4K3AA

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
720
structure length
720
Chain Sequence
GDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
total genus 249
structure length 720
sequence length 720
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k3aA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k3aA04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k3aA02
1EDLA 4BXLA 5DJTB 2B87A 3EJSA 1Y47A 1U7JA 5K5GB 3LVTA 4HB1A 3DX2A 4ASWA 2LXCB 2B89A 1TQSA 3FXEA 1TQVA 3BUPA 1TQWA 1LT1A 1HXKA 3D4YA 5CBOA 2M0BA 5CBNA 1H0TA 1DEEG 2LXBA 4EYYQ 3CZNA 3DX3A 4IOIH 2F7PA 2KI7B 2OW6A 3D4ZA 1EC5A 1QWUA 5EFWB 1QX1A 4HKZH 3DX1A 4GODA 1LP1A 2UWJE 1TQUA 3D52A 2F7OA 3D50A 2M5AB 1HTYA 4JBZA 1ZXGA 2QVAA 1U7MA 3BUQA 2F1AA 2HR3A 4ZNCA 2ZAEB 1Q2NA 3BVWA 1MFTA 1SS1A 1OVRA 1OVUA 1BDDA 2F1BA 1X0TA 1FC2C 3BVUA 4NPFX 1JM0A 4ASVA 3BVVA 5KBPA 1NVOA 1EDIA 2WMMA 1EDJA 2B87B 1QWNA 2F18A 1TQTA 3DDFA 2KZJA 1BDCA 1R34A 4K3AA 2M5AA 4NPEA 3RGUA 2I8DA 3FXDA 5DJUB 2LR2A 1LP1B 4CPGA 4ZMDA 2B88A 2Q1KA 4WWIA 2KIKA 3BVTA 3EJQA 2JWDA 3CZSA 1R33A 2RKLA 4HJGH 3BLBA 2FYVA 1EDKA 3EJPA 3BUDA 1JMBA 1OVVA 1O7DD 3BVXA 2KZIA 3MZWB 4K35A 2K3RA 2WYHA 3DX4A 2WYIA 2OW7A 4NPDA 2OTKE 4GOFA 3QWOC 3EJTA 4GOEA 1ZW0A 4KJMA 5C39A 3BUIA 3S1KA 2P58A 3EJRA 2ALWA 4MN4C 2KS1B 3DDGA 2SPZA 2F7QA 3D51A 3DX0A 1PS3A 3ZDMA 3EJUA 1S3JA 2F7RA 1HWWA 3CV5A 2KUBA 3PH0A 2R44A 1H0TB 3MHVA 2QRXA 3BUBA
chains in the Genus database with same CATH superfamily
4RWUA 2D3OW 2XHBA 4P9OA 3G6EP 2Q67A 3GHGC 2O57A 4I55B 1H2SB 1ZMEC 2W6IG 3CX5D 3CCSP 2M8RA 4N78D 2JP3A 4J11A 4ASWA 1IVXA 5JQGB 4DV3O 4IFDK 2PUSA 1MNGA 4DUVA 2HTBA 4O4LB 4JI0O 3D4YA 3VSNA 2JKEA 5CBNA 1FAVA 1M90W 4WVZA 4NTWA 3HR0A 4FNPA 1L8DA 2Q3EA 5DM6V 3ZRWA 2WT7A 2OWOA 2QA4P 2E76B 3B8NA 1LTIC 2WW1A 4H0LC 4JTDB 2YFOA 1VQKV 3PP5A 5IYBO 4LF4B 1SVFA 2BASA 3X42A 3RBZA 2YX9A 2CTRA 4PJ0H 4JYAO 2IJJA 1LWUC 1EN5A 3BPZA 4H0LD 2E74C 2FYNC 2E75B 5LMNO 2ZIOA 3HE5A 5KUKA 4X65B 4ZNCA 3HIGA 2C2AA 2CH7B 1GL2B 4GX0A 3H1HE 3AEBC 1SETA 3VDCA 4X1YB 3K04A 5LP6C 2RN0A 2CFDA 4QPJA 2N1TD 3M0DA 5KKZB 3CCUP 2QJYB 2HEPA 1M8OB 4MTOA 3FWLA 4DW1A 4GZRB 5KAFZ 5H2FE 3WFVA 1R1BA 2YXYA 2Q0OC 