4K3AA

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
720
structure length
720
Chain Sequence
GDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
total genus 249
structure length 720
sequence length 720
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k3aA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k3aA04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k3aA02
3DX3A 1EDKA 3EJQA 4KJMA 5K5GB 1BDDA 1HTYA 5KBPA 3BUQA 4GOEA 3BVXA 2F7OA 1TQTA 3BUPA 2K3RA 1PS3A 3DX1A 2B88A 1EDLA 1HXKA 1FC2C 2F1BA 1OVUA 4NPEA 1H0TB 2OW7A 1R34A 2B89A 2HR3A 5C39A 4NPDA 2M5AA 3EJSA 1JM0A 1OVVA 2R44A 3DX4A 2JWDA 2KI7B 3D50A 3BUIA 1OVRA 3BVTA 2OW6A 1X0TA 4JBZA 2KUBA 1EDJA 2SPZA 3D52A 2WYIA 2F7QA 4EYYQ 1MFTA 1LT1A 4IOIH 2F18A 3CV5A 3DDFA 3RGUA 2FYVA 3BVUA 4K35A 2KZJA 2M5AB 1TQSA 2F7RA 3EJTA 3MHVA 3MZWB 4ZMDA 4ASWA 3CZNA 1QWNA 1LP1A 3ZDMA 4HB1A 5CBNA 2M0BA 2WYHA 2LXCB 4ZNCA 1NVOA 3PH0A 2OTKE 1S3JA 2WMMA 2QVAA 4GOFA 3D51A 1QX1A 3EJUA 1TQWA 3BUDA 1EDIA 2F7PA 3D4ZA 3EJPA 3BVVA 1O7DD 5DJUB 1JMBA 1U7MA 3DX2A 3QWOC 2ZAEB 1DEEG 2Q1KA 1LP1B 2KIKA 1BDCA 2QRXA 3D4YA 4WWIA 1TQVA 1SS1A 1ZXGA 2B87A 4HJGH 1U7JA 3S1KA 3FXEA 2LR2A 2RKLA 3BUBA 3LVTA 4CPGA 2I8DA 3DX0A 1QWUA 2LXBA 2P58A 1Y47A 3DDGA 1Q2NA 1R33A 1ZW0A 5DJTB 3BVWA 4HKZH 1EC5A 2UWJE 4K3AA 4GODA 4MN4C 4NPFX 2B87B 5CBOA 3BLBA 5EFWB 3CZSA 3FXDA 3EJRA 2KZIA 1HWWA 1H0TA 2KS1B 1TQUA 2F1AA 2ALWA 4ASVA 4BXLA
chains in the Genus database with same CATH superfamily
1G6UA 4DV2B 1FOSF 2M6YA 1EGUA 2EZPA 4DV4B 3U1AA 1JMMA 3WUVA 2K3RA 2E5LO 4DR6O 1UPGA 2JEXA 3MDSA 3KQGA 3WUTA 1RF1B 1PP9J 2XNDH 1SQVJ 1K9MQ 3SWYA 4NPEA 3TGUE 5C8YA 4MW8A 1JMKC 2QM8A 1K5QA 2BSKA 1PNKA 4I55A 3WU2H 1KBHA 1MOFA 3GHGC 1H2SB 2F4VO 3B77A 1L0ND 1IJDB 2GSMB 1NBMG 2OQQA 4WFHA 4CBCA 3CWBJ 4PV1D 1HBWA 3G6EV 3CMEP 3E86A 1CEZA 2WVXB 3MWXA 4LBEC 1M1JA 1FOSE 4TOIA 1K92A 2YIBA 1AFOA 2KUBA 2WLLB 1VQMV 4PA4A 2ZYGA 3BS6A 1IVVA 4IOIH 4N78D 1M90W 3H1JJ 3MD0A 4PD4F 4YPCA 1P84D 1CZQA 3EFFK 1L7JA 4W7ZA 4N23A 3SEPA 4IT5A 1NU1J 1KB9I 3B5NA 2DWDC 4DO2A 1R8EA 1L0LH 1SQXK 3ZBHA 1SQPE 3ACTA 1NVOA 3AG3C 2YEVB 4CC6A 4EIJA 1SQBG 2Q9IA 4JAAA 5H5NA 3L73G 4N21A 2EULA 3AECC 1JOVA 1TUEB 3M06A 3EJUA 1TVKB 3MUY1 1L8DA 3H32B 4JI2B 3MP7B 3CCEP 3DC5A 2A79B 1THZA 1D5AA 3RYHB 3T2OA 2XN0A 5CA3A 1C82A 4PD4E 5KLIC 5JVDB 3D3QA 4JZGA 3PRJA 1SQBD 1GN6A 2N74A 1NTKH 2XAHA 1OJOA 5JJJB 3L73D 1VQ5V 4RNLA 2QWNB 2FFDA 3D4YA 1Y76B 2QJKB 4IYHA 3CI9A 2V7QJ 1RWGA 1SS1A 3NR7A 4DXWA 1SERA 1ZXGA 4RO0A 4O4JA 4BTYA 1OCZB 3QO5A 3VOUA 1SQQK 3FXEA 1MN0A 1RKYA 2A06H 3BUBA 3KIIA 2NR5A 1VQ6V 4CPGA 3ZMVA 1H2NA 2H94A 3L36A 2KQXA 1VF5C 4KT0J 1EN6A 4NVPA 2YIBD 2WT7A 1S9KE 3OE7G 4HNAB 2Y9YA 2GUSA 2QGNA 1R33A 2C2AA 5DJTB 3BVWA 3L72E 4GX0A 4PV1B 3ABLB 2HVJC 1IZ3A 4KHPO 2R3SA 1EKMA 1V7WA 1OIPA 1XREA 2CK3G 4TWKA 3LSUA 1FKAO 3LNMB 3L70H 3ZRWA 1NKZB 3T0AA 2PYJA 4I9QA 4ZKPA 1TA8A 5KLVK 3SGIA 2VWKA 4TUYA 3CL3D 1E79H 1KQGB 1HTYA 3SFDC 3FYIB 1AJYA 2HTBA 4NR1A 5FPRA 3V2RA 3CJHB 1N7OA 3JD3A 3K0DA 4KUMA 3X2QB 1AR5A 3L71H 2F1BA 1VMGA 1UFIA 1N73C 1HF9A 3JARA 3VDCA 5IYBO 2FYNB 3LDDA 1BE3J 4FLTA 2EZOA 4NKGB 4YXDC 2P22C 4JTCB 1W2ZA 3ZIAG 1YXBA 2RN0A 3DX4A 2C9LY 4JPZB 2XHBA 4H0LD 2OYIA 3HIGA 1OV9A 1BCCE 1G1XB 3HKEA 1OJPA 1HNWB 3BUIA 1GN3A 4DR1B 1GK6A 2A45I 3N7NA 3AEAC 5C8YB 3HKDB 2BSKB 4JV5B 4I55B 4FVMA 1SQVK 4H0LC 3PP5A 1VQ9V 4JI5B 3E1RA 4CH5A 2F1MA 1U97A 2WW2A 1AP6A 1NTZE 1RJOA 1Q43A 2DYSC 4JI2O 1OCCC 1MMUA 4ZKUA 3CWBD 2OYQA 5K1XA 4ZOLA 3GG2A 2WYHA 2AW9A 4I4TA 1M1JB 1O9HA 2CAZC 3PH0A 5L3GA 1H2KA 2OQEC 1Q81W 3HE4A 4DV7O 2OYHA 3G4SV 4NXNO 1M1KW 1CI6A 4P9OA 2DE0X 3JAKA 2FL4A 3OUSA 1TU5A 1H88A 4UVAA 4B3TB 4MTOA 4MSWC 3EQ2A 3AMOA 4ZIBA 3B5NB 1RHZB 3P8CD 2BCCH 1NU1K 1X59A 1S72P 1LF6A 1JCCA 2QRXA 5HFMA 4L8JA 1SZTA 1GM8A 5KA5A 2GUVA 4GX5A 5EBLC 1GW3A 2IX7C 3NFQA 3TGUJ 3TYYA 2ZIOA 2OTJV 1LT9A 1Y8AA 1YHQP 2WZSA 3MUZ1 1DF5A 2EIJB 4NTYA 1LTBC 3A0HE 3AG4B 2K88A 1B04A 2ADQB 3CRAA 1RWAA 1KYOH 1KTMA 3VMYA 1IBKO 4JI7B 1AVMA 4O4LB 2P2UA 1N33B 2FFDB 4DZOA 2Z3YA 3VQYA 3BLCA 4DV0B 4HKZH 2KK7A 3APOA 5BR8B 4MN4C 4O4JB 2JKPA 1JZ7A 2UXXA 4FLWA 4OGQC 2DW3A 2IFMA 4KTRA 4XFJA 3L75E 1H0TA 1B06A 3SYQA 2A3QA 3ABMC 1L4AA 1R6TA 2WT7B 2OIEA 1S5LZ 2DOSA 2WSFJ 1FXKA 1WJZA 5AVSB 2Q3EA 3A0OA 1QR8A 5K5GB 4UVBA 3CEIA 3A0HZ 1OCOC 3G71P 4DOJA 1Z2GA 3CXHI 1VQOP 2Q7EA 4XDLA 2Y0CA 1RWFA 2OWOA 3Q5RA 2PUSA 2WSSH 1P7BA 2ZVNB 4MVQA 1OVUA 3A0BZ 3C9IA 4HYTB 3S4BA 3ZRWB 5LXTB 4IFFA 1MZFA 3TF5A 1NGMB 3CXCU 3BATA 3HKCA 1D7MA 2WZ7A 4TUYB 1PPJD 2R44A 1XNQO 1R5LA 4WFGA 1UIIA 3HTKA 1IVWA 2R9AA 5B1BC 3GWKC 1HR0B 3DC6A 5B3SC 3JCUE 1M90Q 1ZMEC 1SS3A 2P4KA 4Q6GA 5GTHH 1OACA 4FNTA 2QEXP 3L74H 3AEFC 2F7QA 3JARB 1LT1A 1QVFO 4KFMA 2QWOB 2QKAA 3Q5PA 1NSVA 2CTPA 3RVYA 3TNUA 1NS1A 1KFNA 2KOGA 1LXKA 5LMNB 1GMJA 1JZ8A 1N36O 4GKGA 2OYIB 3RGBA 2JJLA 1YJWV 4B3TO 2FY8A 4Y28J 3HKEB 2D2CB 1SESA 4BTXA 4M3LA 1AR4A 1NKGA 4RAIA 2E76D 2NRGA 2CFDA 2P10A 2XAGA 3ABMB 3UO3A 1M57D 3JALA 1L4AD 5LBQA 3PN1A 1YITV 2W6IG 3HKBB 1IBLO 2Z0AA 1VQKP 1QX1A 1TQWA 5E1QA 5DM6V 3JCUZ 1AI6A 1M8OB 1QLNA 1P84F 3JSVC 5TISE 3CD6P 1JY3N 4TSFG 4EV5A 1NS2A 4ZOLB 1M57C 1N9EA 1AJQA 3MPHA 3EHBB 1GL2C 2JVDA 4I4TB 1IK9A 4EOTA 3K5OA 3L71J 4EFBA 3HE4B 4U3FG 4JI7O 2Y4TA 3OGCC 2OYHB 3AE9C 2ITCC 2P06A 1CI6B 1L0NH 1VQ8V 4GKJB 3JAKB 3LUTB 2LR2A 1SZXA 3MUDA 3AMOB 3GVMA 1SLQA 1NQTA 2P90A 5AW5B 1PZQA 5E1AC 2O1KA 2YXLA 2Q1FA 1IFJA 2ZXQA 5B3SB 4Z1VA 4E4EA 3C3TA 3K5LA 4LFAB 2AXTH 2ZXWC 1BCCJ 1QX8A 2EILC 2K1EA 2JKEA 5TISZ 3T1CA 3TXQA 1FZGA 5FPOA 2H3OA 4HH2A 2UWJE 2XASA 1PX3A 3BCCH 1SQXH 1QEXA 1W6CA 3MAQA 5GONA 5JCOA 1LT9B 3TGUD 1R3KC 2BASA 4PA7A 3WUUA 3CCVP 1LXMA 2CQTA 1WRGA 4BXLA 4BIZA 5CBFA 1QAKA 4GDOA 2B5UA 3OEEG 3CMEV 3DX3A 1GM7A 2D1WA 3QO7A 1SPUA 3K03A 2HJDA 2NPSD 4D6TJ 4J41A 3CPWU 2WLIB 1LTAC 5CA0A 1HMUA 2JWAA 1FZCC 1K05A 2X0LA 2E76B 2ATKC 5IE9A 3BAAA 5APTA 1H0TB 4I7ZB 4R50A 1HR0O 1NO4A 2Y48A 3RSYA 1L4AB 2Q4PA 3X3YA 4GZRB 1FAVA 1KB9E 2NPSC 2HHHB 2IDBA 1FXKB 5AVRB 5LP6B 1D6YA 1SQQH 2IJHA 4HBNA 4IFMA 5CMZA 1SQPD 1RFYA 3X40A 5B1OA 2AXTZ 3DYPA 5LMNO 1K73W 1XHZA 4JYAB 4K8XA 4RUFA 3JAMN 3SPCA 1E1QG 1NSUA 3CCEV 4DR4B 5AW2B 2FB5A 4FFBA 4BW9A 3W7UA 3PHLA 1CW5A 4OK2A 3KHUA 3E8GA 3DYMA 4XDKA 1SFCD 3HKCB 1TQSA 3O6QA 1K3EA 5ITZA 3IAYA 1BGYJ 4PD4D 2W0QA 5JMDA 4FLYA 1LP1A 1LR1A 1HNXO 3VMXA 5CBNA 4KTPA 1ZTEA 1J1DB 3HTKB 1NTKK 1JZ6A 1Q81Q 1USDA 1X8YA 2LXCB 3K04A 2KNCA 5KLVH 3T2PA 2NNUA 1M1KQ 1GW4A 1FZAA 1S3JA 5APYA 2CTQA 3SDLA 1SFCC 3L72G 1JY2N 1Y74A 2QE7H 3EJPA 4PI2A 4I9WA 1GO3F 4CC5A 4RQFA 1IBMB 4I1LA 1S76D 2E22A 5E79H 3TNUB 1ZV8A 3K5NA 5JWPA 1JUNA 2DN9A 3FX0A 2NN4A 1S9KD 4PI0A 3RT3C 1QLED 4DK0A 4NXMB 4UB8E 1T2KD 1IVSA 3H1KE 3FAVA 4FLXA 3L72D 1BZKA 4MS2A 4X20A 3GF7A 3JALB 4QE7A 4O4HA 2F66C 4X64B 2EABA 1QVGU 1WN7A 3K25A 2CUGA 3RK2C 2H89C 2QJPB 3A2FA 1N7RA 2HFED 3OT7A 1Q5OA 3MHHC 4G28B 4CZZA 1RH5B 1T2KC 3AE1C 2H88C 1SVFA 3OUFA 4KFDA 1PP9H 1SQVH 2YO2A 2HYNA 1US1A 2HFEC 3SSUA 1R3IC 1KORA 3BLBA 3ECQA 3M0AA 3NXSA 4UB8Z 3EJRA 3F7VC 3UQ8A 2G38A 2EAEA 1BSHA 1LTTC 1Q8IA 3CWBH 4KXRA 3RBZA 3N9HA 1H2GA 1N0NA 2JDIH 1NTME 3ITKA 2Q5ZA 1VQ4P 1YI2P 1E5WA 1HTLC 1R5SA 2BT3A 4R4LA 3IC7A 4KJMA 3D36A 1BCCD 3OW2U 1HNZO 3TDKA 5FNVA 4A7PA 2HHHO 3CLQA 3H1JH 2GA1A 3BUQA 2AHYA 3H25A 5APWA 3L35A 5GONB 1NU1H 1FDMA 4BAYA 5DECA 2WSEJ 3SWFA 2E2VA 4OJZA 3CSXA 3OMNB 4J9YB 2ZM6B 4JYAO 2YKPA 4QE9A 3H1HE 2M5AA 2E24A 4DR4O 1NTZD 4LP8A 1W2BO 2UXBB 2E5TA 3HIIA 4IGGA 4JQ0D 4JASA 3V2QA 1QU7A 1US6A 1L0NJ 1SETA 2Q3IA 4MT8A 5CA0B 2M8RA 3T97A 1QLEB 5AVXB 1KZUB 4LC1A 5B66E 1W3YA 1JB0J 1J1EC 1HW7A 1YF2A 3S4RA 3CV5A 2YIUC 1JCDA 3SR2C 5H2FZ 2F95B 2UUBB 4K35A 2JP3A 2XHNA 2BOCC 2KZJA 1J5EB 4EB6A 5APVA 2W8ZA 4C7RA 3ZEDA 1K8AW 1AQTA 3WG7C 1GTWA 1AVLA 