 A;  1NTM G;  1OWA A;  2KYV A;  5CA1 B;  1SS3 A;  1TQS A;  1GMJ A;  3E22 A;  4KJM A;  3B4S A;  1BE3 E;  2N9Y B;  2OW7 A;  1NSR A;  4MVO A;  3I55 V;  1SFC D;  1V54 B;  2W8Z A;  3CWB D;  1FFT B;  5BXZ A;  3FX0 A;  1R3J C;  1X0T A;  3HD7 D;  1URQ A;  1NTK G;  1XTG B;  4B3T O;  4J10 A;  3TDK A;  2XOK G;  4XDL A;  2VQF B;  1N0J A;  4DV3 O;  1DGS A;  1SC5 B;  2F95 B;  4NPD A;  2ZM6 B;  2OYO A;  3D4Y A;  1GL2 D;  3F5H A;  3VDB A;  4JPZ B;  2BEZ F;  1XNQ B;  3JSV C;  2BTO A;  4TOI A;  1SQQ E;  2IBZ H;  5LL6 Y;  3DCD A;  2LQT A;  2CIS A;  1N7R A;  3STZ C;  3L73 J;  5LP6 A;  3WU2 H;  2D73 A;  1S4X A;  4JI4 O;  1YCI A;  2YFN A;  2BTQ B;  4EYY Q;  1Q81 W;  5DEC A;  2NZ2 A;  4U7N A;  2Q6A A;  1UI7 A;  5KHK A;  1Q5O A;  4Z1M G;  3DSQ A;  1Z5W A;  3FWL A;  3MTU E;  4QMA A;  2ZIN A;  4QE9 A;  3B8N A;  3CV5 A;  1YJ9 P;  3OE7 G;  3KZI H;  4GYC B;  1FZC A;  2OCC B;  4J9Y B;  4LF9 O;  2I1K A;  3K5O A;  3H1I E;  1K33 A;  5LYJ A;  1QL1 A;  3QNE A;  3ABK C;  1T3J A;  1VF5 C;  5KUM A;  4UB8 Z;  2XHB A;  1LXK A;  2E74 B;  4RKU J;  1L4A D;  1WN7 A;  3H1H E;  5B1B C;  2HTA A;  3FWN A;  1HNZ O;  1LXM A;  5DJU B;  1KC8 Q;  1LTA C;  5D5P A;  3U11 A;  5AVY B;  3E1R A;  3E7K A;  5JMF A;  3JD3 A;  2N1T B;  4LNU B;  2KB7 P;  2A06 G;  3T0A A;  4I9Q A;  1KN7 A;  4I5S A;  4TWK A;  4GZR B;  1N34 B;  2FYU D;  1A2V A;  5APX A;  4X1K A;  1RF0 A;  2KQX A;  1M4U A;  4PJ0 E;  5APW A;  5GTI H;  1W5Z A;  3CZJ A;  1QL2 A;  4A7P A;  1S5L H;  3CME P;  4TV8 B;  1KU9 A;  1PL0 A;  3D36 C;  1R6N A;  1YTF D;  1QQC A;  2JJ1 G;  1KYO E;  1LTJ C;  4IFD K;  1VF5 D;  3WUU A;  3RYI B;  2RN9 A;  4WF9 V;  3BEH A;  3CME V;  1P84 D;  1PFI A;  4NXM O;  2HVJ C;  1FPO A;  1NU1 H;  1PV0 A;  1BQ0 A;  4CPG A;  3ZMS A;  5CCH C;  5A9G A;  1IZN B;  5TIS Z;  3JD2 A;  3SJB C;  1J95 A;  1MMM A;  4PDV A;  4UCT A;  1KC8 W;  1FZA A;  1N33 B;  3II6 A;  3FB7 C;  3RGU A;  2P10 A;  1FAF A;  3GMA A;  2P2U A;  4GX0 A;  5KHG A;  2A9H A;  3O9O A;  3BAB A;  3K58 A;  5BR8 