4U3JA 2KZJA 4ZKUA 3AEDC 1W6CA 1HJ0A 2KSDA 1HTLC 1FS0E 4BZFA 3L72D 2I8DA 3CXHE 3NBJA 2ZKOA 3CC7P 1K1YA 4CS4A 1IFDA 4ZMDA 4N6JA 4FNQA 1KB9E 2F93B 2WPVB 2E74B 4PDVA 4TOIA 3OR7C 5LMNB 3GHGB 4OWFA 4AQ0A 2LKMA 2KNCA 1NTKK 4YJ2A 3KZIH 1TUBA 1XILA 5B1OA 4WY4D 1RE4A 4F4LA 5FL7G 1J1DB 2XNDG 4KTRA 1HJBA 2BE3A 1URQB 2X03A 1I5XA 3BUDA 1JOYA 2YKQA 1VF5D 1DH3A 5BMVB 3AE2C 2YIUB 3OAKA 4X1IA 3KCYA 4C7NB 3U10A 3SFDC 1HNWO 3L71J 4PA4A 4PD4E 4IL6E 1H8HG 1E1QG 3H9VA 1IBMB 4WFHA 4UCTA 3CC4P 4D6TG 3QWOC 1OCRC 4KJMA 1W4NA 5B1AC 2YMYA 2RCVA 3SPCA 3S1KA 1JCDA 5EBLC 1IK9A 1QL1A 3HD7D 2KS1B 2E75C 2ZE5A 5KA5A 2SPZA 2CPSA 4DV4O 2IDBA 3ZDMA 3OGIB 1IX9A 4F6RA 2WSCJ 2F7RA 2C9LY 4IL6Z 2UXDO 4DR7B 4X20B 3CL3D 1M9NA 2P06A 3G6EV 1MN0A 1MMXA 4J9ZB 1YGAA 4RNLA 1WA8A 3C3TA 3H1KG 5C8YA 1TVKA 2XTAA 4EEQA 2UUAB 4BXLA 3UKMA 2YKPA 3VP9A 4WY4C 1SQBD 3D36C 1AR1B 1PNLA 3V6IA 3VMYA 1I08A 3H1ID 5AVUB 5EBMC 4HB1A 3DX2A 3DCDA 2HP8A 1BCCG 4J7JA 1NJIQ 3FXEA 4FNSA 1SS3A 2OYIB 2JEEA 5B3SB 3BGAA 5CMUA 3ZMUA 3ZBHA 2KSJA 1LVNA 4UVAA 5DN6G 5KJ7C 4DV5O 1I7FA 4DCKA 3A0HZ 1VMGA 2AW9A 3JATA 5GTHZ 4CBCA 4BWAA 1M1JB 4NXMB 3UM7A 4OK2A 4J80A 2V4DA 3TGUH 1IVVA 5H2FZ 3CWBG 2EABA 2GSMB 1KTMA 4YTPC 4KHPO 2HJDA 2N04A 1RSOA 4JF3A 3FAVB 2D2CC 1HTYA 1IQXA 3K5TA 4QE7A 2QWQB 3UQ8A 3KZIE 1IBLO 4W4KA 4LGDE 3X2QB 1OCRB 1JMKC 3RK3B 4E4EA 2ZT9C 3IJ4A 4GYCB 5HFMA 2Q1FA 3PLNA 3APQA 2Y74A 1KSIA 1FFXB 1NH2D 4DR4O 1L4AA 3HKDA 4QE9A 3RW0A 1NVPD 2WSSH 1X4TA 3RK2C 1TQTA 5IYDO 2QJPB 2DN9A 4DR1O 1R34A 1WNSA 3ZEDA 1HGVA 1MV8A 1J5EB 3CYOA 4EB6B 3B8MA 4U7OA 1GH6A 1X9VA 1HMUA 2B88A 4BIZA 1LTBC 1W2EA 1SIHA 5GTIE 1C82A 2BEQD 1VQKP 2VRSA 1MZFA 4DYLA 1USDA 5GONB 3X2QC 1X22A 1R33A 1XQ8A 3LSUA 3HTKA 1NSUA 3H01A 2OOVC 3RYFA 3WB0A 3CCLV 1IBKB 3H1IH 3ZMSA 1VQMP 1Z45A 1YDXA 3GMAA 1AILA 2X6AA 5APUA 1N73A 1IXMA 1FFTB 4DOJA 1JFFB 3E1RA 1T3JA 3LSSA 5IYCO 5AW6B 3SJQC 4DK0A 2ITCC 3BCCJ 2JIZG 1JY3P 3V4QA 4CH3A 5KLVG 4GOFA 3LDCA 2ZR3A 1Q3EA 5BZBA 2DQ0A 1SFCD 1GL2A 3IAOA 2QM4A 4DV2O 3JCZA 2PYJA 3PTZA 2GM4A 2XKMA 1YZBA 5FLXN 2KP8A 3RL0D 4TV8A 5BU8B 1JB0J 1EZVD 2YXRB 2IBZI 3GWKC 5KLIB 2BCCJ 2W6JH 3MIWA 1AR4A 2ZXXA 2YXQB 2HVJC 2W6BA 3ABKC 3T97A 2BSKA 5IJ9B 3OE7G 