4K3AA

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
720
structure length
720
Chain Sequence
b'GDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
total genus 249
structure length 720
sequence length 720
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k3aA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k3aA04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k3aA02
2HR3A 3EJUA 3DX3A 2M5AA 3BUPA 2B89A 2F7PA 2UWJE 1TQSA 2OW6A 1JM0A 3BLBA 4K35A 2SPZA 2LR2A 2LXBA 2QRXA 1Q2NA 5C39A 4CPGA 3RGUA 4JBZA 4IOIH 3EJRA 1TQTA 3BVVA 5DJUB 1QWUA 1TQVA 2KZJA 1S3JA 3DX4A 1EDKA 1HTYA 4GODA 4WWIA 2KS1B 3D4YA 4ASWA 2KZIA 2F7RA 3S1KA 4KJMA 2K3RA 3QWOC 3BUBA 3EJTA 3BVUA 3MHVA 3EJQA 3D51A 2P58A 2ZAEB 4ZNCA 4NPFX 1EDLA 3BUIA 4MN4C 2I8DA 1EC5A 1EDJA 1Y47A 3D52A 3LVTA 1OVRA 3EJPA 1O7DD 3BVWA 1ZXGA 4NPDA 2FYVA 5EFWB 1LP1B 5CBNA 4K3AA 1HXKA 1TQUA 2LXCB 3ZDMA 1PS3A 2QVAA 1TQWA 2B87B 2B87A 2KIKA 4ZMDA 3FXEA 5CBOA 1HWWA 3BVTA 5K5GB 1H0TB 1U7JA 3D4ZA 1SS1A 4BXLA 1MFTA 2R44A 3FXDA 1H0TA 2F18A 1R34A 3EJSA 1NVOA 3DDGA 4EYYQ 1EDIA 3CV5A 3CZNA 2B88A 2M0BA 2OTKE 2F1BA 1QX1A 2M5AB 3DX1A 1DEEG 3PH0A 1OVUA 1LT1A 2KUBA 2F1AA 1BDCA 5DJTB 3DX2A 2WMMA 1BDDA 1QWNA 4NPEA 2WYIA 1FC2C 1LP1A 3DX0A 1X0TA 4GOEA 4GOFA 3D50A 3BVXA 4ASVA 1ZW0A 2F7QA 2WYHA 4HKZH 2RKLA 3BUDA 3CZSA 2OW7A 2KI7B 2F7OA 3BUQA 3DDFA 3MZWB 2JWDA 1OVVA 2Q1KA 5KBPA 1R33A 1JMBA 1U7MA 4HJGH 4HB1A 2ALWA
chains in the Genus database with same CATH superfamily
3N2GA 3H6PA 1XEQA 4IIJA 3P7KA 1FZBA 3EJUA 2ZD9A 1XL6A 3SSUA 2BOBC 5CMZA 3X41A 1NI8A 2XOKG 3X3YA 3ZRVA 2L6LA 4O4HA 1XQ8A 2QKCA 4U3FG 2V1DA 1W59A 4X62B 1GL2C 4IL6E 2ZXWC 1YITV 1KC8Q 3GHGB 1YGAA 1LTGC 3QO5A 3CL3D 1FYJA 1LURA 3A24A 5J2UB 4YXWG 3AE4C 4DK0A 5EBMC 4C7UA 4Z1VA 2OOVC 2ZKOA 2BCCE 1KILD 4DZOA 2CWVA 5F2VO 2FUTA 3M9BA 3D6ZA 3NMDA 3D4YA 1IVUA 2AXTH 1VF7A 3TGUD 2ZVNB 4PJ0H 4HAMA 2CFWA 4JI2O 2WSSG 4WFGA 3BCCD 3JSLA 2OARA 1XMQO 4YIPA 3LOYA 1DTOA 2K3RA 1YQ4C 1AR5A 3CCEV 1K5QA 4PA4A 4W7YA 1F23A 2C0XA 5IT9N 4HNAB 2E74B 1HR0O 1IFNA 4TV9B 3JAWA 4DV6O 1URQB 3GF3A 3TCUA 1Y74B 4YXDC 2FY8A 2KG7B 3UQ8A 1OVRA 1HM2A 5AW8B 3SWFA 1P84F 2QA4P 2W6JG 1BHBA 1G6UA 1QEXA 5CBGA 3JSVC 4LF7O 3L72J 1KYOD 3AEIA 1N7RA 4K3AA 4JZ2A 1EXJA 3HIIA 1IXBA 5CJ0A 2PI5A 1QR9A 3IFXA 2WSEJ 3L75J 4BAYA 1HNZB 1THZA 1GRJA 3RK3C 2OYQA 5AW2B 4PV1D 3CD6V 3H1LD 1NSZA 4KL1A 1HM3A 2V7QJ 4B3TO 4CH6A 4ZMDA 1OJMA 4O4JA 2IDBA 1JY3O 1W7CA 3APOA 4RNLA 1DEBA 3UT5A 4B7EA 3DECA 4X62O 1U97A 3ASNC 3SPJA 3STZC 4C7NA 1VQOP 3HB3B 3CZNA 1PNLA 1GL2A 1FD9A 4MW3A 4LNUA 3SDLA 1NTZJ 2Y9YA 3ZHUA 4H37A 3H1IE 1S72P 2KUBA 3GWKC 4WF9V 3SPCA 2CIQA 5K1XA 1BCCE 3DX0A 3RYFB 4GOFA 4UB6H 1FDOA 1GK6A 1VEWA 3H1JD 1PKXA 1YJWV 5KKZC 3HTKA 2JJLA 3ML0A 1BGYD 2FYUK 1JQ0A 3L73G 1IVXA 1P4RA 1M1KW 4N78E 2EADA 1VF5D 2OYHB 1LUWA 4H0LB 4JI6B 2Q1KA 5H9CA 1YI2V 1F4MA 3KDPB 1R33A 3CWBG 5AW7B 2A0LA 4OGQB 1YJNP 3ECQA 1SQXD 3H1KG 1QAKA 2NR5A 3WU2E 1JJOA 2Q3IA 3CMAV 5JH7A 1Y8AA 2O1KA 1SQQG 2YSUB 2OW6A 2NPSD 1BT8A 3Q4HB 4DRXA 3D36A 4H44C 1GKFA 2JK5C 2LFRA 4UCRA 2QRXA 1S5HC 5KHHA 2PUSA 1UG9A 2CTWA 1HNZO 5IYCO 3SPIA 4FFBA 3IAYA 1Y9BA 1M7LA 3V4WA 3BVVA 1NKZB 2KNCA 1Z45A 2GDSA 4C7RA 1IBMB 1LNQA 2QEXV 1PFIA 2F43G 2Q73A 2QKSA 3K59A 2N74A 4I9QA 2V4DA 3ZN0A 3VQYA 1SPUA 1HF9A 1D7MA 3O9OA 1RE4C 1WPXA 4EFEA 3WMM0 2DW4A 3H1HD 1MOFA 1CXZB 3CSXA 5FNVA 2C9NY 4LFBB 1EN5A 1BSMA 1JFFB 1ZX3A 5HFLA 5KTBA 4DV2B 5CCHC 3BUIA 4JI4B 1NTKG 1N73C 1PP9G 2H7HA 1L0LK 1Y66A 5AVSB 1KECA 5BMVA 4DV0B 2XDJA 1ENVA 3MP7B 5H6QA 3NR7A 3KZIZ 1NH2D 5B1OA 2BE3A 2KB7P 4F4LA 4WFAV 4JI6O 3FWLA 1SQPK 2ZIOA 3E8FA 1FZAA 4I1LA 1V7VA 4J11A 2X0LA 5E79H 4KT0J 3VD5A 3FFQA 5LMUB 4H13D 1NAFA 3C3SA 1TU3F 2B87A 2JKEA 3HKCB 2Y0IA 4MT8A 3PRJA 1NZ6A 1IZNB 4GT1A 1KQSU 1ROPA 1VQPV 4UB8E 3K06A 1S5LH 1MMUA 2IJIA 4LWSA 4BWAA 1TU5A 1FAFA 1FJKA 3OGCC 5LMNB 3ZCCA 1L0NK 3H01A 1SS1A 3DCDA 4J5TA 2R32A 3JD0A 1NVPB 2M0BA 3RRSA 1DEEG 3CCEP 5EZYB 3B2EE 2A06H 3JATA 4ZOLB 1IBMO 2BTOA 3RN4A 2NNUA 2IU0A 1ZL8A 1QU7A 4J10A 3VTPC 2E74C 1XHXA 2O01H 5DM6V 1O9GA 1RPRA 5JCOA 4LFCB 1URQC 2CG0A 4DR6B 1QCEA 1EKMA 1Q6IA 3C3TA 2X6CA 3LSSA 1S9KD 1RY3A 1XDCA 1JUNA 1DLBA 1HP8A 3DTUB 4B3MO 4LFBO 3ZHSA 1HMWA 1BZKA 2AEMA 4ZBMA 3AE2C 4YY3B 1SQVK 1LUVA 2FYUE 5LP6A 3CRAA 4DV0O 2UUAB 1YDXA 2WQYC 1FKAO 2Q5UA 3SYOA 4N6JA 1AQ5A 1NKDA 3D3QA 4L73A 1OW7A 2OYIB 1OCRC 4PI0A 3IF4A 1IFPA 5AVZB 5JJNB 1A32A 3CCUV 1GK4A 2YKPA 4IL6H 5C39A 3AG1B 1XREA 2EINB 3AG3B 2KP8A 3CXHI 3Q5RA 3N27A 2WSCJ 2E2VA 1N7SA 3GHGA 4RO2A 2QKAA 1T5EA 2BCCH 3CRQA 3N4XA 2EJRA 4J80A 3HD7C 5J2UA 2Z5HA 3TXQA 1Q43A 1IXMA 3IGAC 2M3BA 5M1BA 3L75G 1H88A 5B5EZ 4FNQA 4PD4D 1KB9D 4WFEA 5IYBO 2HP8A 5AW1B 4ASWA 2WT7B 4JF7A 1JCHA 2V7QG 3IMHA 3MGNA 4TV8A 1IK7A 2JGDB 1QALA 3H1JE 4FVMA 5KUKA 3K0GA 4K8XA 1W0JG 3MV11 3THOA 1BGYE 1YI2P 4BZFA 2KKWA 5J2TA 1WPBA 1LTJB 1NH4A 4HNAA 1NTZG 2D73A 4TV9A 3W7TA 2Y69C 3BFRA 4DR6O 1Y74A 4EKWA 1NSUA 2V4HA 3CMAP 2KG7A 3M0DC 1I08A 5APWA 4XDLA 1HN0A 2OCCC 1SQXE 3HE5B 2VQFB 1Z56A 1GK9A 3AG7A 1N7PA 3HI7A 2EILB 1M8OB 2HHHB 3P8CD 4YY3O 2YXLA 4J42A 2YO2A 2LW7A 1FXHA 4YPCA 2HEPA 3PP5A 2UUAO 4P30A 3VOUA 1USDA 2KIKA 1Q6HA 4KP4A 3LIEA 3WUVA 1NU1D 2GUZA 2JDIG 2N9YB 2E42A 1QLED 1SQPE 3USSA 1YSCA 2QEXP 3VSNA 1UIIA 2PNCA 1XL4A 4JI8O 2FKWB 5KAIE 1EN6A 4BXLA 3VSMA 2IBZG 3FXDA 5H5NA 3ABLC 4GX0A 2OGUA 1HJBA 3DDGA 1R5LA 3B40A 2N04A 3JASB 3JSNA 1Q86W 4UCUA 1JZ8A 3H1IH 1SERA 5LOVB 1T6AA 2VQEB 1DYUA 1M1JB 1GZLA 1L0NE 1QWNA 2ZCEA 2XAQA 2ZE5A 4BIUA 2IX7C 3L70D 4P9PA 4D7SA 3E8HA 4FPPA 2P67A 1YVWA 3RYFA 2WWWA 1JOYA 2ZXEB 1SF9A 2JEUA 4IGGA 5LA6B 4NB5A 1DD4A 2A7WA 1K73W 1MZEA 1LTIC 1QVGO 3RBXA 1V54B 4I7ZB 1V7WA 1R6KA 1WB8A 2OYHA 2N1TB 2HJFC 4XBFA 2W0QA 3HKDB 3JAKB 1ZN5A 1RF0C 1D6UA 2EIKB 1TVKB 3P30A 3WB0A 3WFVA 3AE6C 4O4LB 4UXNA 1RPOA 3WU2H 1GU4A 5AVWB 2B89A 2F66C 1YJ9V 3CRMA 4JAVA 4DW1A 1VQPP 3VBBA 2NN4A 2VQFO 5AW4B 1VQLP 4MTFA 1SFCA 1SQVE 3B09A 2HHHO 3H32A 4D6TG 1FFTB 4WBNB 1J1EC 2DMXA 2LJ2A 4FK5C 2QG4A 4MVMA 1T3UA 3BY6A 2Y74A 3CJHB 1FXKA 4NXNB 1DP0A 1TQVA 3M9HA 1LOHA 3L37A 5LGUA 2J5UA 5KLVD 3ZRWA 4B08A 2W6AA 1O9HA 3ETQA 3WA3A 4LBEC 5CBFA 2RMZA 2GA1A 1JMKC 1JY2P 3OJAB 1JZ4A 4TTGA 2FL4A 2A45I 3OR6C 2BRVX 4LFAB 3I5CA 2VQEO 4L74A 4R8CA 3BVUA 1N8RQ 1DGSA 3OT7A 3MTUE 1M93A 2L91A 2PGGA 3OGIB 3JD2A 1S9KE 5FLXN 1ZR4A 3H25A 1KD1W 1US1A 3RBZA 2K88A 4UCOA 5TISZ 4NR1A 1ZOYC 2N05A 2E75D 4QIWF 3T4DA 3FX0A 2FYVA 2AW9A 2ZDIA 2BEZF 1N7OA 3ACTA 2EULA 3UM7A 4LF8B 2EINC 3KYQA 3AG3C 4TQDA 1PS3A 2G8YA 3TXSA 1AJQA 4ZKPA 3QDEA 2RQ6A 1HW7A 3CHXA 2IZ1A 3K04A 1AJPA 4JI1O 4JI5O 4B3SB 3HKCA 1I94B 4UB8H 3L74E 5CBOA 3G6EP 4NYKA 3MUDA 4A5UB 4AILC 2ZQ0A 1FZGA 1QAFA 5GTIE 4U3FJ 2P5OA 4QGPA 4FLTA 4PD4E 1NR7A 4H33A 5LYJB 4NXNO 3B5NB 1JZ3A 2Y9ZA 1Q86Q 1GU5A 4J9YB 2E22A 3BCCH 5EC1C 4W4LA 5EZYA 3RK2B 1S0VA 1FC2C 4GYCB 2NZ2A 3CEIA 4YIOA 4CS4A 2D2CB 4EV2A 1ZW0A 5BR8O 5KX5B 5KJ7C 2H88C 1E1QG 1USEA 4FM2A 2G3AA 4I9WA 4IFMA 2CUGA 3SX1A 4LFAO 3G9RA 1K73Q 1V7XA 1G8MA 5LGTA 2YICA 3MHSC 4DV7B 3CC7V 1NQTA 3HUSB 1G2CB 2J58A 2EILC 4W80A 1T2KD 2KSEA 2WGQA 2Y48A 4IYHA 2FYUH 1WN7A 2AZ0A 2HTAA 4TSFG 3WFAA 4DR4B 3RL0D 3L71D 5C8YB 1BHAA 3ZMSA 1JOCA 3P8CE 2HFED 1QBZA 4OVNF 2QWPB 1F1SA 3L9DA 1L8DA 2PYJA 2JKPA 2XHBA 3CCJP 3SYQA 2OYIA 2QJ1A 3BLBA 2ZXQA 4DR7B 2SPZA 2FXPA 4LF8O 1FU1A 1R73A 2FTKA 4JI7B 2VRZA 1BE3J 4MVUA 1SQBD 3ALAA 1TA8A 1KQGB 2HVJC 5B1AB 3V5BA 3EXAA 1I94O 2UUBO 4B3SO 2CFDA 1YXBA 3QF7A 3KIIA 3UKMA 2ZNJA 3OUSA 3EHBB 2QJPB 4WY4D 4PA7A 2P90A 2B5UA 1NTMD 3L70E 1K4DC 2WT7A 2ETNA 1JB0J 4WB4A 2Q8VA 4D7TA 3BHPA 3H1JH 2RMKB 2BOCC 2JGDA 3S4CA 3T0DA 1V54C 2O01J 1Q7YW 1BGYH 1N36B 4FNSA 4KUMA 2CDYA 3EJQA 2N1TC 2ZM6B 1RHZB 1ULVA 5AG2A 2PGDA 1LTJA 4N23A 3JCZA 4X1YA 5A9GA 2OIEA 4BTYA 2QE7G 