B;  3MHS C;  5AW2 B;  3CCQ P;  2R3S A;  2GDS A;  1JCH A;  4IHJ A;  4EKW A;  2Q73 A;  3KYQ A;  4DJG A;  1VQ7 P;  3M0D C;  1QX8 A;  5LGU A;  3G6E V;  4WFF A;  2F7Q A;  2VQE O;  2CG1 A;  1JR9 A;  5CCH D;  3ETD A;  3RN4 A;  1AJP A;  3RYH B;  2CIR A;  3CEI A;  1IQX A;  1LWU C;  2BSK B;  3CRM A;  4FLV A;  3RL0 D;  4J80 A;  5APQ A;  3ZMV A;  3LOY A;  1IBM B;  3BUP A;  4GX2 A;  2YKP A;  1P4R A;  4OPA A;  2K37 A;  3M0D A;  1ZLL A;  3MUZ 1;  4CH6 A;  1K92 A;  4HKZ H;  2YNY A;  1GN4 A;  3MV1 1;  5IYD O;  1PX3 A;  2ZYG A;  2LFS A;  3OR6 C;  3E86 A;  5CBH A;  1VQK V;  2PZS A;  2W6J G;  3HKD B;  2C10 A;  4Q20 A;  3E22 B;  5H2F Z;  1RWC A;  5AVU B;  3K9S A;  5LHH A;  5AVX B;  4D6T E;  1S9K D;  1NTM J;  2CH7 A;  3E8F A;  4NR1 A;  3ZHU A;  3W7W A;  4NKG B;  3NR7 A;  4DYL A;  3JD1 A;  1GN6 A;  1HWT C;  2EJ7 A;  4X1I A;  4BZE A;  2ADP A;  3MIW A;  1P49 A;  1NH2 D;  3B5N A;  1F7Y A;  1VQ4 V;  1L4A A;  1EDK A;  2M7W A;  3CRC A;  1PPJ H;  4DUY O;  1TQT A;  2M5A B;  3JCU E;  2FUQ A;  5KTB A;  4YY3 O;  2PYL A;  4DR1 O;  3IAQ A;  4JAU A;  4NB5 A;  3T1H O;  4RUF A;  1KB9 E;  1RFY A;  2L91 A;  1OCC B;  1S5H C;  2M8R A;  2EIK B;  3RWR D;  3L74 D;  4DUX A;  1XHX A;  4U3J B;  1Z2G A;  2YKQ A;  4KT0 J;  3ZDM A;  4X65 B;  2QJY B;  3J81 N;  3EJP A;  3GHG C;  1HW7 A;  3H32 B;  2W0Q A;  4HYO A;  3BLB A;  3CP1 A;  4DV3 B;  1S5L X;  2V7Q H;  5CB4 A;  4JI7 O;  4UFC A;  1V55 C;  2AXT Z;  1BGY J;  1OCZ B;  1VIB A;  2UU9 O;  1N7S D;  3OMN B;  1J2J B;  1NTM K;  3AK1 A;  3LID A;  1F9G A;  3ZMZ A;  4Z1M H;  3LW5 H;  3P3P A;  3DC6 A;  1P7B A;  1OZH A;  3DGE A;  4C7U A;  3OUS A;  1KFM A;  3OD4 A;  1J0M A;  4I4T A;  3T4Z A;  3QFZ A;  5LP6 C;  3ZBH A;  3AEB C;  1IFD A;  2WQY C;  1GU4 A;  2N74 A;  3AFL A;  3CX5 F;  4DUW A;  4JAA A;  4LH7 A;  4PJ0 Z;  4O2A A;  1GH6 A;  2ZNI A;  4X1K B;  4B3M B;  5KKZ C;  5CJ4 A;  3BCC H;  5GTH E;  3CC2 P;  2FXO A;  3CCL P;  1H38 A;  4N78 D;  2HLD G;  5JMD A;  2K9Y A;  3CRA A;  1I0H A;  4NTX A;  3CB2 A;  