1LTJC 5L3EA 1V55C 1IVWA 1DK1A 2JEXA 1WLEA 2F4VO 4TTGA 4DV6B 3BRVB 1GTWA 4MW8A 3K57A 3T4DA 4RQEA 4N3YB 1K73Q 1HF9A 4UB6Z 1MKMA 3AG7A 1NU1E 1S4XA 2YXHA 1NTKD 4YIPA 2OQEA 1URQD 2JDIH 3V2QA 2WOHA 2KQXA 2EIMC 1KYOI 3TGUE 3SJCC 3F89A 4X62B 3AEAC 1W2BU 2JDIG 1M4UA 4JI5B 1AJPA 3IC9A 4TUYA 1BCCH 4OPHA 3ZHUA 4WFAV 4FLYA 1W7CA 2CTQA 1QVFU 3NREA 3RYHB 3ETQA 2I1JA 1DF4A 2WWWA 2HHHO 3C1LA 5CMZA 3AFJA 1JVMA 1W5ZA 1L7JA 2CQTA 3I3DA 1WB8A 1IJDB 1J95A 1GD2E 4FZ1A 1HBWA 1WAZA 1R3JC 2FYZA 1HNWB 1YEWA 3H1KH 4FLUA 2FKXA 1XEQA 2N1TB 4M3LA 3SX1A 2NLJC 4WFBV 3V4WA 1N73B 1E79H 3WFAA 1KQSU 1JY3O 3LNMB 1Y74A 5CCGC 2XT9A 2P6JA 1JO5A 4FPPA 2FFDC 1FXKA 2D2CB 1NSRA 5KAIZ 1KB9H 2WW0A 3NTNA 1VQOV 4FLVA 4FLWA 2UU9B 1NBMG 5LA6B 1IBLB 2BOCC 1ZSPA 3CXHD 4JI4O 4ZBMA 2J5UA 4GKGA 4LNUB 3JASA 4YPCA 2WVXB 1LUWA 3R65A 3SJBC 1VQ4V 2OTLV 4AYCA 3AMOB 2EJRA 5KLVH 3CCMV 2WLLB 4NKGB 3TNUA 2DQ3A 1Q43A 1PPJE 4KL1A 4NTXA 1S72V 3WG7C 3J7HA 3O8ZA 4U7JA 3QVNA 1O7DD 2LO1A 1VQMV 1DX7A 1AP5A 2JKPA 5BR8O 2F1MA 3CCQV 3JAKB 4TT3H 4EOTA 1SQPG 3ETDA 1IBKO 5DECA 1KILE 5M1BA 2CUGA 1OHHG 2A06G 1VPCA 4XBFA 2ADQB 5KUMA 5L3BA 5KAIE 3S4RA 1BGYE 1JY3N 2OIEA 5DEDA 3HD7B 5EYPB 3WU2Z 2ALWA 3SWKA 2ZT9D 2WLHA 4IGGA 3DTUB 3T2QA 3VDAA 3RYCA 1BSNA 3M99B 2E76C 5FPRA 3ICXA 5EZYB 5CJ0A 4UV8A 1T6AA 2R44A 4O2BA 5APQA 2IJHA 1YF2A 3PJSK 1VQNV 3WIRA 4TLFA 1YBKA 1VF7A 1K1WA 1RQUA 1JZ3A 3D36A 3S4BA 4CZZA 1TU3F 2ZL8A 4KHXA 2Q8VA 3CMEP 5GTIH 1K97A 1U97A 2JGDB 3H1HG 1HH0A 3P8MC 3K5NA 3T0UA 2OGUA 3BY6A 5J2TB 1H38A 1NH2B 2Y0PA 1CI6B 2QGNA 1EQ7A 1SQBH 4R7CA 1QWUA 1QX1A 1TVKB 3RK3D 1N7OA 1F51A 1GM8A 3QDEA 1S1CX 5KLIC 5D5PA 3ASNC 3GF7A 3V2RA 3BRCA 4JI3B 1NR1A 2AXTH 1M1JC 3ITKA 1BSHA 5LXTB 1JYXA 2KG7B 2DE0X 3E1F1 5CHXA 2IBZG 1QAKA 3G9RA 1GW3A 1YVWA 3CB2A 5D5QA 3CZJA 3QFYA 5APYA 3FX7A 4P2ZA 1IURA 1OVUA 2IZ1A 2O1JA 1PD3A 4PDMA 3E2EA 3L70H 2IPPA 2N1TC 1JOVA 4GX2A 3CWBE 1EFRG 3P30A 3JAWB 1YSCA 1L4AC 1N7QA 1SA0A 4ASVA 1MOFA 2WLNA 4OPAA 2XV5A 3H1LD 3L71H 1CSBA 4YJ3A 1AVMA 3X3XA 3B2EE 1PNMA 2WLKA 3HPLC 4B3RO 1IFNA 2M5AA 4LC1A 2AZ2A 4PD4I 5L8RJ 2ITDC 4G27B 2ZNIA 3FFQA 1SIIA 4DR5O 2Q68A 1W2ZA 1PU4A 3CCJV 1RE3C 1P84E 4MVZA 4JYAB 4WBNB 1U57A 2JWDA 2JEUA 