2KYVA 3JCZA 3VD4A 1WMKA 1NS8A 1S72V 5EIBC 1IBMO 4CH4A 2V7QH 4JZ2A 2KSEA 1YIJP 1SA0A 3K9AA 1KYOI 1IVXA 1W5CE 2FMLA 1NKNA 5DEDA 2FYUE 3X41A 1YCIA 1YHQV 3OEHG 4LLHA 4FFBB 4PA9A 4WY4A 5IT9N 2XU6A 3HE5A 4FNPA 2HP8A 3O6QB 5ITZB 1UJWB 3OJAB 5B66Z 2F4VB 2Q1KA 3CX5H 1LP1B 4X88A 4LFBO 1T3JA 2WPSA 3L75G 4IL6H 4EV2A 2AEFA 4O9BA 1JZ2A 1OW7A 1XL6A 2KNCB 3EVKA 3SPGA 1N7QA 1DLBA 1JOYA 1A2VA 1ULVA 1SQBJ 4WWIA 4BRYA 2WVZA 2IBZG 1ZR4A 3SJCC 4YJ3A 5CJ4A 4JAVA 2QG4A 3L73J 1W59A 1Y74B 1PPJH 4W4LA 1JYWA 3L75D 3K59A 3VBBA 3CRRA 3B4SA 2IYOA 1PFIA 3GHGA 4FIPC 1OCRC 1VQOV 1XDCA 2IJKA 3FAVB 3VSNA 3CXHE 2POHA 4X20B 5KKZC 3ABTA 1V54B 2QIWA 1KQSU 1D2DA 4PJ0H 4UB6Z 5B5EH 1JYVA 1WB8A 1BE3H 3SYCA 2OT5A 3ZHSA 3CPWO 4H33A 3KN4A 2BEQD 4LR3A 3ZN1A 4C7UA 3OFNG 2CG1A 2XKMA 3OM3B 2WAMA 4G2KA 3ASNB 3E7KA 3E8HA 3V2PA 3TSIA 2CPSA 1K1XA 3AG1B 2ZM6O 1AJPA 3CCQP 2Y9ZA 4WFAV 2QTOA 3B71A 5EC1C 2DMXA 4QPKA 1FFXA 2QEXV 3O8ZA 4WY4D 2F7OA 1EN4A 1WAZA 5AW1B 4UCUA 2UXBO 1HXKA 2KB7P 3FX7A 4RKUJ 3A5TA 4U7OA 3H1IG 3V5BA 3SJAC 3R4YA 2YIDA 3T09A 4YY3O 2ZD9A 5C93A 3ETEA 2YXYA 3RYFA 3ICXA 3II6A 1H54A 4FNSA 2UUBO 5FNVB 3P30A 3F89A 1BL8A 1K73Q 2ZL8A 3NREA 1F4NA 2XAQA 4JTAB 3IR9A 1R6NA 3C3SA 2OCCB 4KHPB 2KP8A 1WMPA 3ASOC 2LO1A 4H13C 4Z1MG 1VQKV 5GTIE 4MVOA 4U3FE 4FNVA 2N1TC 1V55C 1MZ9A 1WMOA 1IFDA 3VD9A 4PJ0Z 1HP8A 2WLKA 3OAKA 1S5JA 3WA2X 4H37A 4CH3A 3CD6V 4U7JA 4FLVA 1G1IA 3JYCA 2X7RB 2J58A 2M5AB 1EZVH 1V9PA 1Q86W 4MTXA 1F4MA 5KKZB 1WA8A 2WW0A 3SJQC 3UO2A 5KHJA 3DYOA 3M99B 1IXMA 5A9GA 3OMAB 3TGUH 1M56D 1DH3A 3PGBA 3TY1A 3T97B 2CWVA 1JQ0A 3D71A 4JAUA 1IQXA 1F1SA 2BRWA 1L0NK 4GCZA 3M0DC 1SQGA 1IDSA 2Y74A 3ACSA 3PTZA 1HWTC 2UU9B 2L35A 2YS8A 4EB6B 3RL0B 4KFEA 1M56C 5GTIZ 1JTHA 1GN2A 1EZJA 3BFRA 1GM9A 2HKOA 3H1LG 5EC2C 4OK4A 1QL2A 1MSDA 1SA0B 5CB4B 1LJ2A 2XOKG 4JF7A 2N05A 4RWUA 1MSWD 1PD3A 1RM1C 2WVYA 1VQLP 2HODB 1TXKA 2Y0DA 4WFFA 2WSFH 4WY4B 3CCVV 1SQXG 1YGAA 3JSLA 1N73A 1OW8A 3HE5B 1EQ7A 4RO2A 2PRRA 2KS1A 3DX0A 5B1AC 2W83C 1EFRG 3APQA 3AE6C 3AG7A 1NAFA 1Q2NA 1DIPA 2FUTA 2JKAA 3DECA 3CRQA 1L0LE 1B6QA 1OJMA 1N32B 1L2PA 2XSGA 3WU2Z 3O65A 4YJ3B 2VQEO 1X22A 2ILMA 4DV7B 3OTOO 4PD4H 4RESB 2UUAO 4NXNB 3I5DA 4TV8A 1SQBK 3KCXA 1VF5D 4X66B 4DUWA 1KB9D 1KILC 3QF7A 3GHGB 3E80A 3OA7A 4N3YB 2F1AA 2ALWA 4ASVA 3I3EA 2R9RB 2GTSA 1N0JA 1GKFA 5FL7G 5KTBA 2EACA 3EJQA 3RL0g 3JATA 4AYCA 1QCEA 5LHGA 4GOEA 2WTYA 2RNBA 1CSBA 2Z5UA 2OQEA 1GU5A 4EKWA 1PL0A 4MVZA 3S4DA 4DUXA 2P1JA 4FK5C 2WPVB 5BMVA 1GN4A 5C39A 3UM7A 3CCLP 1IBKB 2Z4EA 1HJ0A 3STLC 3AG3B 1FFXB 3K3WA 2KI7B 3G80A 2V4HA 2YXQB 1KECA 3CCMP 4FZ1A 4CH6A 3BVTA 2EIMC 3H1KG 5IYCO 4B08A 2OYOA 2ZT9D 1JVMA 3A24A 4J42A 2XAJA 1K8AQ 3ZMZA 3I3DA 2IZ0A 2Y0IA 4GT1A 3RYFB 2PNCA 3MZWB 4ASUG 2F43G 5KLIB 3FWNA 1I94O 1YTZT 3QH9A 2UU9O 5KAFH 1RPOA 4HB1A 1K7DA 2ZT9C 3H1KD 3CE2A 4JI1O 2WLNA 3T0DA 2WPQA 2DW4A 5LA6A 4DCKA 3ZCCA 3HUSC 3D6ZA 1BCCH 1H89A 2OOVC 1M4UA 2WOHA 1IFIA 3DX2A 3G6BA 1WA8B 5J2UA 3RFRA 3UKMA 3I55P 1VF5B 1NTMG 1MMMA 2JO1A 1XNQB 1A02F 3B8MA 2QWRB 3D6YA 1GTOA 4DV5O 1YQ4C 2KIKA 2W90A 4ABMA 2DQ0A 2R9IA 3ZS8C 1T5EA 2DYRC 1KMIZ 1F23A 3LW5J 1BQ0A 3H01A 1NTZH 3PLNA 3A7OA 2WGQA 1N2DC 2YKOA 2A45G 2L6LA 1N32O 1VQ4V 1YI2V 1OFCX 1NTMD 1JTHB 3AEDC 3J7AU 3USSA 5KHHA 1VDFA 4D6TH 3IMHA 3LVTA 1HWYA 2GUZA 1N36B 1VIBA 4NYKA 2YI8A 4R8CA 4X66O 3H1HG 2CG0A 2AXCA 1Y47A 1LTGC 4QMAA 2IU3A 2JKVA 2Y0EA 2CGNA 5KAFZ 1JA8A 2L91A 4U3FJ 2QA4P 3CZSA 2KSJA 1ZL8A 3NMDA 2Q7CA 1ZWIC 1N73B 1IBLB 4LF7O 3T08A 2KZIA 3TXSA 1Q6UA 1K5SA 3ZHTA 2WQYC 3H1HD 2HVKC 1DD4A 5EBWC 2KS1B 1S5LE 5AVVB 3LIDA 3T4ZA 3K9SA 1PU4A 3B2EE 1I5XA 2Q69A 5AVWB 5IY5C 2PF4E 4OGQD 1W6GA 3CCJP 2BCCE 5KJ7A 5KAIH 4I2LC 4WBAA 1KC8W 3S4AA 3L9DA 2LGQA 1PIXA 1AP5A 1OZHA 1BGYH 2A7WA 4LF4O 1FC2C 4TV8B 2FYUG 3A0BE 3WMM0 3LOYA 2EX3A 1NT2B 3GB7C 4H0LB 1EBOA 3GW6A 3ETGA 3AE5C 1ZN5A 3EJSA 5D5QA 3SWKA 1GMGA 1PNMA 4X9QA 2DYSB 3D8CA 1OCCB 4UV9A 1YIJV 3IN6A 2IYPA 3JATB 1JZ5A 2CWTA 3P32A 2V7QG 4LH6A 1KYOE 3CX5I 2ZR2A 1GL2A 2LFSA 2FYUD 3SPJA 4UFCA 1YTZI 4BTWA 5CHXA 4J10A 4U3JA 1Z45A 1SQPJ 2B9BA 5KA6A 1AVYA 3KG2A 2IBZE 2F18A 1FD9A 1Q6HA 1YJNP 1Q86Q 4JI0O 1Z5VA 1BS3A 2E5YA 5BMVB 4GLXA 3TK1A 3ZRSA 3W7SA 5BZBA 5LGNA 4JI6O 3SJBC 4LFCO 3CCSP 1WT6A 4R7CA 2ZVOB 4BZHA 4ZNCA 4TT3G 4YXWH 3A8TA 1UIXA 1PL5A 1NS0A 3Q2YA 2WA4A 4JYCA 5KHIA 2ODMA 2WVRA 4GOFA 2WCOA 5KAIZ 1TU3F 3DTUB 2Q0AA 4AQ0A 3QG5A 1FYJA 1O7DD 1X4TA 4WFBV 1VF6C 3V4WA 2ZAEB 4EI2A 3PJSK 2UXCO 1XMOB 5KJ7D 3RW0A 1JY3O 3E1F1 1KU9A 2CTWA 3CXHD 2R3CA 2KLVA 1V7VA 4AQYO 5LA6B 2ADPA 2VRZA 3SX1A 4OGQB 1FZCA 3L72J 3CB2A 5KJ7C 1JYNA 3L74E 5L3BA 2WW3A 5J2UB 2C0XA 3RYIA 1FJGB 1GL2D 3QO8A 3H1IE 1OJNA 4DK1A 4EFEA 2UUCB 2NPSA 2W6JH 3ZMUA 4QIWF 1HNXB 3CCQV 3MTUE 4BZEA 2LGWA 2AZ0A 2BEZF 3S3XA 1OCOB 2WSEH 2Q5UA 4UUJC 3HPLC 4O2AA 1LF9A 2WLJA 1ZW0A 4FNQA 3T0UA 1X79B 1ZLZA 4K3AA 1MFZA 1BHAA 2W0FC 1H8EG 1SQFA 3R66A 4DJGA 3ZRVA 1FDOA 1URFA 4L75A 1QALA 1AILA 3ZHVA 3U11A 4TV9A 3E8BA 4JGSA 4B3SO 2CFGA 2GUZB 2QR4A 5GTHZ 2IPPA 2WPDG 2HLOA 1AI5A 1EZVI 5LL6Y 4DR3B 1PV3A 5APUA 2K9PA 5LYJA 5B1BB 5AW4B 3NBBA 4BZGA 1HM2A 2N9YB 1FS0E 1RWCA 3IGAC 3ZX6A 1ZL8B 4U3FD 1AA0A 1SFCA 2MK3A 1HUCA 4J5TA 1JZ4A 2YI9A 2IH1C 1P84H 1YBKA 4I5SA 1YJ9V 2XNDG 1KB9F 5AW0B 3BPZA 1G4YB 1JM0A 2R72A 3Q3DA 4JI8O 3IAOA 1OVVA 1V7XA 4WFEA 1I0HA 2ZJSE 4W80A 3H1LE 2BTQA 1URQA 2AXTE 3ABKC 1NTZJ 4BW5A 3CC4P 2CTRA 3F5WC 3K06A 3BA8A 4WF9V 1XTGB 4EYYQ 1KILE 4ZBMA 4AILC 5HFLA 4OPHA 3BCCE 4MW3A 3I56P 5EYPA 2AHZA 1SQXE 3P3PA 5AW8B 1LVNA 3K0GA 2K1AA 1NSXA 3IFMA 5GW7A 2YO3A 1SQBH 2P6JA 3KYQA 3QFZA 3VD7A 2JGDA 1M57B 3L73H 1HNZB 1GL2B 3SFEC 3QTCA 3HRNA 1K1WA 3TCUA 1VQLV 5FLXN 2YDEA 4U3JB 1XMOO 1A02J 3F5HA 1UI7A 1H2MA 3IFXA 2D73A 1DF4A 1W0KG 1L0LG 1LTIC 5EZYA 1K4CC 4QJFB 4K8ZA 2F7PA 1SQPK 1H8HG 3BVVA 3M9QA 1JY2O 1WLEA 2M7WA 1JMBA 1YQ2A 3QWOC 2ZE7A 2YFOA 3FFQA 2O1JA 2QWPB 1X1JA 2ZXWB 3OR6C 2E42A 4NEIA 2EILB 1QBZA 1FJGO 1SQQE 3ALAA 1L0LD 2UUCO 3OAAG 1T6AA 2PP6A 3OBAA 4RQEA 1VF7A 1FZEA 2AEMA 2LP7A 3RYCA 4ZHQA 1NTKG 5J2TA 1QGKB 2PFXA 3M9HA 4HJGH 2Y73A 2AGAA 1VQPP 1AR1B 2CFLA 4UCRA 2WDAA 2GBOA 1K97A 4L76A 1URQD 5KMGA 5EK0A 2I8DA 3L75J 2FTKA 3K57A 4HYOA 2CK3H 2P58A 2WA3A 2A06G 4YHHO 5J9PC 2QJYC 1D6UA 3RK2D 1WPBA 4DW0A 3OS7A 2ARHA 3IC9A 4GODA 4UCSA 1FZCB 5KLVE 3CC2P 5KHKA 1QNMA 4DR3O 1URQC 2QM7A 4W7YA 4Y99C 4JYBA 4X65B 1KP3A 3Q5SA 1GDTA 3RYIB 3WVFA 2YMYA 4QNHB 1IK7A 2NPSB 3W68A 3CCLV 1HJBA 2YICA 3J80N 4LFBB 2CPBA 3V6IA 3LDEA 3CCMV 4YIOA 3DSQA 2DWEC 3L4FA 1Q90D 3L70G 4O2AB 1KC8Q 5KBPA 1MA1A 1M9NA 1QR9A 4YJ2A 2PI4A 5L3FA 3MV11 1ZX3A 2B88A 1EDLA 3T1HO 1Y66A 1FBMA 3KZIH 1E79G 2ITAA 4PHZA 4TV9B 2CIQA 1RF0C 2OW7A 1DTOA 2YKQA 5CJ0A 5L3DA 5APQA 2IZ1A 1FXVA 3VMAA 5AVZB 1YZBA 3L71G 1R3JC 4AQRD 5LYJB 1N7SC 1PP9E 1JO5A 1SQVE 5E79Z 3V4QA 3N4XA 1SFCB 2WYIA 1FFTB 4LCUC 4LF8B 1PV0A 2A0LA 3CRMA 1K1YA 4JPRA 2IU0A 4CS4A 1JFFA 1PM9A 2Q9LA 4UCOA 5H2FE 3B09A 3H1IJ 3I55V 2E2UA 4FM1A 3CHXA 2ZDIC 3G3ZA 2F7RA 3AE2C 2K9YA 1H8AA 5JMFA 2GDSA 2HEPA 1XTCC 3CZNA 1R6KA 2BTQB 1SNZA 2X03A 4DR7O 4FFKA 5AVYB 3O9OA 1URQB 1GZLA 3DCDA 1XILA 2Y69C 2M0BA 1AQ5A 1MMYA 2P67A 3X3XA 1R73A 1NAYA 2DJVA 1JPXA 1DYUA 2GV9A 3ABUA 2NZ2A 3OMIB 3H1JE 1NTZK 5M1BA 3RK2B 1UG9A 4RJTA 5EYPB 1FU1A 2FKWB 1IC2A 1S4XA 3BUDA 4UCTA 1NU1E 4NTXA 5EIBD 3KZIZ 1EN5A 2IJIA 3T1YB 5APSA 1Q82Q 4YY3B 5IYDO 4BIOA 1XL4A 3TJTA 2JGDB 1NS4A 2JS5A 2JR8A 4J9ZB 1F9GA 1KKCA 1OW6A 2WWWA 2LFRA 2QA4V 2E75D 1NJIW 2LKMA 1EXJA 5EZYB 2BCCG 1AI7A 1Y6XA 3KCYA 1FJKA 4BIUA 1RE3A 3STZC 1WMNA 4KFFA 2E75C 5BU8B 4X65O 4B3RB 3K08A 3H1LJ 3RRSA 1VL2A 5AVUB 3CCJV 4DR2O 4B86A 2EIKC 3AE3C 1MMXA 2ZYDA 1K4DC 3CXHF 2BCCD 3D70A 4LWSA 4UB6E 5CCGC 3JD1A 2CWUA 3RYCB 4PDRA 4ZHQB 4RUEA 3AK3A 2Q0OC 5J2TB 1N86A 2N1TA 3GMAA 1ZP0C 2IJJA 2IW5A 3W67A 2RH0A 