1Q8I A;  3BVV A;  1OJH A;  1URQ C;  1K8A Q;  1Y47 A;  1LT9 B;  1Y6X A;  3BPZ A;  5L3G A;  1N73 C;  5E79 E;  3K0D A;  1DK1 A;  5KJ7 D;  3ZHT A;  1N7O A;  1SS1 A;  1R3L C;  2CTR A;  1FDI A;  1ARO P;  1W0K G;  4DV6 O;  3A2A A;  3K5L A;  4PD4 I;  5IYZ B;  1GDT A;  1K3E A;  4X66 O;  4J11 A;  2LO1 A;  3A0O A;  1UII A;  2KI7 B;  1JZ4 A;  3WG7 B;  2PY5 A;  1D5A A;  3R2P A;  4BIO A;  3RL0 B;  1OCO C;  4AI8 A;  2D2C C;  4QIW F;  2UXB B;  1H89 A;  2E75 B;  3M8A A;  3RYC A;  4YHH O;  1QVG U;  3ZHS A;  5IWA B;  1BZK A;  2XV5 A;  4GKK B;  1W0J G;  4L73 A;  4N21 A;  3V2N A;  1NOH A;  4O4H A;  3AE8 C;  1VL2 A;  1XEQ A;  2NPS D;  4RUE A;  1JX9 A;  4DV5 B;  3UT5 B;  1L0N K;  4H0L B;  1IX9 A;  1CZQ A;  2BOC C;  1KQG B;  1IFP A;  4I55 B;  4YJ3 B;  3FAV B;  5CN0 A;  1TAE A;  2EZO A;  2IYP A;  1UG9 A;  3N27 A;  1NO4 A;  1GW3 A;  1W3Y A;  1MN0 A;  3ZJZ A;  2IFN A;  4ZIB A;  4OPH A;  1NAY A;  3LIE A;  1LWU B;  4JI8 O;  1H2L A;  1RE3 C;  4YXW G;  2CTP A;  3JAK A;  3I5D A;  4OVN F;  2W90 A;  5APV A;  1QR9 A;  3CCU P;  2A3Q A;  3H1J J;  1VQO P;  3DDF A;  1SVF A;  1LR1 A;  3I56 V;  4B3T B;  1XL6 A;  5K1X A;  1HNW O;  2OQQ A;  3HUS B;  2D3O W;  4Y99 B;  1RWH A;  1PL5 A;  2FFD B;  3X42 A;  2QIW A;  1U7J A;  1T2K C;  1VQO V;  3L71 J;  5AVZ B;  1VF6 A;  4J7J A;  2QSA A;  3HD7 A;  5CBO A;  2EIK C;  3Q5R A;  1FZG A;  2DWE C;  4X62 B;  5FPR A;  4AQR D;  3EJT A;  4GOF A;  3P32 A;  1JVM A;  3RK2 B;  2ZIO A;  4PD4 F;  4DV4 B;  1UIX A;  3CCM P;  4TTG A;  2RDC A;  3BLC A;  3ETG A;  3B5N B;  1PX4 A;  2E74 D;  1IBL B;  1NKN A;  4AYC A;  4B86 A;  4HAM A;  1IQY A;  2OYH B;  1V55 B;  1PD3 A;  2FKX A;  3L35 A;  5IYC O;  1VQ4 P;  1XMQ O;  2DYS C;  3HB3 B;  2PGD A;  2WLL B;  1HN1 A;  1XNR O;  1NTZ E;  1Q2N A;  1SA0 A;  2W6B A;  5TJH A;  1NS1 A;  1VQP P;  1WMP A;  3M06 A;  4D6T G;  2KK7 A;  4JYB A;  3QO5 A;  1JYN A;  5CA1 A;  1RQU A;  3CD6 V;  4B3R O;  2BE3 A;  2R70 A;  2IPP A;  3SEP A;  2LFR A;  4J5T A;  2E74 C;  3W68 A;  1M57 B;  1M90 