3CZSA 4LF7B 1KC8W 1N7SB 2CAZC 3USSA 3BCCG 2FYVA 1TGOA 1IZ3A 4R8CA 3EWKA 1N73C 4KTPA 3L72H 2WVZA 4IHJA 2UUBB 4WY4B 3I56P 2RN9A 4JAVA 4TQFA 1W6GA 1ZRTD 2Y69B 4GKJB 2W90A 2WYHA 3SJAC 2E24A 2Z5UA 4ZOLB 2K37A 1EM1A 1EZVH 1Q6UA 1KU9A 1K8AW 1BQ0A 4LFAB 2VQEB 1COWG 1O9HA 3OTOO 1M1KW 3G67A 4DUYB 2E5TA 1XDCA 1VP7A 4YXWG 1JQ0A 1GL2C 3MGNA 1QR8A 2XSGA 4MN4C 2E2UA 1NSXA 4NXNB 3CCEV 2F7QA 2JGUA 3ZMVA 3H1IE 1Q81W 2KXPB 1WMPA 3OEHG 4DV2B 5A2QN 3T97B 3BFRA 2KUBA 3CPWO 3OT7A 4X64B 3PH0A 1NTMJ 1H0TB 1LXMA 5LHGA 1JX9A 3W7UA 5AVWB 1SQVH 4FFBA 4UB8H 1EXJA 4CS3A 2K9JA 3NFQA 2JJ2G 4I1LA 2GA1A 3Q4HA 1LTJA 2PAJA 5JQGA 1Y66A 1NS8A 2EX3A 1ZUQA 1Z5VA 4YY3O 1KP3A 1V55B 3KKYA 1TQVA 3L75H 2D1WA 2QR4A 5GTHE 3QO5A 4WFFA 4P30A 3A0BZ 3DGEA 1QU7A 2BTQA 2Y4TA 2A0LA 2J58A 1YCIA 2Q6AA 1SQVG 1YQ3C 2Z3YA 2QSIA 4EYYQ 2OQEC 3CZNA 1J0MA 3GWOA 4GCZA 4LF8O 2VWJA 3B71A 3OUSA 4CC5A 5KX5B 4Y99B 2WLMA 3SYAA 5CA0B 4LF6B 3NBBA 2PY5A 2WLJA 1NTKJ 1BT8A 3HKBA 4DR2O 1M57B 2YUAA 3RWRD 3Q3DA 1NS2A 5KTBA 4JI0B 3BLCA 4ZKPA 2OYIA 1BGYH 4JF7A 4IYHA 5KLVK 3OTFA 4LWSA 3F5WC 1IFIA 4DUZO 2QE7H 3RK3E 1NVPB 2WQYC 1L0NE 1QVGO 3E22B 3E89A 4TSFG 3SYOA 1QEXA 2HLOA 3HE4A 1BE3E 1HP8A 3G80A 3B77A 2KOGA 5BXZA 5KAFE 2XASA 5KBPA 5APWA 4RKUJ 3SSUA 1QWNA 3W68A 2G3AA 4UCSA 5CCGA 2FFDA 1L0LH 3K06A 1FXKC 2R9AA 1L1FA 3WUUA 1NKDA 2LR2A 2KNCB 1QNMA 2HFEC 4JV5O 1KN7A 2X6CA 2QKCA 1GN3A 2WLIB 1LT9A 4DR5B 1FD9A 3HKCB 5KLVD 2E42A 1HM2A 3IF4A 2P10A 3CLQA 2M3EA 2BRWA 1SQXD 3ZRSA 4OGQD 4LF6O 5L3FA 3A8TA 4ZIBA 3M7MX 1DD3A 2XN2A 1KB9D 2BRVX 3SEPA 4ZKIA 2ITAA 3K0DA 3ZHSA 2K3RA 1TXKA 1YTFB 2ILMA 3CC2V 5CJ4A 2KSEA 4YIOA 2L91A 2WPRA 1LXKA 4ICGA 2JS5A 3ABKB 1F4NA 2ATKC 4TV9A 1SQQK 2NPSB 3HUSB 2ZE6A 1HW7A 3WVFA 4GKKB 3SDLA 2RDYA 2QWRB 1NSSA 4UFCA 3THOA 5AW5B 3KPEA 1L0NH 5KHKA 2ZE7A 1SQPK 1VQLV 1CXZB 4NEIA 1ZR2A 2PI4A 2Z0AA 4IFFA 3TXSA 2KS1A 4I9QA 3ML0A 4AI8A 1CB8A 2VQEO 3MUZ1 2BOBC 1DTOA 2AXCA 2YIDA 4J5TA 4NXNO 4X66O 3RVZA 1ZN5A 1AQ5A 5ITZB 4PA7A 1YIJV 2Z5HA 1OJMA 1NTKH 4I50A 2BCCD 4DV3B 2R32A 2VQFO 1GN2A 1SQPE 2IFMA 1JEKA 2DWDC 3K59A 1MABG 3JASB 1KKDA 1GO3F 1V7WA 2WVXA 2OCCB 4ZHQA 1FJKA 5LBQA 1SQBE 5AVVB 1AI4A 1FYJA 1DEEG 3BHPA 1URQC 4DUXA 2WSFH 