1A2VA 4FLYA 2DQ0A 2AXTZ 4LF9B 1KD1Q 1JYVA 3EJPA 2YXYA 1GM9A 4PJ0Z 1SQXH 4DV7O 1SQQK 2X03A 1FZFA 3HE5A 4W4KA 3OW2U 4YJ3A 2Q6QA 4RKUJ 2GV9A 1VQ6P 2P22C 1FZCC 4GKJB 4GUNA 1NOHA 4DR4O 3J7AU 5APVA 1BCCD 1M56D 1VPCA 1ZRTE 3H1KJ 4CH5A 4Z2WA 2EX3A 2WDAA 3TETA 5GTHE 1HWWA 3M7MX 5KAIH 5AW9B 1L2PA 1KILB 2JWAA 3W7XA 1MFTA 2R44A 4DUZO 5APSA 2Y0PA 2WW1A 4JI7O 2CTQA 1BL8A 4BW9A 2BCCJ 4PDVA 4P2ZA 1IVVA 1W3YA 1VF6C 3TYYA 1M57D 1H2GA 3RW0A 3M99B 4R6ZA 3QNEA 5LOVA 1EZVI 4M3LA 5CN0A 1BDDA 3DX2A 4NPEA 4IYIA 1M1JA 3Q3DA 1FXVA 2KOGA 3X3ZA 5KAFE 1N9EA 5L3CA 1QX8A 1BQ0A 1NTKK 1V55C 3RYHB 1NHLA 1URFA 1X4TA 4ZHQA 3SJQC 4BW5A 2JIZG 1N36O 3MD0A 2ZM6O 1SIHA 3AMOB 5KBPA 1KZUB 1W6CA 1GL2D 4ZKIA 3JAKA 2HG5D 1IFMA 1SO0A 1VQ5V 1NTKJ 3K5BA 4UB6Z 2M5AA 3QFYA 1HUCA 2E76C 2XTAA 3WB1A 4AUWA 1SQVH 2XNXA 2FFDB 1NSRA 2P10A 5CCGC 2KXPB 4JAUA 1ZR2A 4GKJO 2ILMA 4WBNA 4EV5A 1XBLA 3V2QA 1H8EG 2KYVA 3ZHQA 3B5NC 1B3QA 1X8YA 2DN9A 1IBLB 3DXRB 3CJHA 4DR1B 5AW6B 2B1GA 1EM1A 3DX4A 4DV5B 3STLC 2ZR2A 1D6ZA 3FYIB 2JGUA 1SZTA 3ZMTA 1IVSA 2WPVB 2PZSA 3R4YA 1HTYA 4XA4A 2D2CC 3L72D 1VQ7V 3ICXA 4I0XB 2P7JA 3NXSA 4ZI7B 4NVPA 1PX4A 1ZTEA 1KYOI 2CTRA 4EI2A 1YHQP 2LP7A 5IJ0A 4BR6A 2BSKB 1Y4MA 3CC7P 1Q7YQ 1NO4A 3HUSC 1F51A 4DUWA 2EZOA 1N86A 4NPFX 1LT9B 4AQRD 4MN4C 3LNMB 5K1PA 3G71V 3M91A 4JYBA 3D52A 5HFMA 5JMDA 2XAGA 2CAZC 1MUUA 4GX1A 3W7WA 3Q1NA 4OK4A 2WVRA 1ZSPA 2WLLB 3IN6A 3L71E 2E2UA 1IVWA 4BZEA 2NPSB 3CWBE 1NS8A 2WVYA 2YIDA 2LXCB 2IFNA 5IDJA 3CS5A 3BASA 2YIBA 2HODB 3S4RA 2WVXB 1W5ZA 1EZJA 4DV1B 1JTHB 2OTJV 1K8AW 5B1AC 2YKOA 3BRVB 3MWXA 3QO7A 2DYSC 5KHIA 4PA6A 5KMGB 1SQBE 3T2QA 1AA0A 4OXSA 4DV4B 1IFIA 3CX5E 3D4ZA 2OTLV 4O4IA 1XTGB 4CZZA 3U10A 4LF4B 4J7KA 2QJPC 1Y76A 1IDSA 2LQTA 2Y4TA 4X1KB 1KB9H 4PD4H 3HKEA 5E79Z 1OCZB 1PM9A 1FZEA 4HH2A 1IBLO 4DK1A 1JO5A 2FB5A 1N0NA 4DR1O 1NTME 1LT1A 1OW6A 1H8AA 2FYUD 2F1AA 1VQMV 4MW8A 3K58A 3D71A 2QSAA 3B77A 1OJPA 3N2KB 1BE3G 1S5LZ 1AB3A 3E1IA 4JZGA 5E1QA 2EIJB 1NTZK 2P1JA 2QWRB 3QH9A 3AG4B 5KX5A 3JCUH 2K37A 2CGNA 3ABTA 1AI4A 1OW8A 1OCRB 4F6EA 2WLMA 1M5IA 2EABA 3APQA 4TUYB 1NH2B 4JTDB 4FNUA 2CFKA 3E35A 2A06G 1G2CA 1BS3A 1PP9E 2O1JA 3R66A 3L4FA 1XOUA 1M4UA 3AE3C 4DUYB 2ZT9B 2LGWA 2ZYDA 3AE9C 3KZIE 3UIAA 5C8YA 3HD7B 1F4HA 1LJ2A 2OOVA 1TQSA 4GCZA 5JVDB 2WCOA 1H8HG 3A3YB 1GMGA 1BMFG 3CP1A 3OMIB 1NU1H 3RWRD 1JY3P 1HMUA 1KILC 2XN1A 2UXXA 4WCEV 3WVFA 1Q2NA 3VD9A 2MKVA 1E1RG 1RSOA 1IFDA 1L7KA 3EJRA 1OCOB 4DV1O 5CA1A 2DQ3A 3HR0A 2A45G 1MMZA 5DJUB 4GDOA 1QWUA 1FFXB 2RJZA 2LKMA 2GSMB 3OUFA 3G6BA 1XNRB 1EQ7A 1NYHA 3VP9A 4DV4O 4IFFA 1YEWA 5FPOA 4GODA 5CCHD 4LF4O 1VL2A 3EWKA 3TGUJ 5B66H 2Y69B 3L70H 2KK7A 2IM9A 3CB2A 3BCCJ 4U7JA 1L7JA 4IL6Z 3WG7C 3JYCA 3NJXA 3CCQV 2OCCB 1L0LD 2HLDG 2ZQMA 4WFHA 1KMIZ 2BTQA 4O9BA 2RCVA 5IWAB 2BCCG 1EDLA 4B3RB 1Q6UA 1HDJA 2QWQB 3X3XA 1SQPD 4I55A 1PPJD 1N7SD 2ZE8A 1KYOF 4X1IB 3T4ZA 3D8CA 3J81N 2D1WA 3QVNA 4J7JA 2ZYAA 1KKDA 1TUBB 1OV9A 4GKKB 2FFDC 3SJBC 3ABLB 3HE4B 2Z3YA 1WLEA 3IAOA 4NXMB 1EFRG 1L0ND 4DUYO 2QVAA 2WLHA 3H1LJ 1DX7A 2PI4A 2YNYA 1LGHB 5GTHH 3CI9A 4R7CA 1K8AQ 3TJTA 1GO3F 4TWKA 1FOSE 2A79B 1NS7A 1W2EA 3SJCC 5KLVH 3OA7A 4P9OA 5IYZB 4D6TJ 1OZ0A 4TQFA 3CV5A 1S1CX 2HLOA 1N4CA 1LXKA 3CCMV 3V6IA 2YFOA 2W27A 3L72E 3BATA 1P84E 1XNRO 2O01N 1BDCA 3ZHVA 3PJSK 3GF7A 3L75E 1XILA 1CEZA 3CRCA 1LP1A 1GN2A 4NTWA 1VF5C 5KAFH 4RUEA 1LT9C 1YITP 3G71P 2MW2B 3H1JJ 2Q7CA 1AJYA 2WLIB 2DYRB 3AE8C 5KA5A 5L3DA 2XASA 5L3GA 1SQVD 3RYHA 1D2DA 3WIRA 3OE7G 3LNNA 3AE7C 3E7JA 3MZWB 2Z4EA 3RK3E 2E5LB 3H1IG 3TSIA 3W68A 3Q5PA 5IWAO 2NPSC 3BA9A 4GX2A 5LHHA 3CMEV 5LHGA 3KKYA 1QVFU 4B3RO 1NTZE 3IC9A 1RH5B 4HB1A 3MPHA 4IHJB 1J1EB 3BVHA 1C82A 4OK2A 2ARHA 1SQXJ 4GIFA 4B86A 1JYWA 3RVZA 2OTJP 2W6JH 5KA6A 5B1NA 3BUPA 3H9VA 1YQ3C 1KB9I 1K7DA 3ZHRA 3A2FA 1X1HA 4K0KB 2R9RB 2R5BA 5LXTB 1WMNA 2OTLP 4GKKO 3GW6A 4E4EA 4YHHB 1T3JA 2FYZA 3FD9A 1U96A 5CA0B 4UV8A 4NXMO 1VQ9V 3WUUA 5APQA 1RE4A 1OCZC 4LF6B 1RFYA 2CH7B 4L87A 1RWGA 3SGIA 1S3JA 3PLNA 3WU2Z 1M1KQ 2ADQB 3HKBB 3MDSA 4H0LD 1W2ZA 4DV2O 2WITA 3C8VA 1GH6A 2PFXA 4JI4O 2IBZE 1L4AB 5CCHA 3A7OA 3M9QA 1BSNA 1N73A 1JVMA 2EIJC 4OGQD 2Q0OC 3CD6P 3AG4C 2QDOA 3OM3B 3F5HA 2YO3A 1JNMA 2CIRA 2F7RA 3H1HJ 3JD1A 1N0JA 2M6YA 4K8ZA 1NR1A 1NS1A 3E89A 1YZBA 2BSKA 2IJKA 4DR3B 1S76D 1SFCD 2Q1FA 4BRYB 3X2QC 5LMUO 1D5AA 3SFDC 2JRIA 1AQTA 3OEHG 3L74D 3OMAB 2PRRA 4MS2A 1RW9A 4HBNA 2YS8A 3AEGC 2R3SA 2ZT9C 1P7BA 1H2NA 4JTCB 4NKGB 1G1IA 2WLNA 4OPHA 3L71H 3D3IA 5LMNO 2E5LO 3IC7A 2KSJA 1UFIA 3CWBH 4R4MA 4B7KA 1YJWP 4RQEA 3E22B 4MMHA 2K9YA 1FS0E 1OCOC 1VQKV 2WPSA 2WVXA 1ZV8A 3PN1A 3T2PA 3C9IA 4FMTA 1DK1A 4JYAB 2O3JA 1SQBH 4K0KO 1GDTA 1JYNA 3CX5H 1OJNA 3V4QA 1EZVG 2ZIMA 5KMGA 3CCLV 2M8RA 4HYOA 4N21A 3Q1MA 4YHHO 4LFCO 1U7JA 1LVNA 4PA3A 4Q6GA 5JQGB 4X64B 2FBWC 2K9JB 2WZ7A 1R34A 2WO0A 1URQA 4KTRA 1MZFA 4LF6O 4X1KA 3AEFC 5BU5A 4FZ0A 3CCQP 1UPGA 3QG5A 1PV3A 1Y67A 1NTMH 1OVUA 1LWUB 2RN0A 4KTPA 3OEEG 4O2AB 3NBJA 4LC1A 1KN7A 1TAEA 2YDEA 1RQVA 4GOEA 4UB8Z 1L0LE 1OJOA 1RQUA 1J95A 3BVXA 1VARA 4FIPC 3N2KA 3GWOA 2GTAA 4I5SA 1MG1A 1Y6XA 4MVZA 1GMJA 1NSMA 2OW7A 1R5SA 3AG2B 1MA1A 4OH8B 2C10A 3A0BE 2HJDA 1CPYA 3JALB 2UUCB 1PPJE 2JWDA 2H43A 4IT5A 4MVOA 4DR3O 3BRTB 3VD7A 1RKYA 3TGUG 1OZHA 3K5NA 1PP9H 3CXCU 3BCCG 2Q7EA 5APYA 1MFZA 1N2DC 3T0BA 5CB4B 3A0HE 3MAQA 3TNUB 3DX3A 3J7HA 5GONB 1BCCH 2WA3A 2ITDC 3HD7A 5KLIB 3CXHD 3KQGA 2DWEC 5JVDA 4BTWA 3RFRA 3ZX6A 1IJDB 3KHUA 4WVZA 2K1AA 5AVQB 3RGUA 4LR3A 4U3JB 3I55V 1NAYA 1J0MA 2W8ZA 4PD4F 1KB9F 2HYNA 4JYAO 1LXMA 1DF5A 1LTAC 1FFXA 1PGPA 1TUEB 4OJZA 3ETDA 3OB8A 1PU4A 4DYLA 2IYPA 1KQSO 4X64O 3H1LG 2DW3A 2Q7GA 3GVMA 2DYRC 2RDCA 3P32A 4I50B 3OS7A 2Y0CA 2WSFH 3J80N 5IYDO 3M0DA 3S1KA 4KJMA 1P49A 4DO2A 1H2LA 3Q4HA 3E80A 1ZRTD 2GUVA 3QFZA 1FZCB 4G28B 3LDEA 3T2MA 1R1BA 3LVTA 1AROP 4LF5B 4U3FD 4DT0A 1NWQA 2FUQA 1J5EB 4MMIA 1KUQA 5EIBD 2UUCO 1F7YA 3RL0B 1W5CE 1WB7A 1ZXGA 1W4NA 4FFKA 1Z5WA 4BZHA 3H1JG 2KB1A 1JJ2U 1QLEC 1KKCA 1BGYG 4LH6A 2IJJA 3MHHC 1M90W 2ZINA 3RT3C 1VQ9P 1UI7A 1OHHG 3R2PA 1PNKA 2A3QA 4KHPB 2JEXA 1UI8A 1NU1J 4CS2A 1YTFD 2VRSA 1KFMA 2F93B 1KORA 1ZUQA 4DUXA 1JFFA 1FBMA 1L4AC 1SQXG 1PV0A 1AVLA 1V55B 1NVOA 4X20B 4AHCA 1H89A 2B88A 3N2GB 2PAJA 3LW5H 1SS3A 4IIJB 4UFZA 3L72H 1K97A 2CQSA 4TLFA 3OMNB 4J7ZA 2YXRB 1MMYA 4UVCA 2WSEH 2WYIA 3CCUP 3CCRV 4O4HB 5DECA 1Z2GA 1YQ2A 2V7QH 5KAIZ 4KFDA 5L3FA 1RF1B 1MSWD 3CZSA 2E76B 4OX9B 3LSUA 1IQYA 1JZ6A 2Q9LA 5CBHA 3R65A 3BS6A 2CPSA 2GBOA 3BA8A 3MI6A 3AFLA 2Z5UA 2K9PA 4OPAA 3VMAA 1NTZH 4L8JA 5AVTB 4EFBA 2OCHA 5L3BA 4Q20A 1D5NA 3H1HG 1K3EA 2P4KA 4IHJA 1VQKP 4LF5O 1NT2B 1M56B 2F7PA 2WPQA 4TT3G 4ZOLA 4CC6A 4YTPC 3NTNA 2YX9A 1AJNA 1HTLC 1GTOA 5LXTA 4R50A 3AE5C 3U1CA 5JMFA 4JF3A 3F7VC 1CSBA 4WBAA 2YI9A 5CA0A 2P7TC 4KHXA 4L75A 3VQXA 2QGNA 5KHGA 1JA8A 1TQTA 3KN4A 5A2QN 1QHTA 2XNDH 1LWUC 3OTOB 2BEQD 5KLVJ 3ITKA 1M57B 2IBZH 3L73D 2WW0A 3V2NA 1XNQB 4UUJC 2KS1B 2JP3A 3KG2A 2FXOA 3S3XA 1OCCB 3AG2C 3CWBD 4DR5B 1SLQA 1XTCC 5AW0B 3BUBA 4QMAA 1K1YA 2E75C 1N7LA 2EZPA 3H1KD 2Q6AA 1R3IC 3AK3A 4DXWA 2P58A 2DWDC 4R4LA 1LTTC 1UIXA 4BRYA 1SQQD 2L5GB 2F95B 4C7NB 2BASA 1CW5A 3UO3A 1EDJA 3MUY1 2JEEA 3CX5D 3T08A 4OX9O 4LNUB 4KXRA 2UU9B 1AVKA 3BGAA 2DJVA 2DYSB 5BY1A 1IFJA 2YMKA 1WMPA 2ODMA 2Z0AA 5KLIC 2QJKC 2EACA 1X79B 1IU7A 3L35A 3T0UA 2AEJA 3W7UA 2E5YA 3MV01 3AECC 2FXMA 3LDDA 2D3OW 3CXHE 4E2LA 3I55P 2MJZA 1JRQA 3TK1A 2HKOA 5H2FE 1M90Q 2LO1A 3HTKB 3O65A 1JX9A 3ZJZA 3X40A 2YEVB 4PA9A 2XAJA 2IH1C 3JC22 2JJ1G 4LP8A 1H0TB 3S4AA 4NEIA 3EJSA 2X6AA 5JQGA 4XFJA 5EBLC 3E83A 2K9JA 5KJ7A 3OAKA 1YJ9P 1B06A 3EQ2A 2QWOB 1RWHA 1A02F 3SWYA 1NTKD 1PP9D 1JEKA 3OTOO 3PH0A 4JI0B 1HGVA 1LWUA 2WMMA 2YMYA 4OWFA 5EYPB 1L0LH 4O2AA 2UXBB 2YIBD 1A02J 3AEAC 1H2KA 1T2KC 4JYCA 1PGQA 2B1IA 4JAAA 2EAEA 3D70A 