4IIJA 4MVMA 1Y67A 5KMGB 1IO4A 3AE8C 3M9BA 1XNRO 1H38A 4U7NA 2ZE8A 1KYOD 3CX5E 1DP0A 4IL6E 1QAFA 3NJVA 1ROPA 1MNGA 1PS3A 1L1FA 3VD5A 4XA4A 1TVKA 3E22A 2IBZD 1YJNV 1I7FA 2JEEA 1AV1A 2UXDB 1J1EB 3UIAA 3M0DA 2YIUB 1ZR2A 3X3ZA 4O4HB 3AE7C 3WA3A 1AROP 2HR3A 2WSSG 3WG7B 4LF8O 4E2LA 3CCSV 2JJ2G 2JWDA 4YJ2B 3D50A 3RWRD 1IZNB 1OXZA 1JJOA 1I08A 3LIEA 2C10A 3P3NA 3I3BA 2VQEB 4MMHA 3OTOB 1RF1C 4D7TA 2UUAB 4IL6Z 3S3WA 2MJZA 1G2CA 3AFLA 4PJ0E 2NLJC 4DV3O 2ZXEB 3NTNA 5B5EE 1GH6A 2YX9A 1BE3E 2WSCJ 3BVUA 3AEIA 1EM1A 1HN1A 3MGNA 3L74G 2C11A 3MHVA 4XBFA 5IWAO 1RE3C 2WITA 4R4MA 3SYAA 3LW5H 4H13D 1MMZA 3T1YO 5L3CA 1LNQA 3HR0A 3K58A 1FJPA 4FM0A 2N1TD 3W7TA 4PELA 5K1PA 3E35A 1R1BA 5B1NA 3H1KJ 2JJ1G 1BQZA 2YXHA 1DD3A 3WFVA 3E8FA 1KFMA 3B8EB 1JFFB 3L74D 3R2PA 3MI6A 1S2EA 4Q20A 1T8ZA 4HAMA 2Q67A 2LW1A 3H1ID 3N2GA 1KILA 4NTWA 1IU7A 1OCRB 1TGOA 3U10A 1Q7YQ 4U3FH 5B5EZ 3CZJA 5AG2A 4P9PA 3FB8C 1S5HC 4UV8A 2R70A 4LF5O 3FYEB 5LOVA 1YJ9P 4B3RO 4LF6O 4C46A 1KSIA 1DEBA 3VQXA 2WLHA 2B87A 1FS0G 1QHTA 3JD0A 4J11A 1PKXA 1P84I 1L0NG 1I94B 2YIAA 1NTMJ 1QVGO 1EZVE 2LXBA 4DR5O 3C90A 1N34B 5EBMC 1N7NA 4JI1B 1JR9A 2QSAA 1WPXA 3WU2E 3HKDA 1LUWA 1YSCA 3A0RA 2LW7A 1T3UA 4DUYO 2QJKC 3VSMA 5EFWB 5JQGA 2BOBC 2RN9A 1FDIA 3FXDA 2WPRA 2WO0A 2JGUA 3EXAA 3AEGC 1BSNA 1OCZC 1O9GA 2FKXA 4X1YA 4F6EA 3HD7A 2E43A 1N7PA 2BRVX 3ZN0A 2WW1A 3BASA 1I8QA 2E74D 2B1GA 2O01J 3BCCG 3A3YB 2UXDO 4JI3B 1KN7A 1SQPH 2XV5A 3H1LD 1JY3P 1NSMA 3H1HJ 3RN4A 3CC4V 1CXZB 4DV5B 3VMZA 5BU5A 1TAEA 4LWSB 1IX9A 3ASOB 4H13B 5BY1A 2HG5D 3HB3B 4KP4A 4PV1C 1VQNP 3ABLC 3SPHA 1JEKA 1VEWA 3H6PA 2N1TB 1KILD 1V55B 4DRXA 3I56V 4R6ZA 2E74C 1LTSC 1GU4A 4FNRA 3BCCD 4BRYB 1SQXD 3HUSA 3OW2O 4IIJB 2Y0PA 3MV01 2OOVA 4IHJA 4O4IA 1EXIA 1SIIA 3VD3A 2HG5C 2YSUB 3JSNA 1MV8A 3BRVB 3VP8A 1XUQA 1QVFU 1HMWA 2ITDC 3UCSC 2Q8VA 1YYCA 3E22B 2OW6A 4ZI7A 1AV4A 3N27A 1SQQG 3BA9A 4XE5B 2PYLA 1MFTA 3AEEC 1PNLA 1Y4MA 3KKYA 3X2QC 4LF7B 2FYUJ 1X1HA 2XN1A 1NTKE 1SIHA 4WBNA 1M56B 3QG0A 2FYNC 4O4LA 2R5DA 3K5TA 2QM4A 1GK4A 3ZMTA 2CISA 2PZSA 2I1JA 2Q7HA 5LMUO 1DGSA 2EBOA 3L72H 4O2BA 1SQQD 1KD1W 2KKWA 2QWQB 2A06E 2E2TA 1RM1B 3HD7D 1PGJA 1PGPA 3CCRP 2ZCEA 1X9VA 4LF4B 1G2CB 1VQPV 5KUMA 1HN0A 1KQLA 1ZLLA 3D51A 2CFWA 3RK3E 4QPJA 1EDIA 2OIGA 1YEWA 4EDFA 5KLVG 1N8RQ 2BE3A 3M8AA 2PAJA 2Q6QA 2GTAA 3G67A 4MTGA 2QSIA 5B1AB 2N9BA 3HD7C 4DV2O 2QE7G 3VDBA 2E74B 1NJIQ 3FKSG 3L70E 4DV4O 5CCHA 1UI8A 3CC2V 1BDCA 2IM9A 1M1JC 1SP4A 3CMAP 5L3EA 3B5ND 5KLVD 1OMIA 5LXTA 4I50A 1HGZA 3E7JA 1N34O 2PTMA 5BXZA 1RQVA 1CB8A 3P7KA 5CMUA 3WB0A 2JK5C 2P7JA 1DX7A 1KV4A 4JI0B 3N2GB 2ZIMA 1KILB 1ZRTE 2RKLA 1AVOA 3V2NA 2GM4A 2YC0A 3JASA 3ABVC 4JI6B 5IYZA 3B5NC 1QWUA 3L71E 4LFCB 3CC7P 2ZE5A 4H44D 2Z5HA 5KAFE 2A9HA 2RDCA 5LOVB 4JI3O 5H6QA 2P7TC 1FZFA 1JRQA 1EC5A 1BHBA 2OTLP 1PP9G 2B87B 4HZ3A 1SQVG 3VP9A 2W27A 3VYIA 1JYXA 3GLMA 4QGPA 1LWUA 1NR7A 4CS3A 3QDEA 2PI5A 3FD9A 1JY2P 3QVNA 1IFNA 4H44C 4XDJA 1TQUA 3ZJZA 2D3OW 1KQSO 2EIJC 1HDJA 2UXCB 3AG4C 1TUBA 1MUUA 3UT5A 2OGUA 2X6BA 4ZKIA 1EDKA 4FNUA 3CWBG 1ZSPA 3U0ZA 3MIWA 2JDIG 3VN0A 1PP9D 2ZINA 1SQVD 1NTMK 5AW6B 3BEHA 2FFDC 1RWHA 1XOUA 3BVXA 4AQYB 2EIMB 3HKBA 2YXRB 5AVQB 5JQGB 4PDVA 2Z5IA 1F7YA 5LGTA 4LF9B 4X1YB 3L37A 3H1JG 3AE4C 3HD7B 3OR7C 1J95A 1YDXA 4DUZB 2FXOA 5JJEB 1JCHA 1VF6A 5CCHD 4TQDA 1NU1G 3U1CA 3F5TA 1U96A 1NVPD 2RDYA 4D6TE 2ZT9B 1USEA 5AW9B 1KYOF 1DK1A 4WVZA 1NWQA 4PA6A 2KG7A 4WB4A 1KQFB 2P5OA 3H1JD 1S5LH 3RBXA 3CS5A 4DRXB 1X0TA 4KL1A 2SPZA 1SF9A 5LHIA 5CCHC 4UFZA 1ZOYC 2QTSA 5H6RA 3HUSB 4MMIA 3DDFA 1NU1D 1AB3A 4B3MB 2PGDA 3A0HH 4IHJB 1W7CA 4O4IB 3VQWA 4P30A 4B3SB 1N7LA 2AEJA 3A0BH 1A32A 4BWAA 5CA1A 3K5MA 2B1IA 3Q1MA 2DYRB 2HLDG 4ZI7B 4X89A 4H44B 1MG1A 3E1IA 5KAIE 3CRCA 3L75H 1X1IA 2F23A 2D2CD 4WBNB 4GUNA 2MKVA 1J0NA 1G1JA 3D4ZA 1BGYE 3BVHA 1ENVA 2I1KA 2QDOA 2XN2A 2FYUK 4Z2WA 4A5UB 1IFMA 1LWUC 1NH2D 4JI8B 2K37A 2IBZH 4O2BB 4OX9B 3ZHRA 2OYIC 2WLIA 3ETDA 4OVNF 4TLFA 3GF3A 2VS0A 2D2CC 4N6JA 1IURA 3JD2A 2YMKA 1PGQA 2H8PD 1L0LJ 4LNUA 2HPCA 3S4CA 5KX5A 3OD4A 1S5LX 1U7JA 3R65A 2K9JA 1RSOA 5LP6A 1JX9A 3IAQA 1VARA 1PPJG 1MZEA 3CX5D 3W7WA 2H8PC 4L87A 1XBLA 5IY5B 1L7KA 4TQFA 3JCUH 3IJ4A 4GYCB 3J7HA 4DV1B 4LH7A 1H2LA 1WP7A 1NVPB 1Q82W 1HNWO 2M3BA 5AW7B 3T2QA 4I50B 1LTJA 1IFPA 4DR1O 2QKSA 2OYHC 3BVOA 3ETQA 1NTKJ 3LSSA 1WNSA 4IYIA 2QKCA 5JH7A 1JOCA 4JV5O 4JF3A 3T2MA 3JASB 1VQ7P 1F51A 4JI5O 5GTHE 4LF9O 5IYZB 1BE3G 3E2EA 4BWNA 1JNMA 2CH7A 3Q1NA 4GIFA 4DUZO 5F2VO 1PGOA 2RMKB 1BDDA 2IH3C 2RCVA 3H1IH 3WB1A 2P4VA 3K79A 3LSQA 4JI4B 1LWUB 4MTFA 3CCUP 1W2BU 1LT9C 1Q6IA 2BTOA 3B8NA 4AI8A 1BE3D 1OX3A 5TISH 2YNYA 1LUVA 3FWLA 1BT8A 1SRYA 2HTAA 1TUBB 1GK9A 4J7JA 3UT5B 4NPDA 3CYOA 2F93B 5KUKA 4B3MO 3JD4A 2GHYA 2Q7GA 4Z1MH 3L70J 1SKVA 4YHHB 1KP2A 2WOFA 1NSSA 3BGAA 1NH2B 3NBJA 1JZ3A 3VDAA 2LQTA 2EJRA 3BHPA 3SPIA 3ZRXA 2V1DA 4WCEV 1EDJA 2YUAA 1VP7A 3ZHQA 4YIPA 1YQ3C 4FMTA 5TJHA 1W0JG 2E76C 3RGUA 1Z5WA 4X62B 4K0KB 1QL1A 4I7ZC 2JEUA 2ZXXA 3B40A 2JRIA 5BVZA 3BABA 1L4AC 5AVTB 2ZE6A 5A2QN 1S1CX 2CIRA 2VWJA 1FXKC 3C8VA 3I5CA 4C7NA 1KD1Q 3FB5C 3SXXA 1QWNA 5LP6C 3ZDMA 1L0NE 1F4HA 1N33O 2KG7B 2X6AA 4X8AA 1SO0A 1EZVG 3G6EP 3DGEA 4DV0O 1FPOA 1S0VA 4OX9O 1D6ZA 5BR8O 3T1HB 5L8RJ 3TGUG 3H1LH 1NYHA 4N78E 1VQMP 1LTJC 1NH4A 5D5PA 1U7MA 2KLUA 1P84E 5LGUA 1DEEG 2RQ6A 2O3JA 1EZVD 1G8MA 5CA1B 3ML0A 1J1DC 3OB8A 1IXBA 1GRJA 2OCHA 2W0XA 1IQYA 1BMFG 4FZ0A 2B9ZA 2ZNIA 5IJ9A 4ICGA 4DV1O 3ZMSA 3S1KA 1KB9H 1NSZA 4I0XA 1RF0A 2FXMA 1XI1A 5AW3B 1MABG 3AEBC 1OZ0A 4TTGA 1FAFA 3M91A 3BRCA 3AFJA 3FGAD 4AUWA 5DN6G 1NOHA 4L73A 4DR7B 1XHXA 4PD4I 4DT0A 1SQPG 4W4KA 1J0MA 1AJNA 1SQBE 1VQNV 4OPAA 1N7SA 3L73E 1PL4A 2DQ3A 1RW9A 3E89A 3N2KA 4NPFX 4F4LA 5CBOA 1VQ5P 4LNUB 2HPCB 1HM3A 5KX5B 1Q7YW 2BCCJ 2K9JB 1RSOB 1W4NA 2VQFB 2QJPC 3BY6A 1L0LK 4JI4O 3IF4A 2ZR3A 2ZDIA 1K34A 5A1AA 4I6MC 1VQ6P 1PX4A 1ZAUA 3ABKB 3KXDA 1NS7A 1NI8A 2PY5A 1OWAA 1FXHA 3S9OA 1N4CA 2WSCH 1RPRA 4B7EA 1LTJB 3VTPC 2OARA 1TQTA 2UXNA 2ETNA 5JH7B 1NTKD 3A2AA 1HGVA 2CDYA 3MUDC 1M5IA 4FLZA 2XZRA 3T4DA 1XQ8A 1K9MW 2O01N 3QFYA 2WLMA 4DUVA 3GWOA 4JTDB 2CH7B 3VOPA 4UB8H 1RP3B 3H1KH 4X62O 4K0KO 1RY3A 3NJXA 4DR2B 3EFGA 4YTPC 2XDJA 1LGHB 1OJHA 2A06D 2JS3A 2C0WA 3D3IA 4GX1A 3CCRV 5E79E 2L5GB 4NB5A 3WFAA 2CE4A 4UCVA 4JBZA 3VQVA 3D52A 2Q68A 3DXRA 5JCOC 1R3LC 3RK3D 4GKJO 3JAWA 4X1IA 1K04A 1M7LA 3EWKA 2FYVA 3SYPA 4UVCA 1XEQA 1VPCA 3OGIB 3ZHUA 2ZFCA 2PGGA 4DW1A 2XTAA 1CP9A 1N7SD 2G8YA 4J7ZA 4F6RA 1XNRB 2FXPA 4ASWA 1I5YA 4IFDK 4LFAO 2N04A 4LGDE 3L70D 3CMAV 3RK3C 3Q4HA 1RE4A 5IJ0A 3E83A 3J81N 1Y9BA 1QLEC 5CCGA 2QVAA 1AI4A 1S77D 3AK1A 3CP1A 1NTMH 3LNNA 5CBGA 1WP8A 3OTFA 1ZRTD 3KZIE 1IVUA 3L74J 4G27B 4C7NB 4CS2A 1NSRA 3CC7V 1YTFD 1VQ9P 2KB1A 3L71D 1QQCA 1BCCG 2FUQA 1M93A 1P49A 2QJYB 3AG2C 3CWBE 5H2FH 1W5ZA 5CN0A 2A45H 2OTLV 4J80A 3JC22 4GKKB 1FE6A 1TQVA 2O01H 4Y99B 4DV6B 3TETA 4DV3B 5JJNB 4X1KA 4JYYA 3H1HH 1FZBA 3G4SP 3BRTB 1NHLA 2ZNJA 1NTZG 5IWAB 2FBWC 4MVUA 5KHGA 2VQFO 4L74A 3P8CE 3DDGA 2E3CA 3SYOA 1N8RW 2CGOA 4AHCA 1BSMA 1GD2E 2EINC 4D6TG 4PA3A 2KSDA 2ZQMA 5B66H 5IJ9B 1RF1A 3IAPA 4P2ZA 1AVKA 5CBHA 2RJZA 4I0XB 3RVZA 1HWWA 4DYLA 3MHSC 3K5BA 1NR1A 1XMQB 4J7KA 2OTJP 1KKDA 4OH8B 1LOHA 3RK3B 2CFKA 3EJTA 4FJCC 4D6TD 3THOA 1W2EA 2C9NY 5CCGD 1LURA 3H9VA 3CX5F 2FYUH 1N7SB 2CQSA 2V4DA 4LF5B 3N2KB 3BUPA 4LF6B 3W7XA 2WVXA 3DX1A 1V54C 3G9RA 2H7HA 3AK2A 3WB2A 1P4RA 2M3EA 1RE4C 2XT9A 2WLLA 4EEQA 2Q6AA 1R34A 2B89A 3T0BA 3AG2B 3BCCJ 4UB6H 1SQXJ 1BGYG 5CB4A 1F4AA 3ASNC 2E5LB 4DR6B 4DR5B 2Y69B 3AG1C 5IDJA 4NXMO 2BRPA 2HODA 1YTFB 2IBZI 5H9CA 2JIZG 1OVRA 4OXSA 2YEVA 1ZUQA 4DUYB 4FLUA 4BR6A 4X64O 2H43A 1GAXA 3X42A 1WB7A 3WIRA 1BGYD 2XNXA 1YVWA 3QNEA 3H32A 2X6CA 4TT3H 2EINB 2O57A 3RYHA 1HH0A 2AZ2A 4ZMDA 1Q3EA 3CXHH 3D36C 1PPJE 4D7SA 5JVDA 2KXPB 4MVSA 4OWFA 4BZFA 4KHXA 2OCCC 3FB6C 2FYZA 2OTKE 1KUQA 1SQQJ 2XAFA 1Y76A 3DXRB 2WMMA 3JAWB 4X1IB 4YXWG 4GX2A 1OHHG 2ZKOA 4GKKO 1K33A 4B7KA 3F7YC 3G71V 5DJUB 2YFNA 4DV6O 2E75B 4F6RB 2HJFC 4FM2A 2Y4UA 2EIKB 3RL0D 2G3AA 1NKDA 3Q4HB 2RMZA 3P8MC 3LDCA 4HNAA 2R5BA 3M7MX 1YJWP 5IJ0B 1P7GA 3C1LA 2EADA 2MW2B 2R32A 1U57A 2J5UA 2XUMA 1ORQC 1D5NA 2IFNA 5KLVJ 1VQ7V 1YITP 2LJ2A 3RL0C 1MKMA 1COWG 2EJ7A 4IL6X 5APXA 1Z56A 5LMUB 1XMQO 3KDPB 3WIQA 1HVVA 1B3QA 3HI7A 5LHHA 5GTIH 2W6JG 4FPPA 4PDLA 2W6AA 3CCUV 3KPEA 1CPYA 4MVRA 3CJHA 2J59M 4X1KB 1J2JB 2ZYAA 4WY4C 2ZQ0A 1SC5B 1E1RG 2Q73A 2VRSA 1JJ2U 4UXNA 2QJ1A 3U59A 1VQ8P 1RQUA 4PDMA 1J5EO 1NZ6A 3FB7C 2W6BA