1BE3D 5EZYA 2LFRA 3TNUB 1J1DC 3ACTA 4FNUA 4JI2O 1FJGB 2KI7B 4LF8B 3W67A 2ZD9A 2H43A 2FFDB 2WSEH 1FZFA 1QLNA 4UCOA 3EFGA 2YDEA 1M1JA 2JRIA 2Q7HA 3B4SA 5BU5A 4BTXA 3CRRA 1GDTA 3W7XA 3M9HA 1ZXGA 3VOPA 4BW5A 2IH3C 1YJNV 1KQGB 1ULVA 3X40A 3BVWA 2M6YA 1K9MW 1NHLA 1L4AB 3STZC 1VARA 5J2UA 3CCQP 1XNRB 2F1BA 5KMGB 2H8PC 2N1TA 1IZNB 4LFBB 1CI6A 1XBLA 1AVLA 3SR2C 4DV7O 1AVYA 1X1IA 3BVUA 2WMMA 2WPDG 5E79E 1JR9A 2QWPB 4MTFA 4PELA 5LGNA 1WRGA 4O4IA 4DT0A 3CCMP 1K9MQ 2FYUE 1NTKG 1UIIA 1PP9H 1R5LA 3CJHA 2HG5C 1H88A 1WPBA 3J7AU 3BVTA 4MVUA 1RE3A 4EB6A 4QMAA 4OXSA 1G1IA 4YJ2B 3D3IA 4BZHA 2H89C 1AP6A 4Z2WA 2GUZB 3H1KE 4J7ZA 3JAWA 3P32A 4AILC 4JI8B 4GKJO 5B3SC 2OT5A 4X89A 3SYPA 1JMBA 1S2EA 4JI4B 2YMKA 4PV1C 5JMFA 1FZBA 3CRQA 1GW4A 1H89A 1D2DA 2OYHC 2HPCB 1YQ2A 3ABLB 3L4FA 1N8RW 5IWAO 4H33A 5JWPA 4NPDA 2OTKE 3CMAP 2KYVA 3DSQA 1L0LJ 3P3NA 2RNBA 3ZN1A 1NTMG 3LIDA 3LW5H 2LQTA 2Y4UA 1RKYA 1HGZA 3FYIB 2UXCB 3FB7C 3HD7C 1N7SA 3H1JH 2ZDIC 3JD1A 3BS6A 3ASOC 2E76D 1N32B 2EZPA 1VDFA 1Y8AA 2PGGA 2R5BA 3CMAV 1JRQA 3L74E 4DR6B 3TGUD 3RK2D 1L0LE 4X1KA 1PPJG 3E8FA 4MVQA 1VQ5V 1GTOA 3BCCE 3T09A 5LMUO 4W7ZA 3ZRVA 2A7WA 1RPOA 4EV5A 4H44B 1GK4A 1V54C 5AW8B 4TQDA 2W0QA 2X0LA 5CN0A 3H1JJ 1NSVA 2A79B 4XDJA 1H2NA 2AHZA 3HKDB 3QG5A 1WP7A 3MHSC 1ORQC 4N21A 3JD3A 4L75A 2JR8A 3RRSA 3E8BA 3B40A 4JI8O 1EC5A 1YXBA 2AXTZ 3D6ZA 4GDOA 4O4IB 1VQ6V 3IAQA 3A7OA 1NT2B 4EKWA 1TU5A 4DR3O 3AE6C 1SZTA 1NKZB 4B3MO 3AECC 2UXBB 1OW6A 3D52A 4JBZA 2OYIC 4JZ2A 4IFMA 2F1AA 1B6QA 1SRYA 4J42A 4RESB 3GVMA 2Q4PA 2P5OA 4OH8B 2HLDG 4TWKA 3ZS8C 2E2TA 1NI8A 2YFNA 2QA4V 1OCOB 1KILB 1Q86Q 2C11A 1BDDA 3AEEC 5KAFH 1T2KD 1JFFA 1LGHB 3CXCU 2EILB 1QL2A 1OX3A 5LGUA 2JK5C 2YI9A 3F5TA 5IY5B 3W7WA 2RMZA 3CCSV 3L75G 1PL4A 4HNAB 4LNUA 5H5NA 1NYHA 2PTMA 1PL5A 3KZIZ 1K04A 1PX4A 2MJZA 2Q5UA 5AW0B 3CRCA 1M57D 1S77D 3SPIA 2HHHB 3EJQA 1LT9C 4WBNA 1ZRTE 2N05A 3HKEA 3C90A 1AR5A 1ZL8A 4L73A 4XFJA 5KLVE 3WUTA 3NR7A 1SQFA 2FYUD 2EBOA 4F6RB 1PFIA 1FJGO 2YIBA 3A0HE 3GB7C 4X1KB 3D6YA 2CDYA 2FB5A 2P4KA 4YXWH 3L37A 2WO0A 2CGOA 4FJCC 1MMZA 5L3GA 2YICA 2ZE8A 4NVPA 1PP9J 3HRNA 1EGUA 2AZ0A 4B3SB 2KB1A 1SPUA 3EJTA 4BR6A 1FU1A 4K8ZA 1NU1K 2VRZA 1JNMA 1WP8A 