1SQPH 3BEHA 3BUQA 5IJ9B 3A0BH 2YIUB 1PPJH 3RL0C 4FLZA 2KSDA 2HFEC 3VP8A 3JALA 4U3FE 4DR7O 3BAAA 1SRYA 3O8ZA 3PGBA 2DOSA 2C0WA 1AI7A 3CRRA 5JJJB 2ZJSE 3RGBA 3A0HH 2ALWA 3JASA 3L71J 1X1JA 1KP2A 4MTXA 2UU9O 5CB4A 3B5ND 2GHYA 1ZAUA 1VQOV 1FE6A 1EN4A 1L0NH 3UO2A 2H8PD 3KXDA 3TNUA 3DC6A 1F4AA 4Z1MH 1U57A 2F4VB 3JCUZ 4GX5A 5C93A 3RK2D 1S72V 1W6GA 3K9SA 3T1YB 3ABKB 5FNVB 4CH3A 4PI2A 1PGJA 1I7FA 1PNMA 5LHIA 3CCSV 2KLUA 2CFLA 1DF4A 1RE3C 2O57A 4AQYB 5LA6A 3WG7B 4WY4C 1SQBJ 1EBOA 1PIXA 2CTPA 4QJFB 4U3JA 5CA3A 3I3DA 1NS4A 3GB7C 1Q82W 3CCRP 1AVMA 1L1FA 2N1TA 3CCVV 1EDKA 3HKDA 2IH3C 2KQXA 2ITAA 2Q3EA 2ZE6A 3VDBA 5B1BC 1RF1C 1TVKA 4LF9O 1NU1G 4I2LC 3DSQA 4CH4A 4O4LA 4PV1B 1EXIA 2UXDB 2PYLA 3EJTA 4JI0O 3QWOC 1WA8B 1R3LC 4XE5B 2QM8A 4MTGA 4X88A 2WSCH 4LWSB 2UXBO 1ORQC 1BE3E 2RN9A 1K1WA 1AP6A 1FZCA 1K34A 1EC5A 1YTZT 4YJ2B 2E2TA 2Q69A 5B66Z 1XMOB 2C11A 3L70G 2EIMC 5H6RA 1M56C 3ACSA 3BVWA 2NLJC 4NPDA 3JD4A 1AI6A 1XMQB 1GN3A 2QWNB 5D5PA 4UFCA 4FM0A 3H1IJ 3NBBA 1P84D 2WLJA 3ZMVA 1BCCJ 2XZRA 1LF6A 3L75D 3N9HA 3HRNA 3SXXA 4GZRB 1VF6A 1IURA 3KCYA 2F4VO 5AW3B 4DUVA 3N7NA 4JPRA 4WFBV 1M57C 1VF5B 3T1YO 1X9VA 2ZYGA 3EFGA 3AEDC 2Q7HA 1VQ4V 3IJ4A 2OQEC 3RK3D 4AQYO 1HVVA 3FWNA 3L73E 1OCCC 2WA4A 2OTKE 2ZE7A 2YI8A 1NTZD 1LF9A 4X8AA 3M8AA 2Q68A 2Q4PA 4B3TB 2P4VA 1KQLA 1AVOA 5GTHZ 1VP7A 1NSSA 2VWJA 2WSFJ 1MNGA 4ASVA 3H1KE 3I3BA 3BLCA 3E7KA 1HWYA 2RKLA 1IX9A 1RF1A 2HG5C 5KLVG 1WAZA 1SQQE 2UXDO 1N7SB 2C2AA 3L74H 1HJ0A 1NJIW 2I1JA 4Y28J 1E79H 1SVFA 3AFJA 1AP5A 2CGOA 2YKQA 5GTIH 3WUTA 5CCGA 3ABUA 2QE7H 1F4NA 3RYIB 5KAFZ 2QM7A 1W0KG 5DEDA 1FAVA 3JARB 4TV8B 2IBZD 5LYJA 1XMOO 3B5NA 1HNXB 2RNBA 5AVRB 4BWNA 4DV5O 3GMAA 3ETGA 3CYOA 1WP7A 1R8EA 1FOSF 1HBWA 3K0DA 1K1XA 2Y0DA 5J2TB 3BABA 5LL6Y 3D6YA 4FNVA 3ABMB 4C46A 3CC4V 1US6A 3OW2O 4JBZA 2OQQA 3SEPA 3SR2C 1B04A 4EOTA 4UCSA 4XDJA 4FJCC 3VQWA 2PY5A 1X22A 3I56V 2H89C 3M0AA 4H44D 1OIPA 2E5TA 3X2QB 3HUSA 1Q82Q 1NTKE 3D36C 3B4SA 3E86A 3LW5J 4RO0A 5B3SB 2KS1A 4QPJA 4H13B 3U59A 4GLXA 2OQEA 1BQZA 3G80A 3B8NA 3E8GA 2M3EA 2YIUC 4AQ0A 2GUZB 4QE7A 3K5TA 1RJOA 3IAPA 3TDKA 3G3ZA 2I8DA 1S5LX 3PTZA 1SC5B 3WA2X 1Q90D 1K9MW 1SZXA 3VDCA 4D6TD 2Q0AA 2AGAA 2OWOA 2CK3H 4W7ZA 1S5JA 1VDFA 3ABKC 3I5DA 3CCSP 4QNHB 1N7QA 2PTMA 2X6BA 3CXHH 2WW3A 2IYOA 5H2FH 1XHZA 3QO8A 1WRGA 1RWAA 1HNXO 2B9ZA 1PZQA 2FMLA 2YEVA 3E8BA 2P2UA 1G1XB 3CCVP 4MSWC 3F5WC 1FDMA 3Q2YA 1KV4A 2FYNC 4AI8A 3L71G 1VQ5P 1H0TA 5JJEB 2WPDG 1OWAA 2ZR3A 1XUQA 5DN6G 4CBCA 4FM1A 4X9QA 3O6QB 3OFNG 4PV1C 2WVZA 3CC2V 1N7NA 2FYUJ 5LGNA 2JO1A 3K08A 1WNSA 1RP3B 5EYPA 1SFCB 1SQBG 3H32B 3K57A 3C1LA 3OTFA 2F7QA 4RWUA 1TXKA 3AEEC 4GKGA 1GM7A 4LLHA 4IL6X 1FXKB 3K5MA 5IJ9A 1YBKA 4U3FH 3ASOB 3BPZA 1SA0B 1JMMA 1QGKB 2E74D 3VMXA 1NJIQ 3VD3A 3ZRWB 1NTMG 5CMUA 2CWTA 1KILA 1VQ7P 2LW1A 2X7RB 1URQD 1U7MA 5JCOC 2WAMA 2YXHA 3SYAA 4YXWH 3LSQA 1JY2N 2AEFA 2GTSA 1MV8A 4JQ0D 2AZ2A 5LBQA 5BZBA 1NS2A 5B5EE 4FLUA 3A8TA 5TJHA 1JCCA 1VQ4P 3A5TA 3K5LA 2QTOA 4K35A 3G4SV 4B3MB 2LR2A 1SQXK 2WSSH 3AEBC 1FJGB 1BGYJ 1I5YA 1OJHA 4JPZB 1OACA 5LP6C 4EEQA 4X66B 3ZHTA 1YCIA 2LFSA 4MVSA 2J59M 1IZ3A 3VN0A 1F9GA 2CG1A 4DV3B 2W0FC 3CE2A 3RL0g 1J1DB 1AV4A 1EZVE 3DYPA 3RSYA 4KFMA 1GD2E 3AMOA 1BCCG 4WWIA 4LCUC 3LDCA 2KZIA 1QVGU 3F7YC 2R72A 2POHA 2ZT9D 4PD4I 4RJTA 1N7SC 2ZXXA 3GHGC 1L0LJ 1ZLLA 3HD7D 3WB2A 1P7GA 2XU6A 2IZ0A 4JV5B 1QLEB 1WA8A 3OBAA 3D51A 1BE3H 2YIAA 2FFDA 3QTCA 5IE9A 1SESA 1T8ZA 5BU8B 4XDKA 4JASA 1VQLV 1I5XA 3T1CA 1SQPJ 4UVBA 4RESB 1KILE 1RM1B 3ZEDA 2P06A 4YJ2A 1HH0A 4N3YB 4JI3B 1K9MQ 4CS3A 5BXZA 3DXRA 1VQMP 1YIJV 2CWUA 1BSHA 3TGUE 3S9OA 3T09A 5CHXA 3BCCE 2QR4A 2OIGA 2H3OA 1L0NJ 3ABMC 1S2EA 4I0XA 2N9BA 3CC4P 1JYXA 1S4XA 4JGSA 1PL5A 5APXA 1K4CC 4ZI7A 1TQWA 3X42A 1AVYA 3K03A 2R70A 5A1AA 1B6QA 1K5SA 2IW5A 3I56P 2ADPA 2XN2A 2JVDA 3SYCA 2HPCB 1LR1A 2QJYB 3W67A 1LT9A 2F18A 3I3EA 5D5QA 1W2BU 1FJGO 5B3SC 2RDYA 3A2AA 3FB6C 3L73H 1QL2A 1GN4A 4H13C 4X66O 2A45H 3UCSC 1KYOE 4DCKA 4DV3O 1CB8A 3K3WA 3S3WA 3RYCB 3K79A 3ABVC 5AVVB 2WLLA 1SP4A 1JPXA 4EB6B 2XUMA 2EBOA 2NPSA 3OAAG 1RF0A 3OD4A 1X0TA 3H1LE 2AHZA 5CJ4A 1AILA 3H1KH 4DJGA 4JI8B 2AHYA 4BIZA 2Q67A 2HODA 1IQXA 3SYPA 2R3CA 1SQVJ 1KQFB 1SQQH 2CPBA 1NKGA 3T1HB 3NREA 1JTHA 4JYYA 4O2BB 3DDFA 5EK0A 1WMKA 1NBMG 4JV5O 1MMMA 2R5DA 1CP9A 1G1JA 3L72G 4D6TE 3DYMA 1EGUA 3CPWU 4HJGH 4I4TB 2CFGA 3G6EV 2E24A 1R6NA 4PDLA 3RYIA 3CZJA 3DC5A 5AW5B 4JI3O 4L76A 3JARA 2XAHA 2I1KA 1OFCX 1N8RW 1JM0A 1YTFB 3K5OA 2OYHC 4G2KA 1QNMA 2WLKA 4H0LC 1Q3EA 2IU3A 3FGAD 4X1YB 3TF5A 3U11A 4F6RB 4IOIH 4OGQC 1QL1A 3CC2P 1R3JC 2NRGA 4X89A 2KZJA 2E75B 3S4DA 4ICGA 3ZBHA 4TUYA 3CLQA 1SETA 1AR1B 1NTKH 3JD3A 5EBWC 1JCDA 3SFEC 1SFCC 2JKAA 3ZRSA 1NVPD 4YJ3B 1MMXA 3FKSG 1IBKB 2XT9A 5TISE 3KZIH 3FAVB 2W90A 1FXKC 4WFFA 2QJKB 1N32B 3ASOC 1NGMB 3MHVA 2BRPA 3RVYA 2ATKC 2XNDG 4ZNCA 3CCJV 1X59A 2W0XA 1HWTC 2ZL8A 3M06A 3L74J 3CCMP 1HNWB 3B8MA 4IFDK 2FYUG 3T1HO 1OXZA 1MKMA 3LIDA 1PX3A 2E3CA 5ITZB 4FZ1A 5IY5B 1Q5OA 2W6IG 4LGDE 1OX3A 5EFWB 4DOJA 1L4AD 3G4SP 3VOPA 1HGZA 1HXKA 4Y99B 5BVZA 2PP6A 2A9HA 3KCXA 3H1HE 2WPRA 5APTA 1QVFO 4FLXA 1MABG 3SJAC 1COWG 4ZHQB 1J1DC 3CMEP 1JZ5A 2ZDIC 5K5GB 1PL0A 4PDRA 2ITCC 1K04A 1WMOA 3EVKA 5KHJA 2W83C 4X1IA 1NU1K 4ZKUA 1KTMA 2F1BA 2HVKC 2M5AB 2Y73A 4EIJA 3O6QA 1FS0G 3DYOA 4JTAB 3A0RA 2Y0EA 4JI1B 3FYEB 4JI5B 1H38A 4X65B 2RH0A 1TUBA 1JZ7A 1DH3A 1MN0A 3FB7C 3HE4A 4DR2B 1KFNA 3MUDC 1DIPA 2DE0X 1VQNV 4UVAA 3HPLC 1IBKO 3VMYA 1KBHA 1VIBA 1YTZI 1J2JB 1RM1C 1CI6B 2BRWA 5FPRA 1JY2O 1VQ6V 1YIJP 3ZRXA 1H54A 1N32O 1NSXA 1OVVA 1SA0A 3NFQA 3T97B 3S4BA 1GW4A 2XV5A 5KJ7D 4ASUG 2VWKA 1VMGA 3EFFK 5IYZA 3CXHF 1HNWO 1L0LG 4WY4B 3T2OA 4BZGA 2FKXA 1P84H 2HR3A 5BR8B 2CISA 1W2BO 3L75H 2UWJE 3L70J 5IJ0B 1MSDA 5B5EH 1Q8IA 1SQPG 3A0BZ 2QTSA 2QJYC 1PPJG 3IR9A 3FX7A 2H94A 1R3KC 5B1BB 2LXBA 3TY1A 4BIOA 4CPGA 3VDAA 2WLIA 1RWFA 1Q81W 3GLMA 1BE3D 1ZLZA 1IO4A 3A0HZ 1FJPA 1EZVH 1VQ8V 3B71A 2OYIC 1L0NG 3CX5I 2LGQA 4PDMA 2JS3A 4Z1MG 3W7SA 2UXCB 3KPEA 2BT3A 1S77D 2WZSA 1QQCA 2AXTE 2F1MA 1PL4A 3AG1C 1J5EO 1JZ2A 2W6BA 4PJ0E 2EIMB 3ETEA 4CC5A 1SQGA 2A06D 3CPWO 1D6YA 2WOHA 5KLVK 1YF2A 3CCLP 2HTBA 4X65O 1K05A 5EIBC 5AVUB 2UUBB 5L8RJ 2XKMA 3ZIAG 3A0OA 4DR2O 3JAWB 4O4IB 4MVRA 4G27B 4HYTB 3ZMUA 1Y76B 4KHPO 3SPGA 3U1AA 1Y47A 2JDIH 4KFFA 4RQFA 1SQFA 3HKEB 2CH7A 1O7DD 2WOFA 3DGEA 1KB9E 2XN0A 3K25A 3VD4A 1IK9A 1GTWA 3TGUH 2N1TD 3HKBA 1YYCA 5GW7A 2E43A 1L4AA 1JOVA 1N33B 4U7OA 5CBNA 1TQUA 1SQVG 2Q9IA 2UXNA 1ZWIC 1WP8A 1LTJC 2YUAA 1SKVA 2JKVA 4AYCA 4TOIA 3BVOA 3AE1C 3T0AA 2MK3A 1KU9A 2OT5A 2Z5IA 2QIWA 3JCUE 4O4JB 4FLVA 3FXEA 1GN6A 5FL7G 1YHQV 3UT5B 5J9PC 1MZ9A 2HPCA 1GAXA 5EC2C 4ABMA 1GL2B 2R9IA 4RUFA 2ZXWB 2BCCD 2P6JA 3IAQA 1AI5A 1KYOH 1K33A 1QX1A 2Y4UA 3DX1A 1KP3A 3K9AA 2K1EA 2C9LY 5DJTB 3RYCA 4FLWA 1JY3N 2IJHA 1K92A 3H1LH 4EB6A 1Z5VA 2YC0A 2UXCO 4RAIA 3II6A 3FB8C 4FNPA 2EJ7A 3E22A 1NU1E 4UB6E 5AVYB 2KLVA 2CQTA 4HKZH 4DUZB 3BUDA 1TGOA 1RSOB 5KHKA 2KI7B 2XAFA 3F5TA 5CA1B 2F7OA 1E5WA 4O2BA 5IY5C 4D6TH 4UCVA 1OMIA 1G4YB 1M1JC 1JR9A 4UCTA 4I6MC 1SIIA 3P3NA 3MUZ1 4Y99C 3V2PA 2JJ2G 3C90A 3ZN1A 2YFNA 4I4TA 1WT6A 2WW2A 4A7PA 1UJWB 2ZVOB 1QLNA 5B66E 3F89A 1ZMEC 5JH7B 3ZS8C 3GG2A 1SNZA 2QA4V 4DRXB 1NKNA 4PELA 3VYIA 4I7ZC 1I8QA 2BTQB 1XNQO 3L74G 4NTYA 2R9AA 1N33O 1E79G 3MIWA 2GM4A 1N34B 3WIQA 1KC8W 5GTIZ 4I55B 1ZP0C 1FPOA 3BRCA 2EIKC 4FFBB 4DR5O 3RK3B 2E76D 3NJVA 4F6RA 1WJZA 3P8MC 2KNCB 1Q81Q 1GW3A 3LUTB 1PGOA 3JAMN 3L73J 3E2EA 5CCGD 3P3PA 1VQNP 3E1RA 3V2RA 1SQBK 5TISH 3Q5SA 3ASNB 2Q5ZA 3H1ID 1NS0A 1NSVA 4FNTA 1AV1A 3CWBJ 4ZIBA 3FAVA 3G67A 2CE4A 5GONA 5APUA 1GM8A 1P84I 1HN1A 3CX5F 2D2CD 2ZAEB 2VS0A 1NTMK 1SQQJ 2L35A 2AXCA 4J9ZB 4DW0A 3FB5C 5BMVB 3IFMA 1QR8A 4N78D 1DD3A 5KLVE 4PHZA 5KKZB 4KFEA 2B9BA 1RWCA 5ITZA 5L3EA 1AR4A 2FYNB 1LP1B 2JR8A 2YXQB 4MTOA 1NTMJ 3H1HH 3ZDMA 2F23A 1X1IA 5E79E 5JWPA 4FNRA 4I50A 2B87B 5E1AC 1YJNV 2IPPA 2QSIA 3PHLA 2WTYA 4TT3H 1VQ8P 3L36A 3VQVA 1AFOA 1H2SB 3VMZA 3BVTA 3HIGA 3QG0A 2CK3G 1S5LE 2XHNA 4H44B 1N34O 4MVQA 2ZNIA 4EYYQ 1EDIA 4QPKA 3SPHA 1H2MA 1FDIA 2JS5A 4U7NA 4LH7A 4JI2B 2QM4A 3AK1A 2XSGA 3AK2A 1PP9J 5H2FZ 3JATB 1ZL8B 5AVXB 2A06E 2G38A 2IBZI 2GUSA 1HR0B 3D50A 1IC2A 4HZ3A 1R6TA 2M7WA 2WYHA 2PF4E 4DV6B 2ZFCA 3SWKA 4BTXA 2IFMA 1KSIA 1CI6A 1LTBC 2OYOA 4NTXA 4QE9A 3B8EB 1J0NA 1CZQA 3ZMZA 2H8PC 3OR7C 3E1F1 1V9PA 4LF7B 3RK2C 1M9NA 4EDFA 4UV9A 3U0ZA 1JMBA 3T97A 4J41A 1I0HA 1RE3A 1LTSC 4X20A 5LP6B 1XI1A 1N73B 1EZVD 5KUMA 1PD3A 4WY4A