chains in the Genus database with same CATH topology
3DX3A 1EDKA 3EJQA 4KJMA 5K5GB 1BDDA 1HTYA 5KBPA 3BUQA 4GOEA 3BVXA 2F7OA 1TQTA 3BUPA 2K3RA 1PS3A 3DX1A 2B88A 1EDLA 1HXKA 1FC2C 2F1BA 1OVUA 4NPEA 1H0TB 2OW7A 1R34A 2B89A 2HR3A 5C39A 4NPDA 2M5AA 3EJSA 1JM0A 1OVVA 2R44A 3DX4A 2JWDA 2KI7B 3D50A 3BUIA 1OVRA 3BVTA 2OW6A 1X0TA 4JBZA 2KUBA 1EDJA 2SPZA 3D52A 2WYIA 2F7QA 4EYYQ 1MFTA 1LT1A 4IOIH 2F18A 3CV5A 3DDFA 3RGUA 2FYVA 3BVUA 4K35A 2KZJA 2M5AB 1TQSA 2F7RA 3EJTA 3MHVA 3MZWB 4ZMDA 4ASWA 3CZNA 1QWNA 1LP1A 3ZDMA 4HB1A 5CBNA 2M0BA 2WYHA 2LXCB 4ZNCA 1NVOA 3PH0A 2OTKE 1S3JA 2WMMA 2QVAA 4GOFA 3D51A 1QX1A 3EJUA 1TQWA 3BUDA 1EDIA 2F7PA 3D4ZA 3EJPA 3BVVA 1O7DD 5DJUB 1JMBA 1U7MA 3DX2A 3QWOC 2ZAEB 1DEEG 2Q1KA 1LP1B 2KIKA 1BDCA 2QRXA 3D4YA 4WWIA 1TQVA 1SS1A 1ZXGA 2B87A 4HJGH 1U7JA 3S1KA 3FXEA 2LR2A 2RKLA 3BUBA 3LVTA 4CPGA 2I8DA 3DX0A 1QWUA 2LXBA 2P58A 1Y47A 3DDGA 1Q2NA 1R33A 1ZW0A 5DJTB 3BVWA 4HKZH 1EC5A 2UWJE 4K3AA 4GODA 4MN4C 4NPFX 2B87B 5CBOA 3BLBA 5EFWB 3CZSA 3FXDA 3EJRA 2KZIA 1HWWA 1H0TA 2KS1B 1TQUA 2F1AA 2ALWA 4ASVA 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DX3 A;  1EDK A;  3EJQ A;  4KJM A;  5K5G B;  1BDD A;  1HTY A;  5KBP A;  3BUQ A;  4GOE A;  3BVX A;  2F7O A;  1TQT A;  3BUP A;  2K3R A;  1PS3 A;  3DX1 A;  2B88 A;  1EDL A;  1HXK A;  1FC2 C;  2F1B A;  1OVU A;  4NPE A;  1H0T B;  2OW7 A;  1R34 A;  2B89 A;  2HR3 A;  5C39 A;  4NPD A;  2M5A A;  3EJS A;  1JM0 A;  1OVV A;  2R44 A;  3DX4 A;  2JWD A;  2KI7 B;  3D50 A;  3BUI A;  1OVR A;  3BVT A;  2OW6 A;  1X0T A;  4JBZ A;  2KUB A;  1EDJ A;  2SPZ A;  3D52 A;  2WYI A;  2F7Q A;  4EYY Q;  1MFT A;  1LT1 A;  4IOI H;  2F18 A;  3CV5 A;  3DDF A;  3RGU A;  2FYV A;  3BVU A;  4K35 A;  2KZJ A;  2M5A B;  1TQS A;  2F7R A;  3EJT A;  3MHV A;  3MZW B;  4ZMD A;  4ASW A;  3CZN A;  1QWN A;  1LP1 A;  3ZDM A;  4HB1 A;  5CBN A;  2M0B A;  2WYH A;  2LXC B;  4ZNC A;  1NVO A;  3PH0 A;  2OTK E;  1S3J A;  2WMM A;  2QVA A;  4GOF A;  3D51 A;  1QX1 A;  3EJU A;  1TQW A;  3BUD A;  1EDI A;  2F7P A;  3D4Z A;  3EJP A;  3BVV A;  1O7D D;  5DJU B;  1JMB A;  1U7M A;  3DX2 A;  3QWO C;  2ZAE B;  1DEE G;  2Q1K A;  1LP1 B;  2KIK A;  1BDC A;  2QRX A;  3D4Y A;  4WWI A;  1TQV A;  1SS1 A;  1ZXG A;  2B87 A;  4HJG H;  1U7J A;  3S1K A;  3FXE A;  2LR2 A;  2RKL A;  3BUB A;  3LVT A;  4CPG A;  2I8D A;  3DX0 A;  1QWU A;  2LXB A;  2P58 A;  1Y47 A;  3DDG A;  1Q2N A;  1R33 A;  1ZW0 A;  5DJT B;  3BVW A;  4HKZ H;  1EC5 A;  2UWJ E;  4K3A A;  4GOD A;  4MN4 C;  4NPF X;  2B87 B;  5CBO A;  3BLB A;  5EFW B;  3CZS A;  3FXD A;  3EJR A;  2KZI A;  1HWW A;  1H0T A;  2KS1 B;  1TQU A;  2F1A A;  2ALW A;  4ASV A;  4BXL A; 
#chains in the Genus database with same CATH topology
 1G6U A;  4DV2 B;  1FOS F;  2M6Y A;  1EGU A;  2EZP A;  4DV4 B;  3U1A A;  1JMM A;  3WUV A;  2K3R A;  2E5L O;  4DR6 O;  1UPG A;  2JEX A;  3MDS A;  3KQG A;  3WUT A;  1RF1 B;  1PP9 J;  2XND H;  1SQV J;  1K9M Q;  3SWY A;  4NPE A;  3TGU E;  5C8Y A;  4MW8 A;  1JMK C;  2QM8 A;  1K5Q A;  2BSK A;  1PNK A;  4I55 A;  3WU2 H;  1KBH A;  1MOF A;  3GHG C;  1H2S B;  2F4V O;  3B77 A;  1L0N D;  1IJD B;  2GSM B;  1NBM G;  2OQQ A;  4WFH A;  4CBC A;  3CWB J;  4PV1 D;  1HBW A;  3G6E V;  3CME P;  3E86 A;  1CEZ A;  2WVX B;  3MWX A;  4LBE C;  1M1J A;  1FOS E;  4TOI A;  1K92 A;  2YIB A;  1AFO A;  2KUB A;  2WLL B;  1VQM V;  4PA4 A;  2ZYG A;  3BS6 A;  1IVV A;  4IOI H;  4N78 D;  1M90 W;  3H1J J;  3MD0 A;  4PD4 F;  4YPC A;  1P84 D;  1CZQ A;  3EFF K;  1L7J A;  4W7Z A;  4N23 A;  3SEP A;  4IT5 A;  1NU1 J;  1KB9 I;  3B5N A;  2DWD C;  4DO2 A;  1R8E A;  1L0L H;  1SQX K;  3ZBH A;  1SQP E;  3ACT A;  1NVO A;  3AG3 C;  2YEV B;  4CC6 A;  4EIJ A;  1SQB G;  2Q9I A;  4JAA A;  5H5N A;  3L73 G;  4N21 A;  2EUL A;  3AEC C;  1JOV A;  1TUE B;  3M06 A;  3EJU A;  1TVK B;  3MUY 1;  1L8D A;  3H32 B;  4JI2 B;  3MP7 B;  3CCE P;  3DC5 A;  2A79 B;  1THZ A;  1D5A A;  3RYH B;  3T2O A;  2XN0 A;  5CA3 A;  1C82 A;  4PD4 E;  5KLI C;  5JVD B;  3D3Q A;  4JZG A;  3PRJ A;  1SQB D;  1GN6 A;  2N74 A;  1NTK H;  2XAH A;  1OJO A;  5JJJ B;  3L73 D;  1VQ5 V;  4RNL A;  2QWN B;  2FFD A;  3D4Y A;  1Y76 B;  2QJK B;  4IYH A;  3CI9 A;  2V7Q J;  1RWG A;  1SS1 A;  3NR7 A;  4DXW A;  1SER A;  1ZXG A;  4RO0 A;  4O4J A;  4BTY A;  1OCZ B;  3QO5 A;  3VOU A;  1SQQ K;  3FXE A;  1MN0 A;  1RKY A;  2A06 H;  3BUB A;  3KII A;  2NR5 A;  1VQ6 V;  4CPG A;  3ZMV A;  1H2N A;  2H94 A;  3L36 A;  2KQX A;  1VF5 C;  4KT0 J;  1EN6 A;  4NVP A;  2YIB D;  2WT7 A;  1S9K E;  3OE7 G;  4HNA B;  2Y9Y A;  2GUS A;  2QGN A;  1R33 A;  2C2A A;  5DJT B;  3BVW A;  3L72 E;  4GX0 A;  4PV1 B;  3ABL B;  2HVJ C;  1IZ3 A;  4KHP O;  2R3S A;  1EKM A;  1V7W A;  1OIP A;  1XRE A;  2CK3 G;  4TWK A;  3LSU A;  1FKA O;  3LNM B;  3L70 H;  3ZRW A;  1NKZ B;  3T0A A;  2PYJ A;  4I9Q A;  4ZKP A;  1TA8 A;  5KLV K;  3SGI A;  2VWK A;  4TUY A;  3CL3 D;  1E79 H;  1KQG B;  1HTY A;  3SFD C;  3FYI B;  1AJY A;  2HTB A;  4NR1 A;  5FPR A;  3V2R A;  3CJH B;  1N7O A;  3JD3 A;  3K0D A;  4KUM A;  3X2Q B;  1AR5 A;  3L71 H;  2F1B A;  1VMG A;  1UFI A;  1N73 C;  1HF9 A;  3JAR A;  3VDC A;  5IYB O;  2FYN B;  3LDD A;  1BE3 J;  4FLT A;  2EZO A;  4NKG B;  4YXD C;  2P22 C;  4JTC B;  1W2Z A;  3ZIA G;  1YXB A;  2RN0 A;  3DX4 A;  2C9L Y;  4JPZ B;  2XHB A;  4H0L D;  2OYI A;  3HIG A;  1OV9 A;  1BCC E;  1G1X B;  3HKE A;  1OJP A;  1HNW B;  3BUI A;  1GN3 A;  4DR1 B;  1GK6 A;  2A45 I;  3N7N A;  3AEA C;  5C8Y B;  3HKD B;  2BSK B;  4JV5 B;  4I55 B;  4FVM A;  1SQV K;  4H0L C;  3PP5 A;  1VQ9 V;  4JI5 B;  3E1R A;  4CH5 A;  2F1M A;  1U97 A;  2WW2 A;  1AP6 A;  1NTZ E;  1RJO A;  1Q43 A;  2DYS C;  4JI2 O;  1OCC C;  1MMU A;  4ZKU A;  3CWB D;  2OYQ A;  5K1X A;  4ZOL A;  3GG2 A;  2WYH A;  2AW9 A;  4I4T A;  1M1J B;  1O9H A;  2CAZ C;  3PH0 A;  5L3G A;  1H2K A;  2OQE C;  1Q81 W;  3HE4 A;  4DV7 O;  2OYH A;  3G4S V;  4NXN O;  1M1K W;  1CI6 A;  4P9O A;  2DE0 X;  3JAK A;  2FL4 A;  3OUS A;  1TU5 A;  1H88 A;  4UVA A;  4B3T B;  4MTO A;  4MSW C;  3EQ2 A;  3AMO A;  4ZIB A;  3B5N B;  1RHZ B;  3P8C D;  2BCC H;  1NU1 K;  1X59 A;  1S72 P;  1LF6 A;  1JCC A;  2QRX A;  5HFM A;  4L8J A;  1SZT A;  1GM8 A;  5KA5 A;  2GUV A;  4GX5 A;  5EBL C;  1GW3 A;  2IX7 C;  3NFQ A;  3TGU J;  3TYY A;  2ZIO A;  2OTJ V;  1LT9 A;  1Y8A A;  1YHQ P;  2WZS A;  3MUZ 1;  1DF5 A;  2EIJ B;  4NTY A;  1LTB C;  3A0H E;  3AG4 B;  2K88 A;  1B04 A;  2ADQ B;  3CRA A;  1RWA A;  1KYO H;  1KTM A;  3VMY A;  1IBK O;  4JI7 B;  1AVM A;  4O4L B;  2P2U A;  1N33 B;  2FFD B;  4DZO A;  2Z3Y A;  3VQY A;  3BLC A;  4DV0 B;  4HKZ H;  2KK7 A;  3APO A;  5BR8 B;  4MN4 C;  4O4J B;  2JKP A;  1JZ7 A;  2UXX A;  4FLW A;  4OGQ C;  2DW3 A;  2IFM A;  4KTR A;  4XFJ A;  3L75 E;  1H0T A;  1B06 A;  3SYQ A;  2A3Q A;  3ABM C;  1L4A A;  1R6T A;  2WT7 B;  2OIE A;  1S5L Z;  2DOS A;  2WSF J;  1FXK A;  1WJZ A;  5AVS B;  2Q3E A;  3A0O A;  1QR8 A;  5K5G B;  4UVB A;  3CEI A;  3A0H Z;  1OCO C;  3G71 P;  4DOJ A;  1Z2G A;  3CXH I;  1VQO P;  2Q7E A;  4XDL A;  2Y0C A;  1RWF A;  