Q;  1NSM A;  1KB9 D;  4A5U B;  1Q86 Q;  3SDL A;  4MVR A;  1OW6 A;  2WSE J;  1B6Q A;  1IDS A;  4PA9 A;  4UCU A;  5FL7 G;  3D6Z A;  1JOY A;  3L36 A;  1N86 A;  1PZQ A;  2X6A A;  3CCL V;  3AEF C;  5EIB D;  1LUV A;  4X1Y A;  1Q82 W;  3WA3 A;  2RJZ A;  1ZOY C;  3TCU A;  1HDJ A;  2ADQ B;  5J2U B;  1VQ8 V;  1HGV A;  4L76 A;  4W7Z A;  1DX7 A;  4UV9 A;  4U7O A;  3ZIA G;  3G6B A;  3KZI Z;  1WP7 A;  2QE7 H;  2QM7 A;  2WVX A;  4LP8 A;  1OXZ A;  2CFL A;  5LP6 B;  3ASO B;  2NPS A;  1HM3 A;  1M1J B;  4IYH A;  3HKE B;  5KLV H;  2BTQ A;  3ZS8 C;  1I08 A;  5KAF E;  4PDL A;  2LXB A;  1LTI C;  3H1K D;  5LXT A;  2N1T D;  5EIB C;  1Y76 B;  2DYS B;  3ZX6 A;  3V2R A;  1CI6 B;  1AIL A;  1LT9 A;  1XMO B;  2L35 A;  4FMT A;  2ILM A;  2B88 A;  3BCC G;  4ZHQ B;  3E8B A;  1AI7 A;  2QGN A;  5IYZ A;  1L4A C;  1RF1 A;  1BE3 D;  2ZQ0 A;  1M5I A;  2QJY C;  2WAM A;  4MS2 A;  3ZN0 A;  3JAT A;  4TQF A;  1SQB H;  4DV4 O;  3H1I J;  1QAK A;  1EN4 A;  3AEI A;  1NR1 A;  4I0X B;  2UXC B;  2VQE B;  2KLU A;  5DJT B;  4YXW H;  1GL2 C;  3N4X A;  4BRY B;  4GCZ A;  3QO7 A;  2F1B A;  1G2C A;  5IE9 A;  2EJR A;  1H2S B;  3RBX A;  1Y8A A;  1RSO B;  2CFD A;  3RVZ A;  2WO0 A;  2V7Q G;  3FAV A;  1SQQ K;  3ITK A;  4DR3 B;  1KQL A;  1NTZ K;  3KCY A;  4TV8 A;  5CBF A;  5KLV J;  1N8R Q;  1Q86 W;  1WP8 A;  3QG5 A;  3M91 A;  1QLE B;  2IBZ I;  4X20 A;  2RCV A;  3RRS A;  3SFE C;  4DR2 O;  2R72 A;  2ZAE B;  2BOB C;  2HKO A;  3RK2 D;  4RQE A;  1JY2 O;  5KMG A;  4G2K A;  4ZMD A;  3RFR A;  3L75 E;  2R5B A;  1XUQ A;  2AZ2 A;  1K1W A;  1YJ9 V;  1BS3 A;  1EDL A;  1FXK B;  2QJK C;  4UB6 Z;  2WSS H;  2YXH A;  2CFG A;  2JKE A;  3T1C A;  1HTL C;  2M3E A;  3ZRW B;  2YID A;  5KA6 A;  4ZOL A;  2WVY A;  3DTU B;  2WZS A;  1NR7 A;  1JFF B;  1IC2 A;  4J7Z A;  1RPR A;  3H1K H;  4JI3 B;  3KCX A;  3CRR A;  4GLX A;  2E2T A;  2R9A A;  5EBL C;  1GMG A;  2AEJ A;  3W67 A;  2BSK A;  4PDR A;  3S4C A;  2DN9 A;  1YVW A;  2P5O A;  4W4K A;  1VQ5 P;  5KA5 A;  4JI2 B;  1EGU A;  3NRE