chains in the Genus database with same CATH topology
2HR3A 3EJUA 3DX3A 2M5AA 3BUPA 2B89A 2F7PA 2UWJE 1TQSA 2OW6A 1JM0A 3BLBA 4K35A 2SPZA 2LR2A 2LXBA 2QRXA 1Q2NA 5C39A 4CPGA 3RGUA 4JBZA 4IOIH 3EJRA 1TQTA 3BVVA 5DJUB 1QWUA 1TQVA 2KZJA 1S3JA 3DX4A 1EDKA 1HTYA 4GODA 4WWIA 2KS1B 3D4YA 4ASWA 2KZIA 2F7RA 3S1KA 4KJMA 2K3RA 3QWOC 3BUBA 3EJTA 3BVUA 3MHVA 3EJQA 3D51A 2P58A 2ZAEB 4ZNCA 4NPFX 1EDLA 3BUIA 4MN4C 2I8DA 1EC5A 1EDJA 1Y47A 3D52A 3LVTA 1OVRA 3EJPA 1O7DD 3BVWA 1ZXGA 4NPDA 2FYVA 5EFWB 1LP1B 5CBNA 4K3AA 1HXKA 1TQUA 2LXCB 3ZDMA 1PS3A 2QVAA 1TQWA 2B87B 2B87A 2KIKA 4ZMDA 3FXEA 5CBOA 1HWWA 3BVTA 5K5GB 1H0TB 1U7JA 3D4ZA 1SS1A 4BXLA 1MFTA 2R44A 3FXDA 1H0TA 2F18A 1R34A 3EJSA 1NVOA 3DDGA 4EYYQ 1EDIA 3CV5A 3CZNA 2B88A 2M0BA 2OTKE 2F1BA 1QX1A 2M5AB 3DX1A 1DEEG 3PH0A 1OVUA 1LT1A 2KUBA 2F1AA 1BDCA 5DJTB 3DX2A 2WMMA 1BDDA 1QWNA 4NPEA 2WYIA 1FC2C 1LP1A 3DX0A 1X0TA 4GOEA 4GOFA 3D50A 3BVXA 4ASVA 1ZW0A 2F7QA 2WYHA 4HKZH 2RKLA 3BUDA 3CZSA 2OW7A 2KI7B 2F7OA 3BUQA 3DDFA 3MZWB 2JWDA 1OVVA 2Q1KA 5KBPA 1R33A 1JMBA 1U7MA 4HJGH 4HB1A 2ALWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR3 A;  3EJU A;  3DX3 A;  2M5A A;  3BUP A;  2B89 A;  2F7P A;  2UWJ E;  1TQS A;  2OW6 A;  1JM0 A;  3BLB A;  4K35 A;  2SPZ A;  2LR2 A;  2LXB A;  2QRX A;  1Q2N A;  5C39 A;  4CPG A;  3RGU A;  4JBZ A;  4IOI H;  3EJR A;  1TQT A;  3BVV A;  5DJU B;  1QWU A;  1TQV A;  2KZJ A;  1S3J A;  3DX4 A;  1EDK A;  1HTY A;  4GOD A;  4WWI A;  2KS1 B;  3D4Y A;  4ASW A;  2KZI A;  2F7R A;  3S1K A;  4KJM A;  2K3R A;  3QWO C;  3BUB A;  3EJT A;  3BVU A;  3MHV A;  3EJQ A;  3D51 A;  2P58 A;  2ZAE B;  4ZNC A;  4NPF X;  1EDL A;  3BUI A;  4MN4 C;  2I8D A;  1EC5 A;  1EDJ A;  1Y47 A;  3D52 A;  3LVT A;  1OVR A;  3EJP A;  1O7D D;  3BVW A;  1ZXG A;  4NPD A;  2FYV A;  5EFW B;  1LP1 B;  5CBN A;  4K3A A;  1HXK A;  1TQU A;  2LXC B;  3ZDM A;  1PS3 A;  2QVA A;  1TQW A;  2B87 B;  2B87 A;  2KIK A;  4ZMD A;  3FXE A;  5CBO A;  1HWW A;  3BVT A;  5K5G B;  1H0T B;  1U7J A;  3D4Z A;  1SS1 A;  4BXL A;  1MFT A;  2R44 A;  3FXD A;  1H0T A;  2F18 A;  1R34 A;  3EJS A;  1NVO A;  3DDG A;  4EYY Q;  1EDI A;  3CV5 A;  3CZN A;  2B88 A;  2M0B A;  2OTK E;  2F1B A;  1QX1 A;  2M5A B;  3DX1 A;  1DEE G;  3PH0 A;  1OVU A;  1LT1 A;  2KUB A;  2F1A A;  1BDC A;  5DJT B;  3DX2 A;  2WMM A;  1BDD A;  1QWN A;  4NPE A;  2WYI A;  1FC2 C;  1LP1 A;  3DX0 A;  1X0T A;  4GOE A;  4GOF A;  3D50 A;  3BVX A;  4ASV A;  1ZW0 A;  2F7Q A;  2WYH A;  4HKZ H;  2RKL A;  3BUD A;  3CZS A;  2OW7 A;  2KI7 B;  2F7O A;  3BUQ A;  3DDF A;  3MZW B;  2JWD A;  1OVV A;  2Q1K A;  5KBP A;  1R33 A;  1JMB A;  1U7M A;  4HJG H;  4HB1 A;  2ALW A; 
#chains in the Genus database with same CATH topology
 3N2G A;  3H6P A;  1XEQ A;  4IIJ A;  3P7K A;  1FZB A;  3EJU A;  2ZD9 A;  1XL6 A;  3SSU A;  2BOB C;  5CMZ A;  3X41 A;  1NI8 A;  2XOK G;  3X3Y A;  3ZRV A;  2L6L A;  4O4H A;  1XQ8 A;  2QKC A;  4U3F G;  2V1D A;  1W59 A;  4X62 B;  1GL2 C;  4IL6 E;  2ZXW C;  1YIT V;  1KC8 Q;  3GHG B;  1YGA A;  1LTG C;  3QO5 A;  3CL3 D;  1FYJ A;  1LUR A;  3A24 A;  5J2U B;  4YXW G;  3AE4 C;  4DK0 A;  5EBM C;  4C7U A;  4Z1V A;  2OOV C;  2ZKO A;  2BCC E;  1KIL D;  4DZO A;  2CWV A;  5F2V O;  2FUT A;  3M9B A;  3D6Z A;  3NMD A;  3D4Y A;  1IVU A;  2AXT H;  1VF7 A;  3TGU D;  2ZVN B;  4PJ0 H;  4HAM A;  2CFW A;  4JI2 O;  2WSS G;  4WFG A;  3BCC D;  3JSL A;  2OAR A;  1XMQ O;  4YIP A;  3LOY A;  1DTO A;  2K3R A;  1YQ4 C;  1AR5 A;  3CCE V;  1K5Q A;  4PA4 A;  4W7Y A;  1F23 A;  2C0X A;  5IT9 N;  4HNA B;  2E74 B;  1HR0 O;  1IFN A;  4TV9 B;  3JAW A;  4DV6 O;  1URQ B;  3GF3 A;  3TCU A;  1Y74 B;  4YXD C;  2FY8 A;  2KG7 B;  3UQ8 A;  1OVR A;  1HM2 A;  5AW8 B;  3SWF A;  1P84 F;  2QA4 P;  2W6J G;  1BHB A;  1G6U A;  1QEX A;  5CBG A;  3JSV C;  4LF7 O;  3L72 J;  1KYO D;  3AEI A;  1N7R A;  4K3A A;  4JZ2 A;  1EXJ A;  3HII A;  1IXB A;  5CJ0 A;  2PI5 A;  1QR9 A;  3IFX A;  2WSE J;  3L75 J;  4BAY A;  1HNZ B;  1THZ A;  1GRJ A;  3RK3 C;  2OYQ A;  5AW2 B;  4PV1 D;  3CD6 V;  3H1L D;  1NSZ A;  4KL1 A;  1HM3 A;  2V7Q J;  4B3T O;  4CH6 A;  4ZMD A;  1OJM A;  4O4J A;  2IDB A;  1JY3 O;  1W7C A;  3APO A;  4RNL A;  1DEB A;  3UT5 A;  4B7E A;  3DEC A;  4X62 O;  1U97 A;  3ASN C;  3SPJ A;  3STZ C;  4C7N A;  1VQO P;  3HB3 B;  3CZN A;  1PNL A;  1GL2 A;  1FD9 A;  4MW3 A;  4LNU A;  3SDL A;  1NTZ J;  2Y9Y A;  3ZHU A;  4H37 A;  3H1I E;  1S72 P;  2KUB A;  3GWK C;  4WF9 V;  3SPC A;  2CIQ A;  5K1X A;  1BCC E;  3DX0 A;  3RYF B;  4GOF A;  4UB6 H;  1FDO A;  1GK6 A;  1VEW A;  3H1J D;  1PKX A;  1YJW V;  5KKZ C;  3HTK A;  2JJL A;  3ML0 A;  1BGY D;  2FYU K;  1JQ0 A;  3L73 G;  1IVX A;  1P4R A;  1M1K W;  4N78 E;  2EAD A;  1VF5 D;  2OYH B;  1LUW A;  4H0L B;  4JI6 B;  2Q1K A;  5H9C A;  1YI2 V;  1F4M A;  3KDP B;  1R33 A;  3CWB G;  5AW7 B;  2A0L A;  4OGQ B;  1YJN P;  3ECQ A;  1SQX D;  3H1K G;  1QAK A;  2NR5 A;  3WU2 E;  1JJO A;  2Q3I A;  3CMA V;  5JH7 A;  1Y8A A;  2O1K A;  1SQQ G;  2YSU B;  2OW6 A;  2NPS D;  1BT8 A;  3Q4H B;  4DRX A;  3D36 A;  4H44 C;  1GKF A;  2JK5 C;  2LFR A;  4UCR A;  2QRX A;  1S5H C;  5KHH A;  2PUS A;  1UG9 A;  2CTW A;  1HNZ O;  5IYC O;  3SPI A;  4FFB A;  3IAY A;  1Y9B A;  1M7L A;  3V4W A;  3BVV A;  1NKZ B;  2KNC A;  1Z45 A;  2GDS A;  4C7R A;  1IBM B;  1LNQ A;  2QEX V;  1PFI A;  2F43 G;  2Q73 A;  2QKS A;  3K59 A;  2N74 A;  4I9Q A;  2V4D A;  3ZN0 A;  3VQY A;  1SPU A;  1HF9 A;  1D7M A;  3O9O A;  1RE4 C;  1WPX A;  4EFE A;  3WMM 0;  2DW4 A;  3H1H D;  1MOF A;  1CXZ B;  3CSX A;  5FNV A;  2C9N Y;  4LFB B;  1EN5 A;  1BSM A;  1JFF B;  1ZX3 A;  5HFL A;  5KTB A;  4DV2 B;  5CCH C;  3BUI A;  4JI4 B;  1NTK G;  1N73 C;  1PP9 G;  2H7H A;  1L0L K;  1Y66 A;  5AVS B;  1KEC A;  5BMV A;  4DV0 B;  2XDJ A;  1ENV A;  3MP7 B;  5H6Q A;  3NR7 A;  3KZI Z;  1NH2 D;  5B1O A;  2BE3 A;  2KB7 P;  4F4L A;  4WFA V;  4JI6 O;  3FWL A;  1SQP K;  2ZIO A;  3E8F A;  1FZA A;  4I1L A;  1V7V A;  4J11 A;  2X0L A;  5E79 H;  4KT0 J;  3VD5 A;  3FFQ A;  5LMU B;  4H13 D;  1NAF A;  3C3S A;  1TU3 F;  2B87 A;  2JKE A;  3HKC B;  2Y0I A;  4MT8 A;  3PRJ A;  1NZ6 A;  1IZN B;  4GT1 A;  1KQS U;  1ROP A;  1VQP V;  4UB8 E;  3K06 A;  1S5L H;  1MMU A;  2IJI A;  4LWS A;  4BWA A;  1TU5 A;  1FAF A;  1FJK A;  3OGC C;  5LMN B;  3ZCC A;  1L0N K;  3H01 A;  1SS1 A;  3DCD A;  4J5T A;  2R32 A;  3JD0 A;  1NVP B;  2M0B A;  3RRS A;  1DEE G;  3CCE P;  5EZY B;  3B2E E;  2A06 H;  3JAT A;  4ZOL B;  1IBM O;  2BTO A;  3RN4 A;  2NNU A;  2IU0 A;  1ZL8 A;  1QU7 A;  4J10 A;  3VTP C;  2E74 C;  1XHX A;  2O01 H;  5DM6 V;  1O9G A;  1RPR A;  5JCO A;  4LFC B;  1URQ C;  2CG0 A;  4DR6 B;  1QCE A;  1EKM A;  1Q6I A;  3C3T A;  2X6C A;  3LSS A;  1S9K D;  1RY3 A;  1XDC A;  1JUN A;  1DLB A;  1HP8 A;  3DTU B;  4B3M O;  4LFB O;  3ZHS A;  1HMW A;  1BZK A;  2AEM A;  4ZBM A;  3AE2 C;  4YY3 B;  1SQV K;  1LUV A;  2FYU E;  5LP6 A;  3CRA A;  4DV0 O;  2UUA B;  1YDX A;  2WQY C;  1FKA O;  2Q5U A;  3SYO A;  4N6J A;  1AQ5 A;  1NKD A;  3D3Q A;  4L73 A;  1OW7 A;  2OYI B;  1OCR C;  