2OWO A;  3Q5R A;  2PUS A;  2WSS H;  1P7B A;  2ZVN B;  4MVQ A;  1OVU A;  3A0B Z;  3C9I A;  4HYT B;  3S4B A;  3ZRW B;  5LXT B;  4IFF A;  1MZF A;  3TF5 A;  1NGM B;  3CXC U;  3BAT A;  3HKC A;  1D7M A;  2WZ7 A;  4TUY B;  1PPJ D;  2R44 A;  1XNQ O;  1R5L A;  4WFG A;  1UII A;  3HTK A;  1IVW A;  2R9A A;  5B1B C;  3GWK C;  1HR0 B;  3DC6 A;  5B3S C;  3JCU E;  1M90 Q;  1ZME C;  1SS3 A;  2P4K A;  4Q6G A;  5GTH H;  1OAC A;  4FNT A;  2QEX P;  3L74 H;  3AEF C;  2F7Q A;  3JAR B;  1LT1 A;  1QVF O;  4KFM A;  2QWO B;  2QKA A;  3Q5P A;  1NSV A;  2CTP A;  3RVY A;  3TNU A;  1NS1 A;  1KFN A;  2KOG A;  1LXK A;  5LMN B;  1GMJ A;  1JZ8 A;  1N36 O;  4GKG A;  2OYI B;  3RGB A;  2JJL A;  1YJW V;  4B3T O;  2FY8 A;  4Y28 J;  3HKE B;  2D2C B;  1SES A;  4BTX A;  4M3L A;  1AR4 A;  1NKG A;  4RAI A;  2E76 D;  2NRG A;  2CFD A;  2P10 A;  2XAG A;  3ABM B;  3UO3 A;  1M57 D;  3JAL A;  1L4A D;  5LBQ A;  3PN1 A;  1YIT V;  2W6I G;  3HKB B;  1IBL O;  2Z0A A;  1VQK P;  1QX1 A;  1TQW A;  5E1Q A;  5DM6 V;  3JCU Z;  1AI6 A;  1M8O B;  1QLN A;  1P84 F;  3JSV C;  5TIS E;  3CD6 P;  1JY3 N;  4TSF G;  4EV5 A;  1NS2 A;  4ZOL B;  1M57 C;  1N9E A;  1AJQ A;  3MPH A;  3EHB B;  1GL2 C;  2JVD A;  4I4T B;  1IK9 A;  4EOT A;  3K5O A;  3L71 J;  4EFB A;  3HE4 B;  4U3F G;  4JI7 O;  2Y4T A;  3OGC C;  2OYH B;  3AE9 C;  2ITC C;  2P06 A;  1CI6 B;  1L0N H;  1VQ8 V;  4GKJ B;  3JAK B;  3LUT B;  2LR2 A;  1SZX A;  3MUD A;  3AMO B;  3GVM A;  1SLQ A;  1NQT A;  2P90 A;  5AW5 B;  1PZQ A;  5E1A C;  2O1K A;  2YXL A;  2Q1F A;  1IFJ A;  2ZXQ A;  5B3S B;  4Z1V A;  4E4E A;  3C3T A;  3K5L A;  4LFA B;  2AXT H;  2ZXW C;  1BCC J;  1QX8 A;  2EIL C;  2K1E A;  2JKE A;  5TIS Z;  3T1C A;  3TXQ A;  1FZG A;  5FPO A;  2H3O A;  4HH2 A;  2UWJ E;  2XAS A;  1PX3 A;  3BCC H;  1SQX H;  1QEX A;  1W6C A;  3MAQ A;  5GON A;  5JCO A;  1LT9 B;  3TGU D;  1R3K C;  2BAS A;  4PA7 A;  3WUU A;  3CCV P;  1LXM A;  2CQT A;  1WRG A;  4BXL A;  4BIZ A;  5CBF A;  1QAK A;  4GDO A;  2B5U A;  3OEE G;  3CME V;  3DX3 A;  1GM7 A;  2D1W A;  3QO7 A;  1SPU A;  3K03 A;  2HJD A;  2NPS D;  4D6T J;  4J41 A;  3CPW U;  2WLI B;  1LTA C;  5CA0 A;  1HMU A;  2JWA A;  1FZC C;  1K05 A;  2X0L A;  2E76 B;  2ATK C;  5IE9 A;  3BAA A;  5APT A;  1H0T B;  4I7Z B;  4R50 A;  1HR0 O;  1NO4 A;  2Y48 A;  3RSY A;  1L4A B;  2Q4P A;  3X3Y A;  4GZR B;  1FAV A;  1KB9 E;  2NPS C;  2HHH B;  2IDB A;  1FXK B;  5AVR B;  5LP6 B;  1D6Y A;  1SQQ H;  2IJH A;  4HBN A;  4IFM A;  5CMZ A;  1SQP D;  1RFY A;  3X40 A;  5B1O A;  2AXT Z;  3DYP A;  5LMN O;  1K73 W;  1XHZ A;  4JYA B;  4K8X A;  4RUF A;  3JAM N;  3SPC A;  1E1Q G;  1NSU A;  3CCE V;  4DR4 B;  5AW2 B;  2FB5 A;  4FFB A;  4BW9 A;  3W7U A;  3PHL A;  1CW5 A;  4OK2 A;  3KHU A;  3E8G A;  3DYM A;  4XDK A;  1SFC D;  3HKC B;  1TQS A;  3O6Q A;  1K3E A;  5ITZ A;  3IAY A;  1BGY J;  4PD4 D;  2W0Q A;  5JMD A;  4FLY A;  1LP1 A;  1LR1 A;  1HNX O;  3VMX A;  5CBN A;  4KTP A;  1ZTE A;  1J1D B;  3HTK B;  1NTK K;  1JZ6 A;  1Q81 Q;  1USD A;  1X8Y A;  2LXC B;  3K04 A;  2KNC A;  5KLV H;  3T2P A;  2NNU A;  1M1K Q;  1GW4 A;  1FZA A;  1S3J A;  5APY A;  2CTQ A;  3SDL A;  1SFC C;  3L72 G;  1JY2 N;  1Y74 A;  2QE7 H;  3EJP A;  4PI2 A;  4I9W A;  1GO3 F;  4CC5 A;  4RQF A;  1IBM B;  4I1L A;  1S76 D;  2E22 A;  5E79 H;  3TNU B;  1ZV8 A;  3K5N A;  5JWP A;  1JUN A;  2DN9 A;  3FX0 A;  2NN4 A;  1S9K D;  4PI0 A;  3RT3 C;  1QLE D;  4DK0 A;  4NXM B;  4UB8 E;  1T2K D;  1IVS A;  3H1K E;  3FAV A;  4FLX A;  3L72 D;  1BZK A;  4MS2 A;  4X20 A;  3GF7 A;  3JAL B;  4QE7 A;  4O4H A;  2F66 C;  4X64 B;  2EAB A;  1QVG U;  1WN7 A;  3K25 A;  2CUG A;  3RK2 C;  2H89 C;  2QJP B;  3A2F A;  1N7R A;  2HFE D;  3OT7 A;  1Q5O A;  3MHH C;  4G28 B;  4CZZ A;  1RH5 B;  1T2K C;  3AE1 C;  2H88 C;  1SVF A;  3OUF A;  4KFD A;  1PP9 H;  1SQV H;  2YO2 A;  2HYN A;  1US1 A;  2HFE C;  3SSU A;  1R3I C;  1KOR A;  3BLB A;  3ECQ A;  3M0A A;  3NXS A;  4UB8 Z;  3EJR A;  3F7V C;  3UQ8 A;  2G38 A;  2EAE A;  1BSH A;  1LTT C;  1Q8I A;  3CWB H;  4KXR A;  3RBZ A;  3N9H A;  1H2G A;  1N0N A;  2JDI H;  1NTM E;  3ITK A;  2Q5Z A;  1VQ4 P;  1YI2 P;  1E5W A;  1HTL C;  1R5S A;  2BT3 A;  4R4L A;  3IC7 A;  4KJM A;  3D36 A;  1BCC D;  3OW2 U;  1HNZ O;  3TDK A;  5FNV A;  4A7P A;  2HHH O;  3CLQ A;  3H1J H;  2GA1 A;  3BUQ A;  2AHY A;  3H25 A;  5APW A;  3L35 A;  5GON B;  1NU1 H;  1FDM A;  4BAY A;  5DEC A;  2WSE J;  3SWF A;  2E2V A;  4OJZ A;  3CSX A;  3OMN B;  4J9Y B;  2ZM6 B;  4JYA O;  2YKP A;  4QE9 A;  3H1H E;  2M5A A;  2E24 A;  4DR4 O;  1NTZ D;  4LP8 A;  1W2B O;  2UXB B;  2E5T A;  3HII A;  4IGG A;  4JQ0 D;  4JAS A;  3V2Q A;  1QU7 A;  1US6 A;  1L0N J;  1SET A;  2Q3I A;  4MT8 A;  5CA0 B;  2M8R A;  3T97 A;  1QLE B;  5AVX B;  1KZU B;  4LC1 A;  5B66 E;  1W3Y A;  1JB0 J;  1J1E C;  1HW7 A;  1YF2 A;  3S4R A;  3CV5 A;  2YIU C;  1JCD A;  3SR2 C;  5H2F Z;  2F95 B;  2UUB B;  4K35 A;  2JP3 A;  2XHN A;  2BOC C;  2KZJ A;  1J5E B;  4EB6 A;  5APV A;  2W8Z A;  4C7R A;  3ZED A;  1K8A W;  1AQT A;  3WG7 C;  1GTW A;  1AVL A;  2KYV A;  3JCZ A;  3VD4 A;  1WMK A;  1NS8 A;  1S72 V;  5EIB C;  1IBM O;  4CH4 A;  2V7Q H;  4JZ2 A;  2KSE A;  1YIJ P;  1SA0 A;  3K9A A;  1KYO I;  1IVX A;  1W5C E;  2FML A;  1NKN A;  5DED A;  2FYU E;  3X41 A;  1YCI A;  1YHQ V;  3OEH G;  4LLH A;  4FFB B;  4PA9 A;  4WY4 A;  5IT9 N;  2XU6 A;  3HE5 A;  4FNP A;  2HP8 A;  3O6Q B;  5ITZ B;  1UJW B;  3OJA B;  5B66 Z;  2F4V B;  2Q1K A;  3CX5 H;  1LP1 B;  4X88 A;  4LFB O;  1T3J A;  2WPS A;  3L75 G;  4IL6 H;  4EV2 A;  2AEF A;  4O9B A;  1JZ2 A;  1OW7 A;  1XL6 A;  2KNC B;  3EVK A;  3SPG A;  1N7Q A;  1DLB A;  1JOY A;  1A2V A;  1ULV A;  1SQB J;  4WWI A;  4BRY A;  2WVZ A;  2IBZ G;  1ZR4 A;  3SJC C;  4YJ3 A;  5CJ4 A;  4JAV A;  2QG4 A;  3L73 J;  1W59 A;  1Y74 B;  1PPJ H;  4W4L A;  1JYW A;  3L75 D;  3K59 A;  3VBB A;  3CRR A;  3B4S A;  2IYO A;  1PFI A;  3GHG A;  4FIP C;  1OCR C;  1VQO V;  1XDC A;  2IJK A;  3FAV B;  3VSN A;  3CXH E;  2POH A;  4X20 B;  5KKZ C;  3ABT A;  1V54 B;  2QIW A;  1KQS U;  1D2D A;  4PJ0 H;  4UB6 Z;  5B5E H;  1JYV A;  1WB8 A;  1BE3 H;  3SYC A;  2OT5 A;  3ZHS A;  3CPW O;  4H33 A;  3KN4 A;  2BEQ D;  4LR3 A;  3ZN1 A;  4C7U A;  3OFN G;  2CG1 A;  2XKM A;  3OM3 B;  2WAM A;  4G2K A;  3ASN B;  3E7K A;  3E8H A;  3V2P A;  3TSI A;  2CPS A;  1K1X A;  3AG1 B;  2ZM6 O;  1AJP A;  3CCQ P;  2Y9Z A;  4WFA V;  2QTO A;  3B71 A;  5EC1 C;  2DMX A;  4QPK A;  1FFX A;  2QEX V;  3O8Z A;  4WY4 D;  2F7O A;  1EN4 A;  1WAZ A;  5AW1 B;  4UCU A;  2UXB O;  1HXK A;  2KB7 P;  3FX7 A;  4RKU J;  3A5T A;  4U7O A;  3H1I G;  3V5B A;  3SJA C;  3R4Y A;  2YID A;  3T09 A;  4YY3 O;  2ZD9 A;  5C93 A;  3ETE A;  2YXY A;  3RYF A;  3ICX A;  3II6 A;  1H54 A;  4FNS A;  2UUB O;  5FNV B;  3P30 A;  3F89 A;  1BL8 A;  1K73 Q;  2ZL8 A;  3NRE A;  1F4N A;  2XAQ A;  4JTA B;  3IR9 A;  1R6N A;  3C3S A;  2OCC B;  4KHP B;  2KP8 A;  1WMP A;  3ASO C;  2LO1 A;  4H13 C;  4Z1M G;  1VQK V;  5GTI E;  4MVO A;  4U3F E;  4FNV A;  2N1T C;  1V55 C;  1MZ9 A;  1WMO A;  1IFD A;  3VD9 A;  4PJ0 Z;  1HP8 A;  2WLK A;  3OAK A;  1S5J A;  3WA2 X;  4H37 A;  4CH3 A;  3CD6 V;  4U7J A;  4FLV A;  1G1I A;  3JYC A;  2X7R B;  2J58 A;  2M5A B;  1EZV H;  1V9P A;  1Q86 W;  4MTX A;  1F4M A;  5KKZ B;  1WA8 A;  2WW0 A;  3SJQ C;  3UO2 A;  5KHJ A;  3DYO A;  3M99 B;  1IXM A;  5A9G A;  3OMA B;  3TGU H;  1M56 D;  1DH3 A;  3PGB A;  3TY1 A;  3T97 B;  2CWV A;  1JQ0 A;  3D71 A;  4JAU A;  1IQX A;  1F1S A;  2BRW A;  1L0N K;  4GCZ A;  3M0D C;  1SQG A;  1IDS A;  2Y74 A;  3ACS A;  3PTZ A;  1HWT C;  2UU9 B;  2L35 A;  2YS8 A;  4EB6 B;  3RL0 B;  4KFE A;  1M56 C;  5GTI Z;  1JTH A;  1GN2 A;  1EZJ A;  3BFR A;  1GM9 A;  2HKO A;  3H1L G;  5EC2 C;  4OK4 A;  1QL2 A;  