1SC5B 1RQVA 2EJ7A 3AG2C 3H1KJ 2QEXP 3L73E 1JZ5A 1O9GA 3C9IA 2IM9A 3E22A 3K58A 1DF5A 1UFIA 3RYCB 2LW7A 3M0AA 4LH7A 1OWAA 4O4HA 5LMUB 1XNRO 2B87A 3VN0A 3ABMB 1VQ8V 4NXMO 3MP7B 1EKMA 4YY3B 5BVZA 3II6A 2LXCB 4XDKA 4PI2A 1M7LA 1AJYA 3QTCA 4PD4D 3BA8A 4B3TB 4HYTB 2DOSA 3L71G 1LT9B 1LTGC 3CX5H 1URQA 5AW1B 3B5NC 2F7PA 2FBWC 3L70G 3ZN0A 2P90A 2WA3A 5KX5A 4L8JA 1RW9A 2JWAA 1N32O 5EIBD 4Z1MG 3N9HA 4DV4B 1CW5A 5GW7A 3SPGA 3CCEP 2D73A 3H1JG 3BABA 1X8YA 2RDCA 4DUYO 3T08A 1H2KA 1RP3B 2ZT9B 1XREA 2FXPA 4Y28J 4D6TH 3H32A 2CG0A 3WB2A 1OXZA 2IYOA 4O4LA 3ZHQA 4XE5B 3H1JE 2EZOA 4KXRA 2V7QG 1QLEC 2AGAA 1SLQA 3CCRV 1A2VA 3S4DA 2YEVA 1PGPA 3L70E 1KYOE 1AV4A 3CPWU 2JKAA 4H13B 2BTQB 2WGQA 5AVYB 1WA8B 2WVYA 4FMTA 4JASA 3ZMTA 2WPQA 1Y74B 5CCGD 1BDCA 4B3MB 1G1XB 4NPEA 2YNYA 3SXXA 1PV3A 3MPHA 2C10A 4KHPB 1SQBG 2HODB 3OA7A 5FNVB 4JI1B 1QBZA 1TA8A 4D7SA 3W7SA 1Q5OA 1EZJA 2MKVA 5B1NA 2CH7A 3H1HH 1PP9G 4I5SA 3LIEA 2EIKC 3BVOA 3OD4A 4LLHA 1N33O 1P84I 1JPXA 1AVOA 2RH0A 2B1GA 5KJ7D 4RO2A 1NTZK 1IU7A 1PPJD 3NMDA 4RJTA 4CH4A 1AJNA 3AG1B 4DV5B 1L0LK 1S5LE 3GW6A 1KYOF 1Q82W 1KBHA 4H37A 1YYCA 1SQXK 2OYHA 1RPRA 1X59A 3N2GA 2X7RB 4H44D 4EI2A 3LUTB 4QNHB 1HUCA 1RF0A 1SQQE 4OK4A 3TSIA 3CJHB 2QJKB 1NS1A 1RSOB 2ZXWC 1MZ9A 2BEZF 4Q6GA 1YITP 1BHBA 4ZOLA 5C39A 3H1LJ 4JTAB 1SQPH 3IGAC 1KD1W 1US6A 5AVQB 3HD7A 5L3DA 2CWTA 1N7SC 1S5JA 2ZDIA 4LF9O 1BZKA 3T2MA 1WMKA 1RF1C 1OJNA 5H6QA 1YHQP 3L75J 3HKCA 4UCUA 3WA3A 3ZRXA 2ZJSE 3VP8A 1SQQD 4DR1B 1QLEB 2E2VA 2UXCO 1NQTA 3KQGA 1QQCA 4DR7O 3K9SA 4Y99C 2OQQA 1KP2A 2IJKA 4GX1A 5DJTB 4IYIA 1X1HA 3OM3B 1ZWIC 3K5OA 4Q20A 3SPHA 3K03A 1ZOYC 2EADA 1NTZD 5CA3A 2CFWA 3OTOB 2W6AA 3E80A 3Q4HB 1LTJB 2PNCA 3AE9C 1S9KE 5JVDB 1FJPA 1IBMO 3S9OA 2PP6A 2N74A 1HNZB 2IBZE 1SA0B 5IT9N 1NSZA 3AG4C 3W7TA 4R4LA 5GTHH 3U1AA 3U59A 1R6NA 2OYOA 2P67A 1YJ9P 4LCUC 3CCJP 5H2FH 2FXMA 2Q6QA 1N9EA 4F6EA 1XL6A 5EFWB 2E43A 4WCEV 2YS8A 3IAYA 2EIMB 3ASNB 2A9HA 4I7ZB 4ASUG 1KQSO 1JMMA 2A45G 1E79G 1ZLZA 2XN1A 1I5YA 4GT1A 1OIPA 5B1AB 3JCUH 1L0NG 4N78E 5B5EE 2M5AB 2ZXWB 2Q69A 3CCRP 1NU1G 4C7RA 4HAMA 1LTSC 3V2PA 4ZHQB 4PI0A 3O6QA 1LTTC 3MV11 1QALA 4NTYA 2WPSA 1K8AQ 4GKKO 3CC2P 3L73H 1L4AD 3ZHVA 1BQZA 