4PI0 A;  3IF4 A;  1IFP A;  5AVZ B;  5JJN B;  1A32 A;  3CCU V;  1GK4 A;  2YKP A;  4IL6 H;  5C39 A;  3AG1 B;  1XRE A;  2EIN B;  3AG3 B;  2KP8 A;  3CXH I;  3Q5R A;  3N27 A;  2WSC J;  2E2V A;  1N7S A;  3GHG A;  4RO2 A;  2QKA A;  1T5E A;  2BCC H;  3CRQ A;  3N4X A;  2EJR A;  4J80 A;  3HD7 C;  5J2U A;  2Z5H A;  3TXQ A;  1Q43 A;  1IXM A;  3IGA C;  2M3B A;  5M1B A;  3L75 G;  1H88 A;  5B5E Z;  4FNQ A;  4PD4 D;  1KB9 D;  4WFE A;  5IYB O;  2HP8 A;  5AW1 B;  4ASW A;  2WT7 B;  4JF7 A;  1JCH A;  2V7Q G;  3IMH A;  3MGN A;  4TV8 A;  1IK7 A;  2JGD B;  1QAL A;  3H1J E;  4FVM A;  5KUK A;  3K0G A;  4K8X A;  1W0J G;  3MV1 1;  3THO A;  1BGY E;  1YI2 P;  4BZF A;  2KKW A;  5J2T A;  1WPB A;  1LTJ B;  1NH4 A;  4HNA A;  1NTZ G;  2D73 A;  4TV9 A;  3W7T A;  2Y69 C;  3BFR A;  4DR6 O;  1Y74 A;  4EKW A;  1NSU A;  2V4H A;  3CMA P;  2KG7 A;  3M0D C;  1I08 A;  5APW A;  4XDL A;  1HN0 A;  2OCC C;  1SQX E;  3HE5 B;  2VQF B;  1Z56 A;  1GK9 A;  3AG7 A;  1N7P A;  3HI7 A;  2EIL B;  1M8O B;  2HHH B;  3P8C D;  4YY3 O;  2YXL A;  4J42 A;  2YO2 A;  2LW7 A;  1FXH A;  4YPC A;  2HEP A;  3PP5 A;  2UUA O;  4P30 A;  3VOU A;  1USD A;  2KIK A;  1Q6H A;  4KP4 A;  3LIE A;  3WUV A;  1NU1 D;  2GUZ A;  2JDI G;  2N9Y B;  2E42 A;  1QLE D;  1SQP E;  3USS A;  1YSC A;  2QEX P;  3VSN A;  1UII A;  2PNC A;  1XL4 A;  4JI8 O;  2FKW B;  5KAI E;  1EN6 A;  4BXL A;  3VSM A;  2IBZ G;  3FXD A;  5H5N A;  3ABL C;  4GX0 A;  2OGU A;  1HJB A;  3DDG A;  1R5L A;  3B40 A;  2N04 A;  3JAS B;  3JSN A;  1Q86 W;  4UCU A;  1JZ8 A;  3H1I H;  1SER A;  5LOV B;  1T6A A;  2VQE B;  1DYU A;  1M1J B;  1GZL A;  1L0N E;  1QWN A;  2ZCE A;  2XAQ A;  2ZE5 A;  4BIU A;  2IX7 C;  3L70 D;  4P9P A;  4D7S A;  3E8H A;  4FPP A;  2P67 A;  1YVW A;  3RYF A;  2WWW A;  1JOY A;  2ZXE B;  1SF9 A;  2JEU A;  4IGG A;  5LA6 B;  4NB5 A;  1DD4 A;  2A7W A;  1K73 W;  1MZE A;  1LTI C;  1QVG O;  3RBX A;  1V54 B;  4I7Z B;  1V7W A;  1R6K A;  1WB8 A;  2OYH A;  2N1T B;  2HJF C;  4XBF A;  2W0Q A;  3HKD B;  3JAK B;  1ZN5 A;  1RF0 C;  1D6U A;  2EIK B;  1TVK B;  3P30 A;  3WB0 A;  3WFV A;  3AE6 C;  4O4L B;  4UXN A;  1RPO A;  3WU2 H;  1GU4 A;  5AVW B;  2B89 A;  2F66 C;  1YJ9 V;  3CRM A;  4JAV A;  4DW1 A;  1VQP P;  3VBB A;  2NN4 A;  2VQF O;  5AW4 B;  1VQL P;  4MTF A;  1SFC A;  1SQV E;  3B09 A;  2HHH O;  3H32 A;  4D6T G;  1FFT B;  4WBN B;  1J1E C;  2DMX A;  2LJ2 A;  4FK5 C;  2QG4 A;  4MVM A;  1T3U A;  3BY6 A;  2Y74 A;  3CJH B;  1FXK A;  4NXN B;  1DP0 A;  1TQV A;  3M9H A;  1LOH A;  3L37 A;  5LGU A;  2J5U A;  5KLV D;  3ZRW A;  4B08 A;  2W6A A;  1O9H A;  3ETQ A;  3WA3 A;  4LBE C;  5CBF A;  2RMZ A;  2GA1 A;  1JMK C;  1JY2 P;  3OJA B;  1JZ4 A;  4TTG A;  2FL4 A;  2A45 I;  3OR6 C;  2BRV X;  4LFA B;  3I5C A;  2VQE O;  4L74 A;  4R8C A;  3BVU A;  1N8R Q;  1DGS A;  3OT7 A;  3MTU E;  1M93 A;  2L91 A;  2PGG A;  3OGI B;  3JD2 A;  1S9K E;  5FLX N;  1ZR4 A;  3H25 A;  1KD1 W;  1US1 A;  3RBZ A;  2K88 A;  4UCO A;  5TIS Z;  4NR1 A;  1ZOY C;  2N05 A;  2E75 D;  4QIW F;  3T4D A;  3FX0 A;  2FYV A;  2AW9 A;  2ZDI A;  2BEZ F;  1N7O A;  3ACT A;  2EUL A;  3UM7 A;  4LF8 B;  2EIN C;  3KYQ A;  3AG3 C;  4TQD A;  1PS3 A;  2G8Y A;  3TXS A;  1AJQ A;  4ZKP A;  3QDE A;  2RQ6 A;  1HW7 A;  3CHX A;  2IZ1 A;  3K04 A;  1AJP A;  4JI1 O;  4JI5 O;  4B3S B;  3HKC A;  1I94 B;  4UB8 H;  3L74 E;  5CBO A;  3G6E P;  4NYK A;  3MUD A;  4A5U B;  4AIL C;  2ZQ0 A;  1FZG A;  1QAF A;  5GTI E;  4U3F J;  2P5O A;  4QGP A;  4FLT A;  4PD4 E;  1NR7 A;  4H33 A;  5LYJ B;  4NXN O;  3B5N B;  1JZ3 A;  2Y9Z A;  1Q86 Q;  1GU5 A;  4J9Y B;  2E22 A;  3BCC H;  5EC1 C;  4W4L A;  5EZY A;  3RK2 B;  1S0V A;  1FC2 C;  4GYC B;  2NZ2 A;  3CEI A;  4YIO A;  4CS4 A;  2D2C B;  4EV2 A;  1ZW0 A;  5BR8 O;  5KX5 B;  5KJ7 C;  2H88 C;  1E1Q G;  1USE A;  4FM2 A;  2G3A A;  4I9W A;  4IFM A;  2CUG A;  3SX1 A;  4LFA O;  3G9R A;  1K73 Q;  1V7X A;  1G8M A;  5LGT A;  2YIC A;  3MHS C;  4DV7 B;  3CC7 V;  1NQT A;  3HUS B;  1G2C B;  2J58 A;  2EIL C;  4W80 A;  1T2K D;  2KSE A;  2WGQ A;  2Y48 A;  4IYH A;  2FYU H;  1WN7 A;  2AZ0 A;  2HTA A;  4TSF G;  3WFA A;  4DR4 B;  3RL0 D;  3L71 D;  5C8Y B;  1BHA A;  3ZMS A;  1JOC A;  3P8C E;  2HFE D;  1QBZ A;  4OVN F;  2QWP B;  1F1S A;  3L9D A;  1L8D A;  2PYJ A;  2JKP A;  2XHB A;  3CCJ P;  3SYQ A;  2OYI A;  2QJ1 A;  3BLB A;  2ZXQ A;  4DR7 B;  2SPZ A;  2FXP A;  4LF8 O;  1FU1 A;  1R73 A;  2FTK A;  4JI7 B;  2VRZ A;  1BE3 J;  4MVU A;  1SQB D;  3ALA A;  1TA8 A;  1KQG B;  2HVJ C;  5B1A B;  3V5B A;  3EXA A;  1I94 O;  2UUB O;  4B3S O;  2CFD A;  1YXB A;  3QF7 A;  3KII A;  3UKM A;  2ZNJ A;  3OUS A;  3EHB B;  2QJP B;  4WY4 D;  4PA7 A;  2P90 A;  2B5U A;  1NTM D;  3L70 E;  1K4D C;  2WT7 A;  2ETN A;  1JB0 J;  4WB4 A;  2Q8V A;  4D7T A;  3BHP A;  3H1J H;  2RMK B;  2BOC C;  2JGD A;  3S4C A;  3T0D A;  1V54 C;  2O01 J;  1Q7Y W;  1BGY H;  1N36 B;  4FNS A;  4KUM A;  2CDY A;  3EJQ A;  2N1T C;  2ZM6 B;  1RHZ B;  1ULV A;  5AG2 A;  2PGD A;  1LTJ A;  4N23 A;  3JCZ A;  4X1Y A;  5A9G A;  2OIE A;  4BTY A;  2QE7 G;  1A2V A;  4FLY A;  2DQ0 A;  2AXT Z;  4LF9 B;  1KD1 Q;  1JYV A;  3EJP A;  2YXY A;  1GM9 A;  4PJ0 Z;  1SQX H;  4DV7 O;  1SQQ K;  2X03 A;  1FZF A;  3HE5 A;  4W4K A;  3OW2 U;  4YJ3 A;  2Q6Q A;  4RKU J;  2GV9 A;  1VQ6 P;  2P22 C;  1FZC C;  4GKJ B;  4GUN A;  1NOH A;  4DR4 O;  3J7A U;  5APV A;  1BCC D;  1M56 D;  1VPC A;  1ZRT E;  3H1K J;  4CH5 A;  4Z2W A;  2EX3 A;  2WDA A;  3TET A;  5GTH E;  1HWW A;  3M7M X;  5KAI H;  5AW9 B;  1L2P A;  1KIL B;  2JWA A;  3W7X A;  1MFT A;  2R44 A;  4DUZ O;  5APS A;  2Y0P A;  2WW1 A;  4JI7 O;  2CTQ A;  1BL8 A;  4BW9 A;  2BCC J;  4PDV A;  4P2Z A;  1IVV A;  1W3Y A;  1VF6 C;  3TYY A;  1M57 D;  1H2G A;  3RW0 A;  3M99 B;  4R6Z A;  3QNE A;  5LOV A;  1EZV I;  4M3L A;  5CN0 A;  1BDD A;  3DX2 A;  4NPE A;  4IYI A;  1M1J A;  3Q3D A;  1FXV A;  2KOG A;  3X3Z A;  5KAF E;  1N9E A;  5L3C A;  1QX8 A;  1BQ0 A;  1NTK K;  1V55 C;  3RYH B;  1NHL A;  1URF A;  1X4T A;  4ZHQ A;  3SJQ C;  4BW5 A;  2JIZ G;  1N36 O;  3MD0 A;  2ZM6 O;  1SIH A;  3AMO B;  5KBP A;  1KZU B;  1W6C A;  1GL2 D;  4ZKI A;  3JAK A;  2HG5 D;  1IFM A;  1SO0 A;  1VQ5 V;  1NTK J;  3K5B A;  4UB6 Z;  2M5A A;  3QFY A;  1HUC A;  2E76 C;  2XTA A;  3WB1 A;  4AUW A;  1SQV H;  2XNX A;  2FFD B;  1NSR A;  2P10 A;  5CCG C;  2KXP B;  4JAU A;  1ZR2 A;  4GKJ O;  2ILM A;  4WBN A;  4EV5 A;  1XBL A;  3V2Q A;  1H8E G;  2KYV A;  3ZHQ A;  3B5N C;  1B3Q A;  1X8Y A;  2DN9 A;  1IBL B;  3DXR B;  3CJH A;  4DR1 B;  5AW6 B;  2B1G A;  1EM1 A;  3DX4 A;  4DV5 B;  3STL C;  2ZR2 A;  1D6Z A;  3FYI B;  2JGU A;  1SZT A;  3ZMT A;  1IVS A;  2WPV B;  2PZS A;  3R4Y A;  1HTY A;  4XA4 A;  2D2C C;  3L72 D;  1VQ7 V;  3ICX A;  4I0X B;  2P7J A;  3NXS A;  4ZI7 B;  4NVP A;  1PX4 A;  1ZTE A;  1KYO I;  2CTR A;  4EI2 A;  1YHQ P;  2LP7 A;  5IJ0 A;  4BR6 A;  2BSK B;  1Y4M A;  3CC7 P;  1Q7Y Q;  1NO4 A;  3HUS C;  1F51 A;  4DUW A;  2EZO A;  1N86 A;  4NPF X;  1LT9 B;  4AQR D;  4MN4 C;  3LNM B;  5K1P A;  3G71 V;  3M91 A;  4JYB A;  3D52 A;  5HFM A;  5JMD A;  2XAG A;  2CAZ C;  1MUU A;  4GX1 A;  3W7W A;  3Q1N A;  4OK4 A;  2WVR A;  1ZSP A;  2WLL B;  3IN6 A;  3L71 E;  2E2U A;  1IVW A;  4BZE A;  2NPS B;  3CWB E;  1NS8 A;  2WVY A;  2YID A;  2LXC B;  2IFN A;  5IDJ A;  3CS5 A;  3BAS A;  2YIB A;  2HOD B;  3S4R A;  2WVX B;  1W5Z A;  1EZJ A;  4DV1 B;  1JTH B;  2OTJ V;  1K8A W;  5B1A C;  2YKO A;  3BRV B;  3MWX A;  3QO7 A;  2DYS C;  5KHI A;  4PA6 A;  5KMG B;  1SQB E;  3T2Q A;  1AA0 A;  4OXS A;  4DV4 B;  1IFI A;  3CX5 E;  3D4Z A;  2OTL V;  4O4I A;  1XTG B;  4CZZ A;  3U10 A;  4LF4 B;  4J7K A;  2QJP C;  1Y76 A;  1IDS A;  2LQT A;  2Y4T A;  4X1K B;  1KB9 H;  4PD4 H;  3HKE A;  5E79 Z;  1OCZ B;  1PM9 A;  