1MSD A;  1SA0 B;  5CB4 B;  1LJ2 A;  2XOK G;  4JF7 A;  2N05 A;  4RWU A;  1MSW D;  1PD3 A;  1RM1 C;  2WVY A;  1VQL P;  2HOD B;  1TXK A;  2Y0D A;  4WFF A;  2WSF H;  4WY4 B;  3CCV V;  1SQX G;  1YGA A;  3JSL A;  1N73 A;  1OW8 A;  3HE5 B;  1EQ7 A;  4RO2 A;  2PRR A;  2KS1 A;  3DX0 A;  5B1A C;  2W83 C;  1EFR G;  3APQ A;  3AE6 C;  3AG7 A;  1NAF A;  1Q2N A;  1DIP A;  2FUT A;  2JKA A;  3DEC A;  3CRQ A;  1L0L E;  1B6Q A;  1OJM A;  1N32 B;  1L2P A;  2XSG A;  3WU2 Z;  3O65 A;  4YJ3 B;  2VQE O;  1X22 A;  2ILM A;  4DV7 B;  3OTO O;  4PD4 H;  4RES B;  2UUA O;  4NXN B;  3I5D A;  4TV8 A;  1SQB K;  3KCX A;  1VF5 D;  4X66 B;  4DUW A;  1KB9 D;  1KIL C;  3QF7 A;  3GHG B;  3E80 A;  3OA7 A;  4N3Y B;  2F1A A;  2ALW A;  4ASV A;  3I3E A;  2R9R B;  2GTS A;  1N0J A;  1GKF A;  5FL7 G;  5KTB A;  2EAC A;  3EJQ A;  3RL0 g;  3JAT A;  4AYC A;  1QCE A;  5LHG A;  4GOE A;  2WTY A;  2RNB A;  1CSB A;  2Z5U A;  2OQE A;  1GU5 A;  4EKW A;  1PL0 A;  4MVZ A;  3S4D A;  4DUX A;  2P1J A;  4FK5 C;  2WPV B;  5BMV A;  1GN4 A;  5C39 A;  3UM7 A;  3CCL P;  1IBK B;  2Z4E A;  1HJ0 A;  3STL C;  3AG3 B;  1FFX B;  3K3W A;  2KI7 B;  3G80 A;  2V4H A;  2YXQ B;  1KEC A;  3CCM P;  4FZ1 A;  4CH6 A;  3BVT A;  2EIM C;  3H1K G;  5IYC O;  4B08 A;  2OYO A;  2ZT9 D;  1JVM A;  3A24 A;  4J42 A;  2XAJ A;  1K8A Q;  3ZMZ A;  3I3D A;  2IZ0 A;  2Y0I A;  4GT1 A;  3RYF B;  2PNC A;  3MZW B;  4ASU G;  2F43 G;  5KLI B;  3FWN A;  1I94 O;  1YTZ T;  3QH9 A;  2UU9 O;  5KAF H;  1RPO A;  4HB1 A;  1K7D A;  2ZT9 C;  3H1K D;  3CE2 A;  4JI1 O;  2WLN A;  3T0D A;  2WPQ A;  2DW4 A;  5LA6 A;  4DCK A;  3ZCC A;  3HUS C;  3D6Z A;  1BCC H;  1H89 A;  2OOV C;  1M4U A;  2WOH A;  1IFI A;  3DX2 A;  3G6B A;  1WA8 B;  5J2U A;  3RFR A;  3UKM A;  3I55 P;  1VF5 B;  1NTM G;  1MMM A;  2JO1 A;  1XNQ B;  1A02 F;  3B8M A;  2QWR B;  3D6Y A;  1GTO A;  4DV5 O;  1YQ4 C;  2KIK A;  2W90 A;  4ABM A;  2DQ0 A;  2R9I A;  3ZS8 C;  1T5E A;  2DYR C;  1KMI Z;  1F23 A;  3LW5 J;  1BQ0 A;  3H01 A;  1NTZ H;  3PLN A;  3A7O A;  2WGQ A;  1N2D C;  2YKO A;  2A45 G;  2L6L A;  1N32 O;  1VQ4 V;  1YI2 V;  1OFC X;  1NTM D;  1JTH B;  3AED C;  3J7A U;  3USS A;  5KHH A;  1VDF A;  4D6T H;  3IMH A;  3LVT A;  1HWY A;  2GUZ A;  1N36 B;  1VIB A;  4NYK A;  2YI8 A;  4R8C A;  4X66 O;  3H1H G;  2CG0 A;  2AXC A;  1Y47 A;  1LTG C;  4QMA A;  2IU3 A;  2JKV A;  2Y0E A;  2CGN A;  5KAF Z;  1JA8 A;  2L91 A;  4U3F J;  2QA4 P;  3CZS A;  2KSJ A;  1ZL8 A;  3NMD A;  2Q7C A;  1ZWI C;  1N73 B;  1IBL B;  4LF7 O;  3T08 A;  2KZI A;  3TXS A;  1Q6U A;  1K5S A;  3ZHT A;  2WQY C;  3H1H D;  2HVK C;  1DD4 A;  5EBW C;  2KS1 B;  1S5L E;  5AVV B;  3LID A;  3T4Z A;  3K9S A;  1PU4 A;  3B2E E;  1I5X A;  2Q69 A;  5AVW B;  5IY5 C;  2PF4 E;  4OGQ D;  1W6G A;  3CCJ P;  2BCC E;  5KJ7 A;  5KAI H;  4I2L C;  4WBA A;  1KC8 W;  3S4A A;  3L9D A;  2LGQ A;  1PIX A;  1AP5 A;  1OZH A;  1BGY H;  2A7W A;  4LF4 O;  1FC2 C;  4TV8 B;  2FYU G;  3A0B E;  3WMM 0;  3LOY A;  2EX3 A;  1NT2 B;  3GB7 C;  4H0L B;  1EBO A;  3GW6 A;  3ETG A;  3AE5 C;  1ZN5 A;  3EJS A;  5D5Q A;  3SWK A;  1GMG A;  1PNM A;  4X9Q A;  2DYS B;  3D8C A;  1OCC B;  4UV9 A;  1YIJ V;  3IN6 A;  2IYP A;  3JAT B;  1JZ5 A;  2CWT A;  3P32 A;  2V7Q G;  4LH6 A;  1KYO E;  3CX5 I;  2ZR2 A;  1GL2 A;  2LFS A;  2FYU D;  3SPJ A;  4UFC A;  1YTZ I;  4BTW A;  5CHX A;  4J10 A;  4U3J A;  1Z45 A;  1SQP J;  2B9B A;  5KA6 A;  1AVY A;  3KG2 A;  2IBZ E;  2F18 A;  1FD9 A;  1Q6H A;  1YJN P;  1Q86 Q;  4JI0 O;  1Z5V A;  1BS3 A;  2E5Y A;  5BMV B;  4GLX A;  3TK1 A;  3ZRS A;  3W7S A;  5BZB A;  5LGN A;  4JI6 O;  3SJB C;  4LFC O;  3CCS P;  1WT6 A;  4R7C A;  2ZVO B;  4BZH A;  4ZNC A;  4TT3 G;  4YXW H;  3A8T A;  1UIX A;  1PL5 A;  1NS0 A;  3Q2Y A;  2WA4 A;  4JYC A;  5KHI A;  2ODM A;  2WVR A;  4GOF A;  2WCO A;  5KAI Z;  1TU3 F;  3DTU B;  2Q0A A;  4AQ0 A;  3QG5 A;  1FYJ A;  1O7D D;  1X4T A;  4WFB V;  1VF6 C;  3V4W A;  2ZAE B;  4EI2 A;  3PJS K;  2UXC O;  1XMO B;  5KJ7 D;  3RW0 A;  1JY3 O;  3E1F 1;  1KU9 A;  2CTW A;  3CXH D;  2R3C A;  2KLV A;  1V7V A;  4AQY O;  5LA6 B;  2ADP A;  2VRZ A;  3SX1 A;  4OGQ B;  1FZC A;  3L72 J;  3CB2 A;  5KJ7 C;  1JYN A;  3L74 E;  5L3B A;  2WW3 A;  5J2U B;  2C0X A;  3RYI A;  1FJG B;  1GL2 D;  3QO8 A;  3H1I E;  1OJN A;  4DK1 A;  4EFE A;  2UUC B;  2NPS A;  2W6J H;  3ZMU A;  4QIW F;  1HNX B;  3CCQ V;  3MTU E;  4BZE A;  2LGW A;  2AZ0 A;  2BEZ F;  3S3X A;  1OCO B;  2WSE H;  2Q5U A;  4UUJ C;  3HPL C;  4O2A A;  1LF9 A;  2WLJ A;  1ZW0 A;  4FNQ A;  3T0U A;  1X79 B;  1ZLZ A;  4K3A A;  1MFZ A;  1BHA A;  2W0F C;  1H8E G;  1SQF A;  3R66 A;  4DJG A;  3ZRV A;  1FDO A;  1URF A;  4L75 A;  1QAL A;  1AIL A;  3ZHV A;  3U11 A;  4TV9 A;  3E8B A;  4JGS A;  4B3S O;  2CFG A;  2GUZ B;  2QR4 A;  5GTH Z;  2IPP A;  2WPD G;  2HLO A;  1AI5 A;  1EZV I;  5LL6 Y;  4DR3 B;  1PV3 A;  5APU A;  2K9P A;  5LYJ A;  5B1B B;  5AW4 B;  3NBB A;  4BZG A;  1HM2 A;  2N9Y B;  1FS0 E;  1RWC A;  3IGA C;  3ZX6 A;  1ZL8 B;  4U3F D;  1AA0 A;  1SFC A;  2MK3 A;  1HUC A;  4J5T A;  1JZ4 A;  2YI9 A;  2IH1 C;  1P84 H;  1YBK A;  4I5S A;  1YJ9 V;  2XND G;  1KB9 F;  5AW0 B;  3BPZ A;  1G4Y B;  1JM0 A;  2R72 A;  3Q3D A;  4JI8 O;  3IAO A;  1OVV A;  1V7X A;  4WFE A;  1I0H A;  2ZJS E;  4W80 A;  3H1L E;  2BTQ A;  1URQ A;  2AXT E;  3ABK C;  1NTZ J;  4BW5 A;  3CC4 P;  2CTR A;  3F5W C;  3K06 A;  3BA8 A;  4WF9 V;  1XTG B;  4EYY Q;  1KIL E;  4ZBM A;  4AIL C;  5HFL A;  4OPH A;  3BCC E;  4MW3 A;  3I56 P;  5EYP A;  2AHZ A;  1SQX E;  3P3P A;  5AW8 B;  1LVN A;  3K0G A;  2K1A A;  1NSX A;  3IFM A;  5GW7 A;  2YO3 A;  1SQB H;  2P6J A;  3KYQ A;  3QFZ A;  3VD7 A;  2JGD A;  1M57 B;  3L73 H;  1HNZ B;  1GL2 B;  3SFE C;  3QTC A;  3HRN A;  1K1W A;  3TCU A;  1VQL V;  5FLX N;  2YDE A;  4U3J B;  1XMO O;  1A02 J;  3F5H A;  1UI7 A;  1H2M A;  3IFX A;  2D73 A;  1DF4 A;  1W0K G;  1L0L G;  1LTI C;  5EZY A;  1K4C C;  4QJF B;  4K8Z A;  2F7P A;  1SQP K;  1H8H G;  3BVV A;  3M9Q A;  1JY2 O;  1WLE A;  2M7W A;  1JMB A;  1YQ2 A;  3QWO C;  2ZE7 A;  2YFO A;  3FFQ A;  2O1J A;  2QWP B;  1X1J A;  2ZXW B;  3OR6 C;  2E42 A;  4NEI A;  2EIL B;  1QBZ A;  1FJG O;  1SQQ E;  3ALA A;  1L0L D;  2UUC O;  3OAA G;  1T6A A;  2PP6 A;  3OBA A;  4RQE A;  1VF7 A;  1FZE A;  2AEM A;  2LP7 A;  3RYC A;  4ZHQ A;  1NTK G;  5J2T A;  1QGK B;  2PFX A;  3M9H A;  4HJG H;  2Y73 A;  2AGA A;  1VQP P;  1AR1 B;  2CFL A;  4UCR A;  2WDA A;  2GBO A;  1K97 A;  4L76 A;  1URQ D;  5KMG A;  5EK0 A;  2I8D A;  3L75 J;  2FTK A;  3K57 A;  4HYO A;  2CK3 H;  2P58 A;  2WA3 A;  2A06 G;  4YHH O;  5J9P C;  2QJY C;  1D6U A;  3RK2 D;  1WPB A;  4DW0 A;  3OS7 A;  2ARH A;  3IC9 A;  4GOD A;  4UCS A;  1FZC B;  5KLV E;  3CC2 P;  5KHK A;  1QNM A;  4DR3 O;  1URQ C;  2QM7 A;  4W7Y A;  4Y99 C;  4JYB A;  4X65 B;  1KP3 A;  3Q5S A;  1GDT A;  3RYI B;  3WVF A;  2YMY A;  4QNH B;  1IK7 A;  2NPS B;  3W68 A;  3CCL V;  1HJB A;  2YIC A;  3J80 N;  4LFB B;  2CPB A;  3V6I A;  3LDE A;  3CCM V;  4YIO A;  3DSQ A;  2DWE C;  3L4F A;  1Q90 D;  3L70 G;  4O2A B;  1KC8 Q;  5KBP A;  1MA1 A;  1M9N A;  1QR9 A;  4YJ2 A;  2PI4 A;  5L3F A;  3MV1 1;  1ZX3 A;  2B88 A;  1EDL A;  3T1H O;  1Y66 A;  1FBM A;  3KZI H;  1E79 G;  2ITA A;  4PHZ A;  4TV9 B;  2CIQ A;  1RF0 C;  2OW7 A;  1DTO A;  2YKQ A;  5CJ0 A;  5L3D A;  5APQ A;  2IZ1 A;  1FXV A;  3VMA A;  5AVZ B;  1YZB A;  3L71 G;  1R3J C;  4AQR D;  5LYJ B;  1N7S C;  1PP9 E;  1JO5 A;  1SQV E;  5E79 Z;  3V4Q A;  3N4X A;  1SFC B;  2WYI A;  1FFT B;  4LCU C;  4LF8 B;  1PV0 A;  2A0L A;  3CRM A;  1K1Y A;  4JPR A;  2IU0 A;  4CS4 A;  1JFF A;  1PM9 A;  2Q9L A;  4UCO A;  5H2F E;  3B09 A;  3H1I J;  3I55 V;  2E2U A;  4FM1 A;  3CHX A;  2ZDI C;  3G3Z A;  2F7R A;  3AE2 C;  2K9Y A;  1H8A A;  5JMF A;  