A;  3M9B A;  3OEH G;  5F2V O;  4NPF X;  5EK0 A;  2BT3 A;  1VQN P;  3BA9 A;  4X65 O;  2WLN A;  2EIL B;  1L0N G;  4PHZ A;  2JR8 A;  5LOV B;  4NXN O;  3BVT A;  1JRQ A;  2QKA A;  1W2B O;  4H44 C;  2YX9 A;  3ASO C;  3TK1 A;  3L37 A;  1Y9B A;  2N04 A;  2QJ1 A;  3L73 D;  4LNU A;  4MVU A;  2KLV A;  2HJD A;  3ZRS A;  4FM2 A;  4JYC A;  5H6Q A;  3APO A;  2RN0 A;  2EIN B;  4MTF A;  5JWP A;  5CJ0 A;  4BW9 A;  3SWF A;  1NVP D;  1Q3E A;  4JTC B;  3UO2 A;  3S1K A;  5FLX N;  2YIU B;  3M0A A;  3SPG A;  1BE3 H;  2O1J A;  5GW7 A;  1K1Y A;  2X6C A;  4JF3 A;  2DYR C;  1K04 A;  3L72 J;  1JB0 J;  1GRJ A;  2C0X A;  2OTJ V;  1SQB D;  3TGU D;  3JAW B;  3OTF A;  3H1K J;  4RO0 A;  1KTM A;  1L4A B;  1G8M A;  1NTZ G;  3AE6 C;  1HP8 A;  1TUE B;  1IXM A;  1SQX J;  4P9P A;  4PI0 A;  4H33 A;  3KN4 A;  1R5S A;  2NPS B;  2AXT H;  3GF3 A;  4KHP O;  2WLM A;  1JPX A;  1EQ7 A;  2CK3 G;  3HE5 A;  3U1A A;  2GA1 A;  2UXC O;  4NTW A;  3L75 D;  1Y76 A;  2Y0I A;  5FNV A;  2ITD C;  1S2E A;  3JSL A;  1VF7 A;  1D5N A;  5AW8 B;  3RVY A;  3AG2 B;  4NXM B;  3G3Z A;  2P90 A;  4RNL A;  4JI0 O;  1KQS U;  4OH8 B;  3BGA A;  1KEC A;  1IK7 A;  4OK2 A;  2Z4E A;  4X62 O;  2H89 C;  1S9K E;  3VD3 A;  1LTT C;  5AVV B;  4X64 O;  1EZJ A;  3P8C D;  3F7Y C;  2QWP B;  1YQ4 C;  1BGY H;  3DX2 A;  2BRV X;  2QDO A;  3K9A A;  4XA4 A;  2Z3Y A;  4I4T B;  2FUT A;  3B8E B;  4K0K O;  1FXH A;  4EB6 A;  5AVT B;  3LW5 J;  3X3Z A;  3S4D A;  2ZL8 A;  1NAF A;  2P58 A;  5IT9 N;  1WLE A;  3L73 H;  3WMM 0;  1LP1 A;  3K3W A;  1L0N D;  1PP9 J;  3B2E E;  4LF5 B;  2QEX V;  4DZO A;  1JZ2 A;  3PH0 A;  4CZZ A;  1GK6 A;  3AE1 C;  5LA6 A;  4H44 D;  3BCC E;  5GTH H;  2UXD O;  3KG2 A;  1TXK A;  4LF4 B;  5GTI Z;  1OCZ C;  4X1I B;  1WAZ A;  3RGB A;  1SFC C;  4ZNC A;  4D6T D;  2ZFC A;  1JMK C;  4PEL A;  3RW0 A;  5AG2 A;  5A2Q N;  3L70 G;  1QR8 A;  4DR4 B;  1QVG O;  3VMA A;  2JGD A;  3M7M X;  1PM9 A;  3DX0 A;  1O9H A;  3VQX A;  1JYW A;  4U3F E;  1IXB A;  2W6I G;  3OJA B;  3HKC B;  2BCC D;  