1FZE A;  4HH2 A;  1IBL O;  4DK1 A;  1JO5 A;  2FB5 A;  1N0N A;  4DR1 O;  1NTM E;  1LT1 A;  1OW6 A;  1H8A A;  2FYU D;  2F1A A;  1VQM V;  4MW8 A;  3K58 A;  3D71 A;  2QSA A;  3B77 A;  1OJP A;  3N2K B;  1BE3 G;  1S5L Z;  1AB3 A;  3E1I A;  4JZG A;  5E1Q A;  2EIJ B;  1NTZ K;  2P1J A;  2QWR B;  3QH9 A;  3AG4 B;  5KX5 A;  3JCU H;  2K37 A;  2CGN A;  3ABT A;  1AI4 A;  1OW8 A;  1OCR B;  4F6E A;  2WLM A;  1M5I A;  2EAB A;  3APQ A;  4TUY B;  1NH2 B;  4JTD B;  4FNU A;  2CFK A;  3E35 A;  2A06 G;  1G2C A;  1BS3 A;  1PP9 E;  2O1J A;  3R66 A;  3L4F A;  1XOU A;  1M4U A;  3AE3 C;  4DUY B;  2ZT9 B;  2LGW A;  2ZYD A;  3AE9 C;  3KZI E;  3UIA A;  5C8Y A;  3HD7 B;  1F4H A;  1LJ2 A;  2OOV A;  1TQS A;  4GCZ A;  5JVD B;  2WCO A;  1H8H G;  3A3Y B;  1GMG A;  1BMF G;  3CP1 A;  3OMI B;  1NU1 H;  3RWR D;  1JY3 P;  1HMU A;  1KIL C;  2XN1 A;  2UXX A;  4WCE V;  3WVF A;  1Q2N A;  3VD9 A;  2MKV A;  1E1R G;  1RSO A;  1IFD A;  1L7K A;  3EJR A;  1OCO B;  4DV1 O;  5CA1 A;  2DQ3 A;  3HR0 A;  2A45 G;  1MMZ A;  5DJU B;  4GDO A;  1QWU A;  1FFX B;  2RJZ A;  2LKM A;  2GSM B;  3OUF A;  3G6B A;  1XNR B;  1EQ7 A;  1NYH A;  3VP9 A;  4DV4 O;  4IFF A;  1YEW A;  5FPO A;  4GOD A;  5CCH D;  4LF4 O;  1VL2 A;  3EWK A;  3TGU J;  5B66 H;  2Y69 B;  3L70 H;  2KK7 A;  2IM9 A;  3CB2 A;  3BCC J;  4U7J A;  1L7J A;  4IL6 Z;  3WG7 C;  3JYC A;  3NJX A;  3CCQ V;  2OCC B;  1L0L D;  2HLD G;  2ZQM A;  4WFH A;  1KMI Z;  2BTQ A;  4O9B A;  2RCV A;  5IWA B;  2BCC G;  1EDL A;  4B3R B;  1Q6U A;  1HDJ A;  2QWQ B;  3X3X A;  1SQP D;  4I55 A;  1PPJ D;  1N7S D;  2ZE8 A;  1KYO F;  4X1I B;  3T4Z A;  3D8C A;  3J81 N;  2D1W A;  3QVN A;  4J7J A;  2ZYA A;  1KKD A;  1TUB B;  1OV9 A;  4GKK B;  2FFD C;  3SJB C;  3ABL B;  3HE4 B;  2Z3Y A;  1WLE A;  3IAO A;  4NXM B;  1EFR G;  1L0N D;  4DUY O;  2QVA A;  2WLH A;  3H1L J;  1DX7 A;  2PI4 A;  2YNY A;  1LGH B;  5GTH H;  3CI9 A;  4R7C A;  1K8A Q;  3TJT A;  1GO3 F;  4TWK A;  1FOS E;  2A79 B;  1NS7 A;  1W2E A;  3SJC C;  5KLV H;  3OA7 A;  4P9O A;  5IYZ B;  4D6T J;  1OZ0 A;  4TQF A;  3CV5 A;  1S1C X;  2HLO A;  1N4C A;  1LXK A;  3CCM V;  3V6I A;  2YFO A;  2W27 A;  3L72 E;  3BAT A;  1P84 E;  1XNR O;  2O01 N;  1BDC A;  3ZHV A;  3PJS K;  3GF7 A;  3L75 E;  1XIL A;  1CEZ A;  3CRC A;  1LP1 A;  1GN2 A;  4NTW A;  1VF5 C;  5KAF H;  4RUE A;  1LT9 C;  1YIT P;  3G71 P;  2MW2 B;  3H1J J;  2Q7C A;  1AJY A;  2WLI B;  2DYR B;  3AE8 C;  5KA5 A;  5L3D A;  2XAS A;  5L3G A;  1SQV D;  3RYH A;  1D2D A;  3WIR A;  3OE7 G;  3LNN A;  3AE7 C;  3E7J A;  3MZW B;  2Z4E A;  3RK3 E;  2E5L B;  3H1I G;  3TSI A;  3W68 A;  3Q5P A;  5IWA O;  2NPS C;  3BA9 A;  4GX2 A;  5LHH A;  3CME V;  5LHG A;  3KKY A;  1QVF U;  4B3R O;  1NTZ E;  3IC9 A;  1RH5 B;  4HB1 A;  3MPH A;  4IHJ B;  1J1E B;  3BVH A;  1C82 A;  4OK2 A;  2ARH A;  1SQX J;  4GIF A;  4B86 A;  1JYW A;  3RVZ A;  2OTJ P;  2W6J H;  5KA6 A;  5B1N A;  3BUP A;  3H9V A;  1YQ3 C;  1KB9 I;  1K7D A;  3ZHR A;  3A2F A;  1X1H A;  4K0K B;  2R9R B;  2R5B A;  5LXT B;  1WMN A;  2OTL P;  4GKK O;  3GW6 A;  4E4E A;  4YHH B;  1T3J A;  2FYZ A;  3FD9 A;  1U96 A;  5CA0 B;  4UV8 A;  4NXM O;  1VQ9 V;  3WUU A;  5APQ A;  1RE4 A;  1OCZ C;  4LF6 B;  1RFY A;  2CH7 B;  4L87 A;  1RWG A;  3SGI A;  1S3J A;  3PLN A;  3WU2 Z;  1M1K Q;  2ADQ B;  3HKB B;  3MDS A;  4H0L D;  1W2Z A;  4DV2 O;  2WIT A;  3C8V A;  1GH6 A;  2PFX A;  4JI4 O;  2IBZ E;  1L4A B;  5CCH A;  3A7O A;  3M9Q A;  1BSN A;  1N73 A;  1JVM A;  2EIJ C;  4OGQ D;  2Q0O C;  3CD6 P;  3AG4 C;  2QDO A;  3OM3 B;  3F5H A;  2YO3 A;  1JNM A;  2CIR A;  2F7R A;  3H1H J;  3JD1 A;  1N0J A;  2M6Y A;  4K8Z A;  1NR1 A;  1NS1 A;  3E89 A;  1YZB A;  2BSK A;  2IJK A;  4DR3 B;  1S76 D;  1SFC D;  2Q1F A;  4BRY B;  3X2Q C;  5LMU O;  1D5A A;  3SFD C;  2JRI A;  1AQT A;  3OEH G;  3L74 D;  3OMA B;  2PRR A;  4MS2 A;  1RW9 A;  4HBN A;  2YS8 A;  3AEG C;  2R3S A;  2ZT9 C;  1P7B A;  1H2N A;  4JTC B;  4NKG B;  1G1I A;  2WLN A;  4OPH A;  3L71 H;  3D3I A;  5LMN O;  2E5L O;  3IC7 A;  2KSJ A;  1UFI A;  3CWB H;  4R4M A;  4B7K A;  1YJW P;  4RQE A;  3E22 B;  4MMH A;  2K9Y A;  1FS0 E;  1OCO C;  1VQK V;  2WPS A;  2WVX A;  1ZV8 A;  3PN1 A;  3T2P A;  3C9I A;  4FMT A;  1DK1 A;  4JYA B;  2O3J A;  1SQB H;  4K0K O;  1GDT A;  1JYN A;  3CX5 H;  1OJN A;  3V4Q A;  1EZV G;  2ZIM A;  5KMG A;  3CCL V;  2M8R A;  4HYO A;  4N21 A;  3Q1M A;  4YHH O;  4LFC O;  1U7J A;  1LVN A;  4PA3 A;  4Q6G A;  5JQG B;  4X64 B;  2FBW C;  2K9J B;  2WZ7 A;  1R34 A;  2WO0 A;  1URQ A;  4KTR A;  1MZF A;  4LF6 O;  4X1K A;  3AEF C;  5BU5 A;  4FZ0 A;  3CCQ P;  1UPG A;  3QG5 A;  1PV3 A;  1Y67 A;  1NTM H;  1OVU A;  1LWU B;  2RN0 A;  4KTP A;  3OEE G;  4O2A B;  3NBJ A;  4LC1 A;  1KN7 A;  1TAE A;  2YDE A;  1RQV A;  4GOE A;  4UB8 Z;  1L0L E;  1OJO A;  1RQU A;  1J95 A;  3BVX A;  1VAR A;  4FIP C;  3N2K A;  3GWO A;  2GTA A;  4I5S A;  1MG1 A;  1Y6X A;  4MVZ A;  1GMJ A;  1NSM A;  2OW7 A;  1R5S A;  3AG2 B;  1MA1 A;  4OH8 B;  2C10 A;  3A0B E;  2HJD A;  1CPY A;  3JAL B;  2UUC B;  1PPJ E;  2JWD A;  2H43 A;  4IT5 A;  4MVO A;  4DR3 O;  3BRT B;  3VD7 A;  1RKY A;  3TGU G;  1OZH A;  3K5N A;  1PP9 H;  3CXC U;  3BCC G;  2Q7E A;  5APY A;  1MFZ A;  1N2D C;  3T0B A;  5CB4 B;  3A0H E;  3MAQ A;  3TNU B;  3DX3 A;  3J7H A;  5GON B;  1BCC H;  2WA3 A;  2ITD C;  3HD7 A;  5KLI B;  3CXH D;  3KQG A;  2DWE C;  5JVD A;  4BTW A;  3RFR A;  3ZX6 A;  1IJD B;  3KHU A;  4WVZ A;  2K1A A;  5AVQ B;  3RGU A;  4LR3 A;  4U3J B;  3I55 V;  1NAY A;  1J0M A;  2W8Z A;  4PD4 F;  1KB9 F;  2HYN A;  4JYA O;  1LXM A;  1DF5 A;  1LTA C;  1FFX A;  1PGP A;  1TUE B;  4OJZ A;  3ETD A;  3OB8 A;  1PU4 A;  4DYL A;  2IYP A;  1KQS O;  4X64 O;  3H1L G;  2DW3 A;  2Q7G A;  3GVM A;  2DYR C;  2RDC A;  3P32 A;  4I50 B;  3OS7 A;  2Y0C A;  2WSF H;  3J80 N;  5IYD O;  3M0D A;  3S1K A;  4KJM A;  1P49 A;  4DO2 A;  1H2L A;  3Q4H A;  3E80 A;  1ZRT D;  2GUV A;  3QFZ A;  1FZC B;  4G28 B;  3LDE A;  3T2M A;  1R1B A;  3LVT A;  1ARO P;  4LF5 B;  4U3F D;  4DT0 A;  1NWQ A;  2FUQ A;  1J5E B;  4MMI A;  1KUQ A;  5EIB D;  2UUC O;  1F7Y A;  3RL0 B;  1W5C E;  1WB7 A;  1ZXG A;  1W4N A;  4FFK A;  1Z5W A;  4BZH A;  3H1J G;  2KB1 A;  1JJ2 U;  1QLE C;  1KKC A;  1BGY G;  4LH6 A;  2IJJ A;  3MHH C;  1M90 W;  2ZIN A;  3RT3 C;  1VQ9 P;  1UI7 A;  1OHH G;  3R2P A;  1PNK A;  2A3Q A;  4KHP B;  2JEX A;  1UI8 A;  1NU1 J;  4CS2 A;  1YTF D;  2VRS A;  1KFM A;  2F93 B;  1KOR A;  1ZUQ A;  4DUX A;  1JFF A;  1FBM A;  1L4A C;  1SQX G;  1PV0 A;  1AVL A;  1V55 B;  1NVO A;  4X20 B;  4AHC A;  1H89 A;  2B88 A;  3N2G B;  2PAJ A;  3LW5 H;  1SS3 A;  4IIJ B;  4UFZ A;  3L72 H;  1K97 A;  2CQS A;  4TLF A;  3OMN B;  4J7Z A;  2YXR B;  1MMY A;  4UVC A;  2WSE H;  2WYI A;  3CCU P;  3CCR V;  4O4H B;  5DEC A;  1Z2G A;  1YQ2 A;  2V7Q H;  5KAI Z;  4KFD A;  5L3F A;  1RF1 B;  1MSW D;  3CZS A;  2E76 B;  4OX9 B;  3LSU A;  1IQY A;  1JZ6 A;  2Q9L A;  5CBH A;  3R65 A;  3BS6 A;  2CPS A;  2GBO A;  3BA8 A;  3MI6 A;  3AFL A;  2Z5U A;  2K9P A;  4OPA A;  3VMA A;  1NTZ H;  4L8J A;  5AVT B;  4EFB A;  2OCH A;  5L3B A;  4Q20 A;  1D5N A;  3H1H G;  1K3E A;  2P4K A;  4IHJ A;  1VQK P;  4LF5 O;  1NT2 B;  1M56 B;  2F7P A;  2WPQ A;  4TT3 G;  4ZOL A;  4CC6 A;  4YTP C;  3NTN A;  2YX9 A;  1AJN A;  1HTL C;  1GTO A;  5LXT A;  4R50 A;  3AE5 C;  3U1C A;  5JMF A;  4JF3 A;  3F7V C;  1CSB A;  4WBA A;  2YI9 A;  5CA0 A;  2P7T C;  4KHX A;  4L75 A;  3VQX A;  2QGN A;  5KHG A;  1JA8 A;  1TQT A;  3KN4 A;  5A2Q N;  1QHT A;  2XND H;  1LWU C;  3OTO B;  2BEQ D;  5KLV J;  3ITK A;  1M57 B;  2IBZ H;  3L73 D;  2WW0 A;  3V2N A;  1XNQ B;  4UUJ C;  2KS1 B;  2JP3 A;  3KG2 A;  2FXO A;  3S3X A;  1OCC B;  3AG2 C;  3CWB D;  4DR5 B;  1SLQ A;  1XTC C;  5AW0 B;  3BUB A;  4QMA