2GDS A;  2HEP A;  1XTC C;  3CZN A;  1R6K A;  2BTQ B;  1SNZ A;  2X03 A;  4DR7 O;  4FFK A;  5AVY B;  3O9O A;  1URQ B;  1GZL A;  3DCD A;  1XIL A;  2Y69 C;  2M0B A;  1AQ5 A;  1MMY A;  2P67 A;  3X3X A;  1R73 A;  1NAY A;  2DJV A;  1JPX A;  1DYU A;  2GV9 A;  3ABU A;  2NZ2 A;  3OMI B;  3H1J E;  1NTZ K;  5M1B A;  3RK2 B;  1UG9 A;  4RJT A;  5EYP B;  1FU1 A;  2FKW B;  1IC2 A;  1S4X A;  3BUD A;  4UCT A;  1NU1 E;  4NTX A;  5EIB D;  3KZI Z;  1EN5 A;  2IJI A;  3T1Y B;  5APS A;  1Q82 Q;  4YY3 B;  5IYD O;  4BIO A;  1XL4 A;  3TJT A;  2JGD B;  1NS4 A;  2JS5 A;  2JR8 A;  4J9Z B;  1F9G A;  1KKC A;  1OW6 A;  2WWW A;  2LFR A;  2QA4 V;  2E75 D;  1NJI W;  2LKM A;  1EXJ A;  5EZY B;  2BCC G;  1AI7 A;  1Y6X A;  3KCY A;  1FJK A;  4BIU A;  1RE3 A;  3STZ C;  1WMN A;  4KFF A;  2E75 C;  5BU8 B;  4X65 O;  4B3R B;  3K08 A;  3H1L J;  3RRS A;  1VL2 A;  5AVU B;  3CCJ V;  4DR2 O;  4B86 A;  2EIK C;  3AE3 C;  1MMX A;  2ZYD A;  1K4D C;  3CXH F;  2BCC D;  3D70 A;  4LWS A;  4UB6 E;  5CCG C;  3JD1 A;  2CWU A;  3RYC B;  4PDR A;  4ZHQ B;  4RUE A;  3AK3 A;  2Q0O C;  5J2T B;  1N86 A;  2N1T A;  3GMA A;  1ZP0 C;  2IJJ A;  2IW5 A;  3W67 A;  2RH0 A;  4IIJ A;  4MVM A;  1Y67 A;  5KMG B;  1IO4 A;  3AE8 C;  3M9B A;  1XNR O;  1H38 A;  4U7N A;  2ZE8 A;  1KYO D;  3CX5 E;  1DP0 A;  4IL6 E;  1QAF A;  3NJV A;  1ROP A;  1MNG A;  1PS3 A;  1L1F A;  3VD5 A;  4XA4 A;  1TVK A;  3E22 A;  2IBZ D;  1YJN V;  1I7F A;  2JEE A;  1AV1 A;  2UXD B;  1J1E B;  3UIA A;  3M0D A;  2YIU B;  1ZR2 A;  3X3Z A;  4O4H B;  3AE7 C;  3WA3 A;  1ARO P;  2HR3 A;  2WSS G;  3WG7 B;  4LF8 O;  4E2L A;  3CCS V;  2JJ2 G;  2JWD A;  4YJ2 B;  3D50 A;  3RWR D;  1IZN B;  1OXZ A;  1JJO A;  1I08 A;  3LIE A;  2C10 A;  3P3N A;  3I3B A;  2VQE B;  4MMH A;  3OTO B;  1RF1 C;  4D7T A;  2UUA B;  4IL6 Z;  3S3W A;  2MJZ A;  1G2C A;  3AFL A;  4PJ0 E;  2NLJ C;  4DV3 O;  2ZXE B;  3NTN A;  5B5E E;  1GH6 A;  2YX9 A;  1BE3 E;  2WSC J;  3BVU A;  3AEI A;  1EM1 A;  1HN1 A;  3MGN A;  3L74 G;  2C11 A;  3MHV A;  4XBF A;  5IWA O;  1RE3 C;  2WIT A;  4R4M A;  3SYA A;  3LW5 H;  4H13 D;  1MMZ A;  3T1Y O;  5L3C A;  1LNQ A;  3HR0 A;  3K58 A;  1FJP A;  4FM0 A;  2N1T D;  3W7T A;  4PEL A;  5K1P A;  3E35 A;  1R1B A;  5B1N A;  3H1K J;  2JJ1 G;  1BQZ A;  2YXH A;  1DD3 A;  3WFV A;  3E8F A;  1KFM A;  3B8E B;  1JFF B;  3L74 D;  3R2P A;  3MI6 A;  1S2E A;  4Q20 A;  1T8Z A;  4HAM A;  2Q67 A;  2LW1 A;  3H1I D;  3N2G A;  1KIL A;  4NTW A;  1IU7 A;  1OCR B;  1TGO A;  3U10 A;  1Q7Y Q;  4U3F H;  5B5E Z;  3CZJ A;  5AG2 A;  4P9P A;  3FB8 C;  1S5H C;  4UV8 A;  2R70 A;  4LF5 O;  3FYE B;  5LOV A;  1YJ9 P;  4B3R O;  4LF6 O;  4C46 A;  1KSI A;  1DEB A;  3VQX A;  2WLH A;  2B87 A;  1FS0 G;  1QHT A;  3JD0 A;  4J11 A;  1PKX A;  1P84 I;  1L0N G;  1I94 B;  2YIA A;  1NTM J;  1QVG O;  1EZV E;  2LXB A;  4DR5 O;  3C90 A;  1N34 B;  5EBM C;  1N7N A;  4JI1 B;  1JR9 A;  2QSA A;  1WPX A;  3WU2 E;  3HKD A;  1LUW A;  1YSC A;  3A0R A;  2LW7 A;  1T3U A;  4DUY O;  2QJK C;  3VSM A;  5EFW B;  5JQG A;  2BOB C;  2RN9 A;  1FDI A;  3FXD A;  2WPR A;  2WO0 A;  2JGU A;  3EXA A;  3AEG C;  1BSN A;  1OCZ C;  1O9G A;  2FKX A;  4X1Y A;  4F6E A;  3HD7 A;  2E43 A;  1N7P A;  2BRV X;  3ZN0 A;  2WW1 A;  3BAS A;  1I8Q A;  2E74 D;  2B1G A;  2O01 J;  3BCC G;  3A3Y B;  2UXD O;  4JI3 B;  1KN7 A;  1SQP H;  2XV5 A;  3H1L D;  1JY3 P;  1NSM A;  3H1H J;  3RN4 A;  3CC4 V;  1CXZ B;  4DV5 B;  3VMZ A;  5BU5 A;  1TAE A;  4LWS B;  1IX9 A;  3ASO B;  4H13 B;  5BY1 A;  2HG5 D;  3HB3 B;  4KP4 A;  4PV1 C;  1VQN P;  3ABL C;  3SPH A;  1JEK A;  1VEW A;  3H6P A;  2N1T B;  1KIL D;  1V55 B;  4DRX A;  3I56 V;  4R6Z A;  2E74 C;  1LTS C;  1GU4 A;  4FNR A;  3BCC D;  4BRY B;  1SQX D;  3HUS A;  3OW2 O;  4IIJ B;  2Y0P A;  3MV0 1;  2OOV A;  4IHJ A;  4O4I A;  1EXI A;  1SII A;  3VD3 A;  2HG5 C;  2YSU B;  3JSN A;  1MV8 A;  3BRV B;  3VP8 A;  1XUQ A;  1QVF U;  1HMW A;  2ITD C;  3UCS C;  2Q8V A;  1YYC A;  3E22 B;  2OW6 A;  4ZI7 A;  1AV4 A;  3N27 A;  1SQQ G;  3BA9 A;  4XE5 B;  2PYL A;  1MFT A;  3AEE C;  1PNL A;  1Y4M A;  3KKY A;  3X2Q C;  4LF7 B;  2FYU J;  1X1H A;  2XN1 A;  1NTK E;  1SIH A;  4WBN A;  1M56 B;  3QG0 A;  2FYN C;  4O4L A;  2R5D A;  3K5T A;  2QM4 A;  1GK4 A;  3ZMT A;  2CIS A;  2PZS A;  2I1J A;  2Q7H A;  5LMU O;  1DGS A;  2EBO A;  3L72 H;  4O2B A;  1SQQ D;  1KD1 W;  2KKW A;  2QWQ B;  2A06 E;  2E2T A;  1RM1 B;  3HD7 D;  1PGJ A;  1PGP A;  3CCR P;  2ZCE A;  1X9V A;  4LF4 B;  1G2C B;  1VQP V;  5KUM A;  1HN0 A;  1KQL A;  1ZLL A;  3D51 A;  2CFW A;  3RK3 E;  4QPJ A;  1EDI A;  2OIG A;  1YEW A;  4EDF A;  5KLV G;  1N8R Q;  2BE3 A;  3M8A A;  2PAJ A;  2Q6Q A;  2GTA A;  3G67 A;  4MTG A;  2QSI A;  5B1A B;  2N9B A;  3HD7 C;  4DV2 O;  2QE7 G;  3VDB A;  2E74 B;  1NJI Q;  3FKS G;  3L70 E;  4DV4 O;  5CCH A;  1UI8 A;  3CC2 V;  1BDC A;  2IM9 A;  1M1J C;  1SP4 A;  3CMA P;  5L3E A;  3B5N D;  5KLV D;  1OMI A;  5LXT A;  4I50 A;  1HGZ A;  3E7J A;  1N34 O;  2PTM A;  5BXZ A;  1RQV A;  1CB8 A;  3P7K A;  5CMU A;  3WB0 A;  2JK5 C;  2P7J A;  1DX7 A;  1KV4 A;  4JI0 B;  3N2G B;  2ZIM A;  1KIL B;  1ZRT E;  2RKL A;  1AVO A;  3V2N A;  2GM4 A;  2YC0 A;  3JAS A;  3ABV C;  4JI6 B;  5IYZ A;  3B5N C;  1QWU A;  3L71 E;  4LFC B;  3CC7 P;  2ZE5 A;  4H44 D;  2Z5H A;  5KAF E;  2A9H A;  2RDC A;  5LOV B;  4JI3 O;  5H6Q A;  2P7T C;  1FZF A;  1JRQ A;  1EC5 A;  1BHB A;  2OTL P;  1PP9 G;  2B87 B;  4HZ3 A;  1SQV G;  3VP9 A;  2W27 A;  3VYI A;  1JYX A;  3GLM A;  4QGP A;  1LWU A;  1NR7 A;  4CS3 A;  3QDE A;  2PI5 A;  3FD9 A;  1JY2 P;  3QVN A;  1IFN A;  4H44 C;  4XDJ A;  1TQU A;  3ZJZ A;  2D3O W;  1KQS O;  2EIJ C;  1HDJ A;  2UXC B;  3AG4 C;  1TUB A;  1MUU A;  3UT5 A;  2OGU A;  2X6B A;  4ZKI A;  1EDK A;  4FNU A;  3CWB G;  1ZSP A;  3U0Z A;  3MIW A;  2JDI G;  3VN0 A;  1PP9 D;  2ZIN A;  1SQV D;  1NTM K;  5AW6 B;  3BEH A;  2FFD C;  1RWH A;  1XOU A;  3BVX A;  4AQY B;  2EIM B;  3HKB A;  2YXR B;  5AVQ B;  5JQG B;  4PDV A;  2Z5I A;  1F7Y A;  5LGT A;  4LF9 B;  4X1Y B;  3L37 A;  3H1J G;  3AE4 C;  3HD7 B;  3OR7 C;  1J95 A;  1YDX A;  4DUZ B;  2FXO A;  5JJE B;  1JCH A;  1VF6 A;  5CCH D;  4TQD A;  1NU1 G;  3U1C A;  3F5T A;  1U96 A;  1NVP D;  2RDY A;  4D6T E;  2ZT9 B;  1USE A;  5AW9 B;  1KYO F;  1DK1 A;  4WVZ A;  1NWQ A;  4PA6 A;  2KG7 A;  4WB4 A;  1KQF B;  2P5O A;  3H1J D;  1S5L H;  3RBX A;  3CS5 A;  4DRX B;  1X0T A;  4KL1 A;  2SPZ A;  1SF9 A;  5LHI A;  5CCH C;  4UFZ A;  1ZOY C;  2QTS A;  5H6R A;  3HUS B;  4MMI A;  3DDF A;  1NU1 D;  1AB3 A;  4B3M B;  2PGD A;  3A0H H;  4IHJ B;  1W7C A;  4O4I B;  3VQW A;  4P30 A;  4B3S B;  1N7L A;  2AEJ A;  3A0B H;  1A32 A;  4BWA A;  5CA1 A;  3K5M A;  2B1I A;  3Q1M A;  2DYR B;  2HLD G;  4ZI7 B;  4X89 A;  4H44 B;  1MG1 A;  3E1I A;  5KAI E;  3CRC A;  3L75 H;  1X1I A;  2F23 A;  2D2C D;  4WBN B;  4GUN A;  2MKV A;  1J0N A;  1G1J A;  3D4Z A;  1BGY E;  3BVH A;  1ENV A;  2I1K A;  2QDO A;  2XN2 A;  2FYU K;  4Z2W A;  4A5U B;  1IFM A;  1LWU C;  1NH2 D;  4JI8 B;  2K37 A;  2IBZ H;  4O2B B;  4OX9 B;  3ZHR A;  2OYI C;  2WLI A;  3ETD A;  4OVN F;  4TLF A;  3GF3 A;  2VS0 A;  2D2C C;  4N6J A;  1IUR A;  3JD2 A;  2YMK A;  1PGQ A;  2H8P D;  1L0L J;  4LNU A;  2HPC A;  3S4C A;  5KX5 A;  3OD4 A;  1S5L X;  1U7J A;  3R65 A;  2K9J A;  1RSO A;  5LP6 A;  1JX9 A;  3IAQ A;  1VAR A;  1PPJ G;  1MZE A;  3CX5 D;  3W7W A;  2H8P C;  4L87 A;  1XBL A;  5IY5 B;  1L7K A;  4TQF A;  3JCU H;  3IJ4 A;  4GYC B;  3J7H A;  4DV1 B;  4LH7 A;  1H2L A;  1WP7 A;  1NVP B;  1Q82 W;  1HNW O;  2M3B A;  5AW7 B;  3T2Q A;  4I50 B;  1LTJ A;  1IFP A;  4DR1 O;  2QKS A;  2OYH C;  3BVO A;  3ETQ A;  1NTK J;  3LSS A;  1WNS A;  4IYI A;  2QKC A;  5JH7 A;  1JOC A;  4JV5 O;  4JF3 A;  3T2M A;  3JAS B;  1VQ7 P;  1F51 A;  4JI5 O;  5GTH E;  4LF9 O;  5IYZ B;  1BE3 G;  3E2E A;  4BWN A;  1JNM A;  2CH7 A;  3Q1N A;  4GIF A;  4DUZ O;  5F2V O;  1PGO A;  2RMK B;  1BDD A;  2IH3 C;  2RCV A;  3H1I H;  3WB1 A;  2P4V A;  3K79 A;  3LSQ A;  4JI4 B;  1LWU B;  4MTF A;  3CCU P;  1W2B U;  1LT9 C;  1Q6I A;  2BTO A;  3B8N A;  4AI8 A;  1BE3 D;  1OX3 A;  5TIS H;  2YNY A;  1LUV A;  3FWL A;  1BT8 A;  1SRY A;  2HTA A;  1TUB B;  1GK9 A;  4J7J A;  3UT5 B;  4NPD A;  3CYO A;  2F93 B;  5KUK A;  4B3M O;  3JD4 A;  2GHY A;  2Q7G A;  4Z1M H;  3L70 J;  1SKV A;  4YHH B;  1KP2 A;  2WOF A;  1NSS A;  3BGA A;  1NH2 B;  3NBJ A;  1JZ3 A;  3VDA A;  2LQT A;  2EJR A;  3BHP A;  3SPI A;  3ZRX A;  2V1D A;  4WCE V;  1EDJ A;  2YUA A;  1VP7 A;  3ZHQ A;  4YIP A;  1YQ3 C;  4FMT A;  5TJH A;  1W0J G;  2E76 C;  3RGU A;  1Z5W A;  4X62 B;  4K0K B;  1QL1 A;  4I7Z C;  2JEU A;  2ZXX A;  3B40 A;  2JRI A;  5BVZ A;  3BAB A;  1L4A C;  5AVT B;  2ZE6 A;  5A2Q N;  1S1C X;  2CIR A;  2VWJ A;  1FXK C;  3C8V A;  3I5C A;  4C7N A;  1KD1 Q;  3FB5 C;  3SXX A;  1QWN A;  5LP6 C;  3ZDM A;  1L0N E;  1F4H A;  1N33 O;  2KG7 B;  2X6A A;  4X8A A;  1SO0 A;  1EZV G;  3G6E P;  3DGE A;  4DV0 O;  1FPO A;  1S0V A;  4OX9 O;  1D6Z A;  5BR8 O;  3T1H B;  5L8R J;  3TGU G;  3H1L H;  1NYH A;  4N78 E;  1VQM P;  1LTJ C;  1NH4 A;  5D5P A;  1U7M A;  2KLU A;  1P84 E;  5LGU A;  1DEE G;  2RQ6 A;  2O3J A;  1EZV D;  1G8M A;  5CA1 B;  3ML0 A;  1J1D C;  3OB8 A;  1IXB A;  1GRJ A;  2OCH A;  2W0X A;  1IQY A;  1BMF G;  4FZ0 A;  2B9Z A;  2ZNI A;  5IJ9 A;  4ICG A;  4DV1 O;  3ZMS A;  3S1K A;  1KB9 H;  1NSZ A;  4I0X A;  1RF0 A;  2FXM A;  1XI1 A;  5AW3 B;  1MAB G;  3AEB C;  1OZ0 A;  4TTG A;  1FAF A;  3M91 A;  3BRC A;  3AFJ A;  3FGA D;  4AUW A;  5DN6 G;  1NOH A;  4L73 A;  4DR7 B;  1XHX A;  4PD4 I;  4DT0 A;  1SQP G;  4W4K A;  1J0M A;  1AJN A;  1SQB E;  1VQN V;  4OPA A;  1N7S A;  3L73 E;  1PL4 A;  2DQ3 A;  1RW9 A;  3E89 A;  3N2K A;  4NPF X;  4F4L A;  5CBO A;  1VQ5 P;  4LNU B;  2HPC B;  1HM3 A;  5KX5 B;  1Q7Y W;  2BCC J;  2K9J B;  1RSO B;  1W4N A;  2VQF B;  2QJP C;  3BY6 A;  1L0L K;  4JI4 O;  3IF4 A;  2ZR3 A;  2ZDI A;  1K34 A;  5A1A A;  4I6M C;  1VQ6 P;  1PX4 A;  1ZAU A;  3ABK B;  3KXD A;  1NS7 A;  1NI8 A;  2PY5 A;  1OWA A;  1FXH A;  3S9O A;  1N4C A;  2WSC H;  1RPR A;  4B7E A;  1LTJ B;  3VTP C;  2OAR A;  1TQT A;  2UXN A;  2ETN A;  5JH7 B;  1NTK D;  3A2A A;  1HGV A;  2CDY A;  3MUD C;  1M5I A;  4FLZ A;  2XZR A;  3T4D A;  1XQ8 A;  1K9M W;  2O01 N;  3QFY A;  2WLM A;  4DUV A;  3GWO A;  4JTD B;  2CH7 B;  3VOP A;  4UB8 H;  1RP3 B;  3H1K H;  4X62 O;  4K0K O;  1RY3 A;  3NJX A;  4DR2 B;  3EFG A;  4YTP C;  2XDJ A;  1LGH B;  1OJH A;  2A06 D;  2JS3 A;  2C0W A;  3D3I A;  4GX1 A;  3CCR V;  5E79 E;  2L5G B;  4NB5 A;  3WFA A;  2CE4 A;  4UCV A;  4JBZ A;  3VQV A;  3D52 A;  2Q68 A;  3DXR A;  5JCO C;  1R3L C;  3RK3 D;  4GKJ O;  3JAW A;  4X1I A;  1K04 A;  1M7L A;  3EWK A;  2FYV A;  3SYP A;  4UVC A;  1XEQ A;  1VPC A;  3OGI B;  3ZHU A;  2ZFC A;  2PGG A;  4DW1 A;  2XTA A;  1CP9 A;  1N7S D;  2G8Y A;  4J7Z A;  4F6R A;  1XNR B;  2FXP A;  4ASW A;  1I5Y A;  4IFD K;  4LFA O;  2N04 A;  4LGD E;  3L70 D;  3CMA V;  3RK3 C;  3Q4H A;  1RE4 A;  5IJ0 A;  3E83 A;  3J81 N;  1Y9B A;  1QLE C;  5CCG A;  2QVA A;  1AI4 A;  1S77 D;  3AK1 A;  3CP1 A;  1NTM H;  3LNN A;  5CBG A;  1WP8 A;  3OTF A;  1ZRT D;  3KZI E;  1IVU A;  3L74 J;  4G27 B;  4C7N B;  4CS2 A;  1NSR A;  3CC7 V;  1YTF D;  1VQ9 P;  2KB1 A;  3L71 D;  1QQC A;  1BCC G;  2FUQ A;  1M93 A;  1P49 A;  2QJY B;  3AG2 C;  3CWB E;  5H2F H;  1W5Z A;  5CN0 A;  2A45 H;  2OTL V;  4J80 A;  3JC2 2;  4GKK B;  1FE6 A;  1TQV A;  2O01 H;  4Y99 B;  4DV6 B;  3TET A;  4DV3 B;  5JJN B;  4X1K A;  4JYY A;  3H1H H;  1FZB A;  3G4S P;  3BRT B;  1NHL A;  2ZNJ A;  1NTZ G;  5IWA B;  2FBW C;  4MVU A;  5KHG A;  2VQF O;  4L74 A;  3P8C E;  3DDG A;  2E3C A;  3SYO A;  1N8R W;  2CGO A;  4AHC A;  1BSM A;  1GD2 E;  2EIN C;  4D6T G;  4PA3 A;  2KSD A;  2ZQM A;  5B66 H;  5IJ9 B;  1RF1 A;  3IAP A;  4P2Z A;  1AVK A;  5CBH A;  2RJZ A;  4I0X B;  3RVZ A;  1HWW A;  4DYL A;  3MHS C;  3K5B A;  1NR1 A;  1XMQ B;  4J7K A;  2OTJ P;  1KKD A;  4OH8 B;  1LOH A;  3RK3 B;  2CFK A;  3EJT A;  4FJC C;  4D6T D;  3THO A;  1W2E A;  2C9N Y;  5CCG D;  1LUR A;  3H9V A;  3CX5 F;  2FYU H;  1N7S B;  2CQS A;  2V4D A;  4LF5 B;  3N2K B;  3BUP A;  4LF6 B;  3W7X A;  2WVX A;  3DX1 A;  1V54 C;  3G9R A;  2H7H A;  3AK2 A;  3WB2 A;  1P4R A;  2M3E A;  1RE4 C;  2XT9 A;  2WLL A;  4EEQ A;  2Q6A A;  1R34 A;  2B89 A;  3T0B A;  3AG2 B;  3BCC J;  4UB6 H;  1SQX J;  1BGY G;  5CB4 A;  1F4A A;  3ASN C;  2E5L B;  4DR6 B;  4DR5 B;  2Y69 B;  3AG1 C;  5IDJ A;  4NXM O;  2BRP A;  2HOD A;  1YTF B;  2IBZ I;  5H9C A;  2JIZ G;  1OVR A;  4OXS A;  2YEV A;  1ZUQ A;  4DUY B;  4FLU A;  4BR6 A;  4X64 O;  2H43 A;  1GAX A;  3X42 A;  1WB7 A;  3WIR A;  1BGY D;  2XNX A;  1YVW A;  3QNE A;  3H32 A;  2X6C A;  4TT3 H;  2EIN B;  2O57 A;  3RYH A;  1HH0 A;  2AZ2 A;  4ZMD A;  1Q3E A;  3CXH H;  3D36 C;  1PPJ E;  4D7S A;  5JVD A;  2KXP B;  4MVS A;  4OWF A;  4BZF A;  4KHX A;  2OCC C;  3FB6 C;  2FYZ A;  2OTK E;  1KUQ A;  1SQQ J;  2XAF A;  1Y76 A;  3DXR B;  2WMM A;  3JAW B;  4X1I B;  4YXW G;  4GX2 A;  1OHH G;  2ZKO A;  4GKK O;  1K33 A;  4B7K A;  3F7Y C;  3G71 V;  5DJU B;  2YFN A;  4DV6 O;  2E75 B;  4F6R B;  2HJF C;  4FM2 A;  2Y4U A;  2EIK B;  3RL0 D;  2G3A A;  1NKD A;  3Q4H B;  2RMZ A;  3P8M C;  3LDC A;  4HNA A;  2R5B A;  3M7M X;  1YJW P;  5IJ0 B;  1P7G A;  3C1L A;  2EAD A;  2MW2 B;  2R32 A;  1U57 A;  2J5U A;  2XUM A;  1ORQ C;  1D5N A;  2IFN A;  5KLV J;  1VQ7 V;  1YIT P;  2LJ2 A;  3RL0 C;  1MKM A;  1COW G;  2EJ7 A;  4IL6 X;  5APX A;  1Z56 A;  5LMU B;  1XMQ O;  3KDP B;  3WIQ A;  1HVV A;  1B3Q A;  3HI7 A;  5LHH A;  5GTI H;  2W6J G;  4FPP A;  4PDL A;  2W6A A;  3CCU V;  3KPE A;  1CPY A;  4MVR A;  3CJH A;  2J59 M;  4X1K B;  1J2J B;  2ZYA A;  4WY4 C;  2ZQ0 A;  1SC5 B;  1E1R G;  2Q73 A;  2VRS A;  1JJ2 U;  4UXN A;  2QJ1 A;  3U59 A;  1VQ8 P;  1RQU A;  4PDM A;  1J5E O;  1NZ6 A;  3FB7 C;  2W6B A; 
#chains in the Genus database with same CATH homology
 3DX3 A;  1EDK A;  3EJQ A;  4KJM A;  5K5G B;  1BDD A;  1HTY A;  5KBP A;  3BUQ A;  4GOE A;  3BVX A;  2F7O A;  1TQT A;  3BUP A;  2K3R A;  1PS3 A;  3DX1 A;  2B88 A;  1EDL A;  1HXK A;  1FC2 C;  2F1B A;  1OVU A;  4NPE A;  1H0T B;  2OW7 A;  1R34 A;  2B89 A;  2HR3 A;  5C39 A;  4NPD A;  2M5A A;  3EJS A;  1JM0 A;  1OVV A;  2R44 A;  3DX4 A;  2JWD A;  2KI7 B;  3D50 A;  3BUI A;  1OVR A;  3BVT A;  2OW6 A;  1X0T A;  4JBZ A;  2KUB A;  1EDJ A;  2SPZ A;  3D52 A;  2WYI A;  2F7Q A;  4EYY Q;  1MFT A;  1LT1 A;  4IOI H;  2F18 A;  3CV5 A;  3DDF A;  3RGU A;  2FYV A;  3BVU A;  4K35 A;  2KZJ A;  2M5A B;  1TQS A;  2F7R A;  3EJT A;  3MHV A;  3MZW B;  4ZMD A;  4ASW A;  3CZN A;  1QWN A;  1LP1 A;  3ZDM A;  4HB1 A;  5CBN A;  2M0B A;  2WYH A;  2LXC B;  4ZNC A;  1NVO A;  3PH0 A;  2OTK E;  1S3J A;  2WMM A;  2QVA A;  4GOF A;  3D51 A;  1QX1 A;  3EJU A;  1TQW A;  3BUD A;  1EDI A;  2F7P A;  3D4Z A;  3EJP A;  3BVV A;  1O7D D;  5DJU B;  1JMB A;  1U7M A;  3DX2 A;  3QWO C;  2ZAE B;  1DEE G;  2Q1K A;  1LP1 B;  2KIK A;  1BDC A;  2QRX A;  3D4Y A;  4WWI A;  1TQV A;  1SS1 A;  1ZXG A;  2B87 A;  4HJG H;  1U7J A;  3S1K A;  3FXE A;  2LR2 A;  2RKL A;  3BUB A;  3LVT A;  4CPG A;  2I8D A;  3DX0 A;  1QWU A;  2LXB A;  2P58 A;  1Y47 A;  3DDG A;  1Q2N A;  1R33 A;  1ZW0 A;  5DJT B;  3BVW A;  4HKZ H;  1EC5 A;  2UWJ E;  4K3A A;  4GOD A;  4MN4 C;  4NPF X;  2B87 B;  5CBO A;  3BLB A;  5EFW B;  3CZS A;  3FXD A;  3EJR A;  2KZI A;  1HWW A;  1H0T A;  2KS1 B;  1TQU A;  2F1A A;  2ALW A;  4ASV A;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...