5E79 H;  2F7R A;  3HR0 A;  3FB8 C;  1A32 A;  2H8P D;  1LOH A;  5IY5 C;  1JFF A;  1FJG B;  1Q81 Q;  3LSQ A;  1NH2 B;  3H1L J;  3UO3 A;  1I94 O;  3A0B E;  2ZE5 A;  1XMQ B;  1U57 A;  3TGU J;  3E80 A;  3OAK A;  4LF6 B;  3H32 A;  3JAS A;  1US1 A;  1N0N A;  3T4D A;  2A79 B;  2H94 A;  4DUY B;  5H6R A;  5LHI A;  1IFN A;  2E5Y A;  3L71 D;  1QAL A;  2XN1 A;  3H1H D;  1FJP A;  1OW7 A;  3Q4H A;  3W7T A;  3L75 G;  4LF4 O;  3WIR A;  3RSY A;  3T97 A;  5B1A B;  3G67 A;  2VWJ A;  3OAA G;  1RWA A;  3BVU A;  2YEV B;  2AW9 A;  1V9P A;  1Y4M A;  4BIZ A;  4LF7 O;  3O6Q A;  3PRJ A;  1A02 F;  3J7A U;  2XAQ A;  3GWK C;  1G4Y B;  3JAR A;  2NLJ C;  3WA2 X;  1N2D C;  5DN6 G;  2JJL A;  4JQ0 D;  1ZP0 C;  5L8R J;  2FFD A;  1XRE A;  2Q3I A;  3HD7 B;  1TQU A;  2OQE A;  2GSM B;  1S5J A;  3GG2 A;  3DYO A;  5KHH A;  1ZAU A;  1LTB C;  4B7E A;  1N7S B;  3L74 H;  2MKV A;  2LW7 A;  5H2F H;  3CWB H;  2IJI A;  2UUA O;  3QG0 A;  4HBN A;  1ROP A;  4UVA A;  5K1P A;  1NU1 K;  1EBO A;  3AG1 B;  2MJZ A;  1S5L Z;  5APY A;  3EJQ A;  4I6M C;  2E43 A;  2VWK A;  2CPS A;  5BU5 A;  5APU A;  5L3F A;  4FM1 A;  1L0N E;  3HE4 B;  1MMY A;  1I7F A;  3V6I A;  2LR2 A;  2FTK A;  2HP8 A;  2F1M A;  4BZG A;  2Q6Q A;  1LF9 A;  2HJF C;  4LGD E;  2A7W A;  2WDA A;  3H1L D;  2ZT9 C;  4KHP B;  2XN0 A;  4GKK O;  3TXS A;  2LKM A;  3LVT A;  3HKB B;  1JEK A;  1X1H A;  5FNV B;  3M9Q A;  1QLE D;  2UWJ E;  2E76 B;  1HTY A;  2CFK A;  1T2K D;  3BVH A;  1FJK A;  1EZV H;  3AG3 B;  2OAR A;  4EI2 A;  4KFD A;  4D6T H;  1VP7 A;  1YSC A;  3EWK A;  3WB0 A;  2E5L B;  3NBJ A;  1NTM H;  1JCD A;  5KUK A;  3FYE B;  4KFF A;  4BXL A;  4EDF A;  3AMO B;  4HH2 A;  3RK3 E;  1MSD A;  4B3S O;  2OWO A;  3MHV A;  2JEE A;  5CMZ A;  1VQM P;  2J58 A;  4I1L A;  1LJ2 A;  2EIJ B;  3DEC A;  1DF4 A;  4UCV A;  2GUZ B;  2UXX A;  2ODM A;  1KZU B;  4UB6 H;  1EDI A;  3C3S A;  2OTK E;  3L71 G;  3HUS A;  5E1A C;  2WPD G;  4FPP A;  1JZ5 A;  1JJO A;  1SKV A;  4BW5 A;  1TVK B;  2HR3 A;  4DV1 B;  3LSU A;  2QR4 