A;  1K1Y A;  2E75 C;  1N7L A;  2EZP A;  3H1K D;  2Q6A A;  1R3I C;  3AK3 A;  4DXW A;  2P58 A;  2DWD C;  4R4L A;  1LTT C;  1UIX A;  4BRY A;  1SQQ D;  2L5G B;  2F95 B;  4C7N B;  2BAS A;  1CW5 A;  3UO3 A;  1EDJ A;  3MUY 1;  2JEE A;  3CX5 D;  3T08 A;  4OX9 O;  4LNU B;  4KXR A;  2UU9 B;  1AVK A;  3BGA A;  2DJV A;  2DYS B;  5BY1 A;  1IFJ A;  2YMK A;  1WMP A;  2ODM A;  2Z0A A;  5KLI C;  2QJK C;  2EAC A;  1X79 B;  1IU7 A;  3L35 A;  3T0U A;  2AEJ A;  3W7U A;  2E5Y A;  3MV0 1;  3AEC C;  2FXM A;  3LDD A;  2D3O W;  3CXH E;  4E2L A;  3I55 P;  2MJZ A;  1JRQ A;  3TK1 A;  2HKO A;  5H2F E;  1M90 Q;  2LO1 A;  3HTK B;  3O65 A;  1JX9 A;  3ZJZ A;  3X40 A;  2YEV B;  4PA9 A;  2XAJ A;  2IH1 C;  3JC2 2;  2JJ1 G;  4LP8 A;  1H0T B;  3S4A A;  4NEI A;  3EJS A;  2X6A A;  5JQG A;  4XFJ A;  5EBL C;  3E83 A;  2K9J A;  5KJ7 A;  3OAK A;  1YJ9 P;  1B06 A;  3EQ2 A;  2QWO B;  1RWH A;  1A02 F;  3SWY A;  1NTK D;  1PP9 D;  1JEK A;  3OTO O;  3PH0 A;  4JI0 B;  1HGV A;  1LWU A;  2WMM A;  2YMY A;  4OWF A;  5EYP B;  1L0L H;  4O2A A;  2UXB B;  2YIB D;  1A02 J;  3AEA C;  1H2K A;  1T2K C;  4JYC A;  1PGQ A;  2B1I A;  4JAA A;  2EAE A;  3D70 A;  1SQP H;  3BEH A;  3BUQ A;  5IJ9 B;  3A0B H;  2YIU B;  1PPJ H;  3RL0 C;  4FLZ A;  2KSD A;  2HFE C;  3VP8 A;  3JAL A;  4U3F E;  4DR7 O;  3BAA A;  1SRY A;  3O8Z A;  3PGB A;  2DOS A;  2C0W A;  1AI7 A;  3CRR A;  5JJJ B;  2ZJS E;  3RGB A;  3A0H H;  2ALW A;  3JAS A;  3L71 J;  1X1J A;  1KP2 A;  4MTX A;  2UU9 O;  5CB4 A;  3B5N D;  2GHY A;  1ZAU A;  1VQO V;  1FE6 A;  1EN4 A;  1L0N H;  3UO2 A;  2H8P D;  3KXD A;  3TNU A;  3DC6 A;  1F4A A;  4Z1M H;  1U57 A;  2F4V B;  3JCU Z;  4GX5 A;  5C93 A;  3RK2 D;  1S72 V;  1W6G A;  3K9S A;  3T1Y B;  3ABK B;  5FNV B;  4CH3 A;  4PI2 A;  1PGJ A;  1I7F A;  1PNM A;  5LHI A;  3CCS V;  2KLU A;  2CFL A;  1DF4 A;  1RE3 C;  2O57 A;  4AQY B;  5LA6 A;  3WG7 B;  4WY4 C;  1SQB J;  1EBO A;  1PIX A;  2CTP A;  4QJF B;  4U3J A;  5CA3 A;  3I3D A;  1NS4 A;  3GB7 C;  1Q82 W;  3CCR P;  1AVM A;  1L1F A;  2N1T A;  3CCV V;  1EDK A;  3HKD A;  2IH3 C;  2KQX A;  2ITA A;  2Q3E A;  2ZE6 A;  3VDB A;  5B1B C;  1RF1 C;  1TVK A;  4LF9 O;  1NU1 G;  4I2L C;  3DSQ A;  4CH4 A;  4O4L A;  4PV1 B;  1EXI A;  2UXD B;  2PYL A;  3EJT A;  4JI0 O;  3QWO C;  1WA8 B;  1R3L C;  4XE5 B;  2QM8 A;  4MTG A;  4X88 A;  2WSC H;  4LWS B;  2UXB O;  1ORQ C;  1BE3 E;  2RN9 A;  1K1W A;  1AP6 A;  1FZC A;  1K34 A;  1EC5 A;  1YTZ T;  4YJ2 B;  2E2T A;  2Q69 A;  5B66 Z;  1XMO B;  2C11 A;  3L70 G;  2EIM C;  5H6R A;  1M56 C;  3ACS A;  3BVW A;  2NLJ C;  4NPD A;  3JD4 A;  1AI6 A;  1XMQ B;  1GN3 A;  2QWN B;  5D5P A;  4UFC A;  4FM0 A;  3H1I J;  3NBB A;  1P84 D;  2WLJ A;  3ZMV A;  1BCC J;  2XZR A;  1LF6 A;  3L75 D;  3N9H A;  3HRN A;  3SXX A;  4GZR B;  1VF6 A;  1IUR A;  3KCY A;  2F4V O;  5AW3 B;  4DUV A;  3N7N A;  4JPR A;  4WFB V;  1M57 C;  1VF5 B;  3T1Y O;  1X9V A;  2ZYG A;  3EFG A;  3AED C;  2Q7H A;  1VQ4 V;  3IJ4 A;  2OQE C;  3RK3 D;  4AQY O;  1HVV A;  3FWN A;  3L73 E;  1OCC C;  2WA4 A;  2OTK E;  2ZE7 A;  2YI8 A;  1NTZ D;  1LF9 A;  4X8A A;  3M8A A;  2Q68 A;  2Q4P A;  4B3T B;  2P4V A;  1KQL A;  1AVO A;  5GTH Z;  1VP7 A;  1NSS A;  2VWJ A;  2WSF J;  1MNG A;  4ASV A;  3H1K E;  3I3B A;  3BLC A;  3E7K A;  1HWY A;  2RKL A;  1IX9 A;  1RF1 A;  2HG5 C;  5KLV G;  1WAZ A;  1SQQ E;  2UXD O;  1N7S B;  2C2A A;  3L74 H;  1HJ0 A;  1NJI W;  2I1J A;  4Y28 J;  1E79 H;  1SVF A;  3AFJ A;  1AP5 A;  2CGO A;  2YKQ A;  5GTI H;  3WUT A;  5CCG A;  3ABU A;  2QE7 H;  1F4N A;  3RYI B;  5KAF Z;  2QM7 A;  1W0K G;  5DED A;  1FAV A;  3JAR B;  4TV8 B;  2IBZ D;  5LYJ A;  1XMO O;  3B5N A;  1HNX B;  2RNB A;  5AVR B;  4BWN A;  4DV5 O;  3GMA A;  3ETG A;  3CYO A;  1WP7 A;  1R8E A;  1FOS F;  1HBW A;  3K0D A;  1K1X A;  2Y0D A;  5J2T B;  3BAB A;  5LL6 Y;  3D6Y A;  4FNV A;  3ABM B;  4C46 A;  3CC4 V;  1US6 A;  3OW2 O;  4JBZ A;  2OQQ A;  3SEP A;  3SR2 C;  1B04 A;  4EOT A;  4UCS A;  4XDJ A;  4FJC C;  3VQW A;  2PY5 A;  1X22 A;  3I56 V;  2H89 C;  3M0A A;  4H44 D;  1OIP A;  2E5T A;  3X2Q B;  3HUS A;  1Q82 Q;  1NTK E;  3D36 C;  3B4S A;  3E86 A;  3LW5 J;  4RO0 A;  5B3S B;  2KS1 A;  4QPJ A;  4H13 B;  3U59 A;  4GLX A;  2OQE A;  1BQZ A;  3G80 A;  3B8N A;  3E8G A;  2M3E A;  2YIU C;  4AQ0 A;  2GUZ B;  4QE7 A;  3K5T A;  1RJO A;  3IAP A;  3TDK A;  3G3Z A;  2I8D A;  1S5L X;  3PTZ A;  1SC5 B;  3WA2 X;  1Q90 D;  1K9M W;  1SZX A;  3VDC A;  4D6T D;  2Q0A A;  2AGA A;  2OWO A;  2CK3 H;  4W7Z A;  1S5J A;  1VDF A;  3ABK C;  3I5D A;  3CCS P;  4QNH B;  1N7Q A;  2PTM A;  2X6B A;  3CXH H;  2WW3 A;  2IYO A;  5H2F H;  1XHZ A;  3QO8 A;  1WRG A;  1RWA A;  1HNX O;  2B9Z A;  1PZQ A;  2FML A;  2YEV A;  3E8B A;  2P2U A;  1G1X B;  3CCV P;  4MSW C;  3F5W C;  1FDM A;  3Q2Y A;  1KV4 A;  2FYN C;  4AI8 A;  3L71 G;  1VQ5 P;  1H0T A;  5JJE B;  2WPD G;  1OWA A;  2ZR3 A;  1XUQ A;  5DN6 G;  4CBC A;  4FM1 A;  4X9Q A;  3O6Q B;  3OFN G;  4PV1 C;  2WVZ A;  3CC2 V;  1N7N A;  2FYU J;  5LGN A;  2JO1 A;  3K08 A;  1WNS A;  1RP3 B;  5EYP A;  1SFC B;  1SQB G;  3H32 B;  3K57 A;  3C1L A;  3OTF A;  2F7Q A;  4RWU A;  1TXK A;  3AEE C;  4GKG A;  1GM7 A;  4LLH A;  4IL6 X;  1FXK B;  3K5M A;  5IJ9 A;  1YBK A;  4U3F H;  3ASO B;  3BPZ A;  1SA0 B;  1JMM A;  1QGK B;  2E74 D;  3VMX A;  1NJI Q;  3VD3 A;  3ZRW B;  1NTM G;  5CMU A;  2CWT A;  1KIL A;  1VQ7 P;  2LW1 A;  2X7R B;  1URQ D;  1U7M A;  5JCO C;  2WAM A;  2YXH A;  3SYA A;  4YXW H;  3LSQ A;  1JY2 N;  2AEF A;  2GTS A;  1MV8 A;  4JQ0 D;  2AZ2 A;  5LBQ A;  5BZB A;  1NS2 A;  5B5E E;  4FLU A;  3A8T A;  5TJH A;  1JCC A;  1VQ4 P;  3A5T A;  3K5L A;  2QTO A;  4K35 A;  3G4S V;  4B3M B;  2LR2 A;  1SQX K;  2WSS H;  3AEB C;  1FJG B;  1BGY J;  1I5Y A;  1OJH A;  4JPZ B;  1OAC A;  5LP6 C;  4EEQ A;  4X66 B;  3ZHT A;  1YCI A;  2LFS A;  4MVS A;  2J59 M;  1IZ3 A;  3VN0 A;  1F9G A;  2CG1 A;  4DV3 B;  2W0F C;  3CE2 A;  3RL0 g;  1J1D B;  1AV4 A;  1EZV E;  3DYP A;  3RSY A;  4KFM A;  1GD2 E;  3AMO A;  1BCC G;  4WWI A;  4LCU C;  3LDC A;  2KZI A;  1QVG U;  3F7Y C;  2R72 A;  2POH A;  2ZT9 D;  4PD4 I;  4RJT A;  1N7S C;  2ZXX A;  3GHG C;  1L0L J;  1ZLL A;  3HD7 D;  3WB2 A;  1P7G A;  2XU6 A;  2IZ0 A;  4JV5 B;  1QLE B;  1WA8 A;  3OBA A;  3D51 A;  1BE3 H;  2YIA A;  2FFD A;  3QTC A;  5IE9 A;  1SES A;  1T8Z A;  5BU8 B;  4XDK A;  4JAS A;  1VQL V;  1I5X A;  3T1C A;  1SQP J;  4UVB A;  4RES B;  1KIL E;  1RM1 B;  3ZED A;  2P06 A;  4YJ2 A;  1HH0 A;  4N3Y B;  4JI3 B;  1K9M Q;  4CS3 A;  5BXZ A;  3DXR A;  1VQM P;  1YIJ V;  2CWU A;  1BSH A;  3TGU E;  3S9O A;  3T09 A;  5CHX A;  3BCC E;  2QR4 A;  2OIG A;  2H3O A;  1L0N J;  3ABM C;  1S2E A;  4I0X A;  2N9B A;  3CC4 P;  1JYX A;  1S4X A;  4JGS A;  1PL5 A;  5APX A;  1K4C C;  4ZI7 A;  1TQW A;  3X42 A;  1AVY A;  3K03 A;  2R70 A;  5A1A A;  1B6Q A;  1K5S A;  2IW5 A;  3I56 P;  2ADP A;  2XN2 A;  2JVD A;  3SYC A;  2HPC B;  1LR1 A;  2QJY B;  3W67 A;  1LT9 A;  2F18 A;  3I3E A;  5D5Q A;  1W2B U;  1FJG O;  5B3S C;  2RDY A;  3A2A A;  3FB6 C;  3L73 H;  1QL2 A;  1GN4 A;  4H13 C;  4X66 O;  2A45 H;  3UCS C;  1KYO E;  4DCK A;  4DV3 O;  1CB8 A;  3K3W A;  3S3W A;  3RYC B;  3K79 A;  3ABV C;  5AVV B;  2WLL A;  1SP4 A;  1JPX A;  4EB6 B;  2XUM A;  2EBO A;  2NPS A;  3OAA G;  1RF0 A;  3OD4 A;  1X0T A;  3H1L E;  2AHZ A;  5CJ4 A;  1AIL A;  3H1K H;  4DJG A;  4JI8 B;  2AHY A;  4BIZ A;  2Q67 A;  2HOD A;  1IQX A;  3SYP A;  2R3C A;  1SQV J;  1KQF B;  1SQQ H;  2CPB A;  1NKG A;  3T1H B;  3NRE A;  1JTH A;  4JYY A;  4O2B B;  3DDF A;  5EK0 A;  1WMK A;  1NBM G;  4JV5 O;  1MMM A;  2R5D A;  1CP9 A;  1G1J A;  3L72 G;  4D6T E;  3DYM A;  1EGU A;  3CPW U;  4HJG H;  4I4T B;  2CFG A;  3G6E V;  2E24 A;  1R6N A;  4PDL A;  3RYI A;  3CZJ A;  3DC5 A;  5AW5 B;  4JI3 O;  4L76 A;  3JAR A;  2XAH A;  2I1K A;  1OFC X;  1N8R W;  1JM0 A;  1YTF B;  3K5O A;  2OYH C;  4G2K A;  1QNM A;  2WLK A;  4H0L C;  1Q3E A;  2IU3 A;  3FGA D;  4X1Y B;  3TF5 A;  3U11 A;  4F6R B;  4IOI H;  4OGQ C;  1QL1 A;  3CC2 P;  1R3J C;  2NRG A;  4X89 A;  2KZJ A;  2E75 B;  3S4D A;  4ICG A;  3ZBH A;  4TUY A;  3CLQ A;  1SET A;  1AR1 B;  1NTK H;  3JD3 A;  5EBW C;  1JCD A;  3SFE C;  1SFC C;  2JKA A;  3ZRS A;  1NVP D;  4YJ3 B;  1MMX A;  3FKS G;  1IBK B;  2XT9 A;  5TIS E;  3KZI H;  3FAV B;  2W90 A;  1FXK C;  4WFF A;  2QJK B;  1N32 B;  3ASO C;  1NGM B;  3MHV A;  2BRP A;  3RVY A;  2ATK C;  2XND G;  4ZNC A;  3CCJ V;  1X59 A;  2W0X A;  1HWT C;  2ZL8 A;  3M06 A;  3L74 J;  3CCM P;  1HNW B;  3B8M A;  4IFD K;  2FYU G;  3T1H O;  1OXZ A;  1MKM A;  3LID A;  1PX3 A;  2E3C A;  5ITZ B;  4FZ1 A;  5IY5 B;  1Q5O A;  2W6I G;  4LGD E;  1OX3 A;  5EFW B;  4DOJ A;  1L4A D;  3G4S P;  3VOP A;  1HGZ A;  1HXK A;  4Y99 B;  5BVZ A;  2PP6 A;  2A9H A;  3KCX A;  3H1H E;  2WPR A;  5APT A;  1QVF O;  4FLX A;  1MAB G;  3SJA C;  1COW G;  4ZHQ B;  1J1D C;  3CME P;  1JZ5 A;  2ZDI C;  5K5G B;  1PL0 A;  4PDR A;  2ITC C;  1K04 A;  1WMO A;  3EVK A;  5KHJ A;  2W83 C;  4X1I A;  1NU1 K;  4ZKU A;  1KTM A;  2F1B A;  2HVK C;  2M5A B;  2Y73 A;  4EIJ A;  3O6Q A;  1FS0 G;  3DYO A;  4JTA B;  3A0R A;  2Y0E A;  4JI1 B;  3FYE B;  4JI5 B;  1H38 A;  4X65 B;  2RH0 A;  1TUB A;  1JZ7 A;  1DH3 A;  1MN0 A;  3FB7 C;  3HE4 A;  4DR2 B;  1KFN A;  3MUD C;  1DIP A;  2DE0 X;  1VQN V;  4UVA A;  3HPL C;  1IBK O;  3VMY A;  1KBH A;  1VIB A;  1YTZ I;  1J2J B;  1RM1 C;  1CI6 B;  2BRW A;  5FPR A;  1JY2 O;  1VQ6 V;  1YIJ P;  3ZRX A;  1H54 A;  1N32 O;  1NSX A;  1OVV A;  1SA0 A;  3NFQ A;  3T97 B;  3S4B A;  1GW4 A;  2XV5 A;  5KJ7 D;  4ASU G;  2VWK A;  1VMG A;  3EFF K;  5IYZ A;  3CXH F;  1HNW O;  1L0L G;  4WY4 B;  3T2O A;  4BZG A;  2FKX A;  1P84 H;  2HR3 A;  5BR8 B;  2CIS A;  1W2B O;  3L75 H;  2UWJ E;  3L70 J;  5IJ0 B;  1MSD A;  5B5E H;  1Q8I A;  1SQP G;  3A0B Z;  2QTS A;  2QJY C;  1PPJ G;  3IR9 A;  3FX7 A;  2H94 A;  1R3K C;  5B1B B;  2LXB A;  3TY1 A;  4BIO A;  4CPG A;  3VDA A;  2WLI A;  1RWF A;  1Q81 W;  3GLM A;  1BE3 D;  1ZLZ A;  1IO4 A;  3A0H Z;  1FJP A;  1EZV H;  1VQ8 V;  3B71 A;  2OYI C;  1L0N G;  3CX5 I;  2LGQ A;  4PDM A;  2JS3 A;  4Z1M G;  3W7S A;  2UXC B;  3KPE A;  2BT3 A;  1S77 D;  2WZS A;  1QQC A;  2AXT E;  2F1M A;  1PL4 A;  3AG1 C;  1J5E O;  1JZ2 A;  2W6B A;  4PJ0 E;  2EIM B;  3ETE A;  4CC5 A;  1SQG A;  2A06 D;  3CPW O;  1D6Y A;  2WOH A;  5KLV K;  1YF2 A;  3CCL P;  2HTB A;  4X65 O;  1K05 A;  5EIB C;  5AVU B;  2UUB B;  5L8R J;  2XKM A;  3ZIA G;  3A0O A;  4DR2 O;  3JAW B;  4O4I B;  4MVR A;  4G27 B;  4HYT B;  3ZMU A;  1Y76 B;  4KHP O;  3SPG A;  3U1A A;  1Y47 A;  2JDI H;  4KFF A;  4RQF A;  1SQF A;  3HKE B;  2CH7 A;  1O7D D;  2WOF A;  3DGE A;  1KB9 E;  2XN0 A;  3K25 A;  3VD4 A;  1IK9 A;  1GTW A;  3TGU H;  2N1T D;  3HKB A;  1YYC A;  5GW7 A;  2E43 A;  1L4A A;  1JOV A;  1N33 B;  4U7O A;  5CBN A;  1TQU A;  1SQV G;  2Q9I A;  2UXN A;  1ZWI C;  1WP8 A;  1LTJ C;  2YUA A;  1SKV A;  2JKV A;  4AYC A;  4TOI A;  3BVO A;  3AE1 C;  3T0A A;  2MK3 A;  1KU9 A;  2OT5 A;  2Z5I A;  2QIW A;  3JCU E;  4O4J B;  4FLV A;  3FXE A;  1GN6 A;  5FL7 G;  1YHQ V;  3UT5 B;  5J9P C;  1MZ9 A;  2HPC A;  1GAX A;  5EC2 C;  4ABM A;  1GL2 B;  2R9I A;  4RUF A;  2ZXW B;  2BCC D;  2P6J A;  3IAQ A;  1AI5 A;  1KYO H;  1K33 A;  1QX1 A;  2Y4U A;  3DX1 A;  1KP3 A;  3K9A A;  2K1E A;  2C9L Y;  5DJT B;  3RYC A;  4FLW A;  1JY3 N;  2IJH A;  1K92 A;  3H1L H;  4EB6 A;  1Z5V A;  2YC0 A;  2UXC O;  4RAI A;  3II6 A;  3FB8 C;  4FNP A;  2EJ7 A;  3E22 A;  1NU1 E;  4UB6 E;  5AVY B;  2KLV A;  2CQT A;  4HKZ H;  4DUZ B;  3BUD A;  1TGO A;  1RSO B;  5KHK A;  2KI7 B;  2XAF A;  3F5T A;  5CA1 B;  2F7O A;  1E5W A;  4O2B A;  5IY5 C;  4D6T H;  4UCV A;  1OMI A;  1G4Y B;  1M1J C;  1JR9 A;  4UCT A;  4I6M C;  1SII A;  3P3N A;  3MUZ 1;  4Y99 C;  3V2P A;  2JJ2 G;  3C90 A;  3ZN1 A;  2YFN A;  4I4T A;  1WT6 A;  2WW2 A;  4A7P A;  1UJW B;  2ZVO B;  1QLN A;  5B66 E;  3F89 A;  1ZME C;  5JH7 B;  3ZS8 C;  3GG2 A;  1SNZ A;  2QA4 V;  4DRX B;  1NKN A;  4PEL A;  3VYI A;  4I7Z C;  1I8Q A;  2BTQ B;  1XNQ O;  3L74 G;  4NTY A;  2R9A A;  1N33 O;  1E79 G;  3MIW A;  2GM4 A;  1N34 B;  3WIQ A;  1KC8 W;  5GTI Z;  4I55 B;  1ZP0 C;  1FPO A;  3BRC A;  2EIK C;  4FFB B;  4DR5 O;  3RK3 B;  2E76 D;  3NJV A;  4F6R A;  1WJZ A;  3P8M C;  2KNC B;  1Q81 Q;  1GW3 A;  3LUT B;  1PGO A;  3JAM N;  3L73 J;  3E2E A;  5CCG D;  3P3P A;  1VQN P;  3E1R A;  3V2R A;  1SQB K;  5TIS H;  3Q5S A;  3ASN B;  2Q5Z A;  3H1I D;  1NS0 A;  1NSV A;  4FNT A;  1AV1 A;  3CWB J;  4ZIB A;  3FAV A;  3G67 A;  2CE4 A;  5GON A;  5APU A;  1GM8 A;  1P84 I;  1HN1 A;  3CX5 F;  2D2C D;  2ZAE B;  2VS0 A;  1NTM K;  1SQQ J;  2L35 A;  2AXC A;  4J9Z B;  4DW0 A;  3FB5 C;  5BMV B;  3IFM A;  1QR8 A;  4N78 D;  1DD3 A;  5KLV E;  4PHZ A;  5KKZ B;  4KFE A;  2B9B A;  1RWC A;  5ITZ A;  5L3E A;  1AR4 A;  2FYN B;  1LP1 B;  2JR8 A;  2YXQ B;  4MTO A;  1NTM J;  3H1H H;  3ZDM A;  2F23 A;  1X1I A;  5E79 E;  5JWP A;  4FNR A;  4I50 A;  2B87 B;  5E1A C;  1YJN V;  2IPP A;  2QSI A;  3PHL A;  2WTY A;  4TT3 H;  1VQ8 P;  3L36 A;  3VQV A;  1AFO A;  1H2S B;  3VMZ A;  3BVT A;  3HIG A;  3QG0 A;  2CK3 G;  1S5L E;  2XHN A;  4H44 B;  1N34 O;  4MVQ A;  2ZNI A;  4EYY Q;  1EDI A;  4QPK A;  3SPH A;  1H2M A;  1FDI A;  2JS5 A;  4U7N A;  4LH7 A;  4JI2 B;  2QM4 A;  3AK1 A;  2XSG A;  3AK2 A;  1PP9 J;  5H2F Z;  3JAT B;  1ZL8 B;  5AVX B;  2A06 E;  2G38 A;  2IBZ I;  2GUS A;  1HR0 B;  3D50 A;  1IC2 A;  4HZ3 A;  1R6T A;  2M7W A;  2WYH A;  2PF4 E;  4DV6 B;  2ZFC A;  3SWK A;  4BTX A;  2IFM A;  1KSI A;  1CI6 A;  1LTB C;  2OYO A;  4NTX A;  4QE9 A;  3B8E B;  1J0N A;  1CZQ A;  3ZMZ A;  2H8P C;  3OR7 C;  3E1F 1;  1V9P A;  4LF7 B;  3RK2 C;  1M9N A;  4EDF A;  4UV9 A;  3U0Z A;  1JMB A;  3T97 A;  4J41 A;  1I0H A;  1RE3 A;  1LTS C;  4X20 A;  5LP6 B;  1XI1 A;  1N73 B;  1EZV D;  5KUM A;  1PD3 A;  4WY4 A; 
#chains in the Genus database with same CATH homology
 2HR3 A;  3EJU A;  3DX3 A;  2M5A A;  3BUP A;  2B89 A;  2F7P A;  2UWJ E;  1TQS A;  2OW6 A;  1JM0 A;  3BLB A;  4K35 A;  2SPZ A;  2LR2 A;  2LXB A;  2QRX A;  1Q2N A;  5C39 A;  4CPG A;  3RGU A;  4JBZ A;  4IOI H;  3EJR A;  1TQT A;  3BVV A;  5DJU B;  1QWU A;  1TQV A;  2KZJ A;  1S3J A;  3DX4 A;  1EDK A;  1HTY A;  4GOD A;  4WWI A;  2KS1 B;  3D4Y A;  4ASW A;  2KZI A;  2F7R A;  3S1K A;  4KJM A;  2K3R A;  3QWO C;  3BUB A;  3EJT A;  3BVU A;  3MHV A;  3EJQ A;  3D51 A;  2P58 A;  2ZAE B;  4ZNC A;  4NPF X;  1EDL A;  3BUI A;  4MN4 C;  2I8D A;  1EC5 A;  1EDJ A;  1Y47 A;  3D52 A;  3LVT A;  1OVR A;  3EJP A;  1O7D D;  3BVW A;  1ZXG A;  4NPD A;  2FYV A;  5EFW B;  1LP1 B;  5CBN A;  4K3A A;  1HXK A;  1TQU A;  2LXC B;  3ZDM A;  1PS3 A;  2QVA A;  1TQW A;  2B87 B;  2B87 A;  2KIK A;  4ZMD A;  3FXE A;  5CBO A;  1HWW A;  3BVT A;  5K5G B;  1H0T B;  1U7J A;  3D4Z A;  1SS1 A;  4BXL A;  1MFT A;  2R44 A;  3FXD A;  1H0T A;  2F18 A;  1R34 A;  3EJS A;  1NVO A;  3DDG A;  4EYY Q;  1EDI A;  3CV5 A;  3CZN A;  2B88 A;  2M0B A;  2OTK E;  2F1B A;  1QX1 A;  2M5A B;  3DX1 A;  1DEE G;  3PH0 A;  1OVU A;  1LT1 A;  2KUB A;  2F1A A;  1BDC A;  5DJT B;  3DX2 A;  2WMM A;  1BDD A;  1QWN A;  4NPE A;  2WYI A;  1FC2 C;  1LP1 A;  3DX0 A;  1X0T A;  4GOE A;  4GOF A;  3D50 A;  3BVX A;  4ASV A;  1ZW0 A;  2F7Q A;  2WYH A;  4HKZ H;  2RKL A;  3BUD A;  3CZS A;  2OW7 A;  2KI7 B;  2F7O A;  3BUQ A;  3DDF A;  3MZW B;  2JWD A;  1OVV A;  2Q1K A;  5KBP A;  1R33 A;  1JMB A;  1U7M A;  4HJG H;  4HB1 A;  2ALW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...