1IFJA 2L5GB 3A5TA 2P2UA 4U3FH 1PNKA 2F18A 1DLBA 1EN4A 4IL6H 1LURA 4IHJB 2QDOA 1S72P 1JUNA 1AROP 5DJUB 2HKOA 2CIRA 1MFZA 1W5CE 3G4SV 5HFLA 3CWBJ 3SYCA 1VQ6P 2GTSA 4AQYO 1RHZB 1BCCE 2Q73A 4B86A 2Q7EA 5J2UB 5B5EH 1FBMA 4DO2A 1LTAC 3RT3C 3TYYA 2OTJP 5CBHA 2W8ZA 1FZGA 1WPXA 3AK1A 1NZ6A 3CXHF 1P84D 3CXHI 2H94A 2MW2B 2YC0A 2GUVA 3FWNA 3KXDA 1N4CA 3AG4B 1EDKA 3A2AA 4BZEA 2F23A 3P8CE 3VOUA 5IE9A 1LOHA 5CCHD 5LGTA 4BTWA 2QM8A 5KHIA 4JV5B 1BS3A 4I9WA 2W6JG 1K05A 1DIPA 2NPSA 3TCUA 2UXXA 2ADPA 1UJWB 1JTHA 2QJKC 4J41A 2QE7G 1VF6C 1IFMA 4RUEA 3G71P 1FE6A 4GOEA 3BUIA 4I0XA 1QGKB 4ZI7A 1BGYG 2BRPA 1SQQG 5JH7B 2L35A 4O9BA 3M9BA 4FLXA 1UIXA 1MZEA 2XU6A 3BCCD 3L36A 3EJUA 1N7LA 3TXQA 4LF9B 4MMIA 1BE3H 2K88A 4L74A 5KKZC 1SQQJ 2I1KA 3H1IG 1BCCJ 1ZX3A 3CX5F 1FDOA 5AW9B 4D6TJ 1M56B 2HVKC 1OCZC 3BATA 1KV4A 3FD9A 1H8EG 3MHHC 3AE7C 4B3TO 2EAEA 3VTPC 3A0OA 3D8CA 5LA6A 4DJGA 2CQSA 3G6BA 3KIIA 2QM7A 4JAAA 4P9PA 1H2GA 3N2KB 5AG2A 2F4VB 3ABMC 2B89A 2FYUK 1SZXA 3BRTB 1NTKE 3VMAA 3ALAA 1TQWA 1RWGA 1LT1A 5CBOA 4I50B 3IFXA 3RGBA 3I55V 1OV9A 1PL0A 2LJ2A 4AHCA 4IT5A 1FS0G 3B5NA 3WIQA 1RY3A 2HJFC 2FMLA 3STLC 3PHLA 1KB9F 1GRJA 1DP0A 4MVOA 5TISE 4I7ZC 1SQPD 1X79B 2W83C 2NPSD 1ZLLA 1K34A 1LWUB 4A5UB 3DXRB 2AEMA 4KFEA 1KD1Q 1VEWA 2QWOB 2NNUA 5CB4B 1Y76A 4B3SO 3BUQA 2RJZA 4JI1O 2GUSA 1EBOA 1EZVG 2NRGA 2B1IA 1JCCA 3AEFC 3HE4B 3OGCC 1FC2C 4O2AA 1SFCA 4LR3A 3AE1C 3JSLA 4J9YB 4JYCA 3ZMZA 1SQXH 3CWBH 3X3YA 1AI7A 2UUBO 4C7NA 3VQWA 3LNNA 2B5UA 3L71E 3BASA 2E5YA 3L73G 3AK3A 3DC5A 3RGUA 1HVVA 1HWTC 4FNRA 3J81N 1IDSA 1KUQA 3TK1A 3TY1A 2EIKB 3CX5I 4EV2A 4UFZA 1GN6A 4ZI7B 1QAFA 1FDMA 2DYSC 2O3JA 4UXNA 3S4AA 4HJGH 1SQXJ 1NU1H 5L3CA 2DYRC 2R9RB 1XNQO 4EIJA 2E5LB 4FLZA 1PX3A 1FKAO 4MT8A 3WG7B 3ASOB 2O1KA 1OVVA 3CMEV 2PFXA 2Y0EA 4DK1A 4O4JB 1Y67A 4IIJA 2OYQA 4FNVA 2ZQ0A 1FXHA 3JCUZ 1NR7A 4J10A 1B3QA 5IDJA 4RQFA 3L74D 5CBGA 3VD7A 2AXTE 4BRYB 1RF0C 3L73J 1R3IC 1QVFO 3VSMA 3CHXA 3ACSA 1JY2O 1D6ZA 3P8CD 3Q2YA 2E3CA 1GKFA 2F95B 3O6QB 2XAQA 4BTYA 4HYOA 4DV0O 1RF1A 2G38A 1SQXG 2FY8A 1M93A 2PYLA 2E74D 2LGWA 5AW2B 2C0XA 3ETGA 1F23A 3K0GA 4EFEA 2P7TC 1S5LZ 1W2BO 3VD5A 2XAHA 2YIUC 1XUQA 5K1XA 2E22A 1R3LC 5B5EZ 3I3EA 