A;  2Q1K A;  1VQ6 V;  2FYN B;  4KHX A;  5KLI C;  4QPK A;  3N9H A;  5JJN B;  3KHU A;  1E1Q G;  3ZED A;  1ZR2 A;  2CTQ A;  5LA6 B;  2POH A;  1MUU A;  3CC4 V;  1N7Q A;  2RMZ A;  4B08 A;  4QNH B;  1VQP V;  1YBK A;  2WW2 A;  1BHB A;  2LP7 A;  3CX5 H;  2Q7G A;  3ETQ A;  1HN0 A;  3AEG C;  1DP0 A;  3CHX A;  3G4S V;  5LMN B;  3Q5S A;  3D50 A;  3CCJ V;  4MT8 A; 
#chains in the Genus database with same CATH homology
 3D52 A;  2KIK A;  1EC5 A;  2KI7 B;  2M5A A;  2RKL A;  1HXK A;  3BUP A;  1X0T A;  3MZW B;  2LXB A;  3BVW A;  4HJG H;  3S1K A;  4HKZ H;  2F7P A;  1QX1 A;  4GOD A;  2QVA A;  4NPD A;  3FXD A;  2KZJ A;  3BVU A;  3D4Y A;  2LXC B;  2B88 A;  2SPZ A;  2M0B A;  3CZS A;  1TQU A;  3BUB A;  3D4Z A;  2B87 A;  2OW7 A;  2R44 A;  4EYY Q;  1LT1 A;  5CBN A;  4K3A A;  2JWD A;  5DJT B;  1H0T B;  4ASW A;  4GOE A;  1OVU A;  1QWN A;  3DDF A;  2F1B A;  3CV5 A;  3EJQ A;  1U7M A;  1MFT A;  1QWU A;  3BVX A;  1EDK A;  3EJR A;  4WWI A;  1OVR A;  1NVO A;  2LR2 A;  1U7J A;  1LP1 B;  1JM0 A;  1TQT A;  2M5A B;  5CBO A;  4NPE A;  1ZXG A;  2B87 B;  1BDC A;  4MN4 C;  3EJT A;  1DEE G;  1FC2 C;  2I8D A;  1PS3 A;  3EJU A;  2ZAE B;  4GOF A;  3DX2 A;  2KS1 B;  3LVT A;  1EDJ A;  3ZDM A;  5DJU B;  4ZMD A;  2UWJ E;  1HTY A;  3EJP A;  1R33 A;  2WMM A;  2P58 A;  3BLB A;  5C39 A;  1EDL A;  1LP1 A;  4IOI H;  4K35 A;  2F18 A;  1JMB A;  4BXL A;  4HB1 A;  3PH0 A;  5EFW B;  1Q2N A;  2QRX A;  1TQW A;  1ZW0 A;  2F1A A;  3MHV A;  2ALW A;  1R34 A;  2OW6 A;  1BDD A;  2KUB A;  4ASV A;  4ZNC A;  3BUQ A;  3DX4 A;  2FYV A;  1EDI A;  4CPG A;  5KBP A;  2OTK E;  1S3J A;  3DX3 A;  3DX1 A;  2WYI A;  3EJS A;  2B89 A;  2F7O A;  2HR3 A;  2Q1K A;  3DDG A;  3RGU A;  3DX0 A;  1O7D D;  3BUI A;  2WYH A;  2K3R A;  3QWO C;  3D51 A;  4NPF X;  3CZN A;  1OVV A;  3BUD A;  2F7R A;  1HWW A;  1H0T A;  3BVV A;  4JBZ A;  3BVT A;  1Y47 A;  3FXE A;  5K5G B;  2F7Q A;  1TQS A;  1SS1 A;  2KZI A;  4KJM A;  3D50 A;  1TQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...