1F4MA 1U7JA 1PP9D 1P7BA 3ZHTA 2NN4A 3T4ZA 2HODA 2XNDH 3I5CA 5KAIH 4BWNA 1Q81Q 2R3CA 5KMGA 4PA9A 1XTGB 1OACA 1HXKA 2BT3A 1VQ4P 4DUWA 2ZM6O 1R73A 3E35A 1P84F 2WW3A 5TISH 1YTZT 2QKSA 3D71A 4MMHA 1SQVJ 1JJOA 1V7XA 5EIBC 1S76D 3JARB 3UT5A 4KFDA 1B06A 3HUSA 1W0JG 4GODA 1WMOA 3ABVC 1VF5C 4W7YA 1TQUA 1XL4A 5C93A 1T5EA 3FB5C 3IFMA 1SO0A 4WFGA 5B1BC 2MK3A 1XMOO 5JVDA 4B7KA 2OCCC 4L87A 1H2LA 1PM9A 5JH7A 5KHJA 2KLUA 2PGDA 3H1IJ 3BVHA 3CC4V 1F9GA 2A06H 2V7QJ 4FIPC 1BMFG 4DW0A 3ZRWB 1KQFB 3PN1A 4I4TA 2CTWA 1G2CB 1KILA 1JM0A 4NPFX 3MDSA 2HPCA 1HN1A 1KZUB 5LP6B 3TF5A 1Q8IA 1YTFD 1SQVE 4UB8E 2QJPC 4B08A 2UXBO 5H6RA 4JI6B 3X41A 5E79Z 2H3OA 2PZSA 2XOKG 3LDEA 3WU2E 3JD0A 3MWXA 1VL2A 1ZL8B 1CP9A 3QO8A 1Q82Q 3CCVV 1ZR4A 2P4VA 3CSXA 4QGPA 3VQXA 2DMXA 4DV1O 1IVSA 4JI7O 3N4XA 3LOYA 1N0NA 1FPOA 1SNZA 3A3YB 1NTZH 3ZHRA 3B5ND 3L74G 2EILC 3BA9A 3E7KA 1BGYJ 3Q5PA 4GUNA 2G8YA 4N23A 3C8VA 5CA1B 3RYIA 1XMOB 3AFLA 3WA2X 3ZX6A 4C46A 1OMIA 3RK2B 3WUVA 2HYNA 3L74J 5KHGA 3JALA 3CWBD 3DX4A 2ZVNB 3M06A 2NPSC 2WYIA 2E75D 1N2DC 3FAVA 1VF6A 1V7VA 1OJPA 2XN0A 3AG3B 1FDIA 1PZQA 1YQ4C 3L70J 4D6TE 4PJ0Z 3PRJA 4JI2B 1N86A 4MTXA 3LDDA 2EINC 2OIGA 4WFEA 2YKOA 1F4HA 2Y0IA 2K1EA 3DDGA 4PV1B 4H13C 3ZIAG 1PS3A 1AV1A 1PPJH 3A24A 1NTZE 2JS3A 4FM1A 2K9YA 3N2GB 3K9AA 3MHVA 1SQXE 4NB5A 2QRXA 3IN6A 2CGNA 1AA0A 3G4SP 1G1JA 1J0NA 3K5LA 5APTA 2DWEC 3UCSC 5APVA 1YJNP 4X62O 1Y47A 3RYHA 1T3UA 1JZ8A 3SWYA 3LVTA 2Q5ZA 1HDJA 1MSDA 3KG2A 1M57C 1H8AA 1NTMD 2A45H 1SESA 1SERA 2JO1A 2Z4EA 3U0ZA 1N7RA 2EINB 4YHHB 3BUPA 1LF9A 1NAYA 4HZ3A 4I2LC 1KB9I 3JAMN 2CFGA 1RWFA 1IXBA 1US1A 2Q7CA 2HTAA 2LXBA 1VQ7P 4DRXA 1D7MA 3QO7A 3N7NA 4KP4A 3H1LE 4MVMA 5AW7B 3WB1A 1UI7A 1IK7A 2EACA 4PHZA 4X66B 1Y6XA 3CD6V 3JD2A 3DX1A 3T0DA 4PDRA 1N0JA 2XAJA 3MUDA 1XI1A 3WU2H 1DD4A 2F7OA 1K4DC 4HNAA 1K73W 3EQ2A 4UB6E 1JTHB 1PKXA 4U7NA 1NTZJ 2ZAEB 1HR0B 4CH5A 2YEVB 3JYCA 1KORA 3L35A 2E5LO 3V5BA 1B04A 3CEIA 3T1CA 1Z56A 2FUQA 1E5WA 3GG2A 1M5IA 5LYJA 3T1YB 1SFCC 3GF3A 3H1LG 1JZ7A 1SQGA 2BCCG 4K0KB 1M1KQ 1VQLP 1K5SA 4DXWA 1WMNA 3L75D 4K3AA 1QVGU 4PD4H 3RL0C 3FXDA 1D5AA 3L72J 3VQYA 5C8YB 1W0KG 1NS4A 3E8GA 2PI5A 3R2PA 2M3BA 3SPJA 4EFBA 3CE2A 4HH2A 1TUBB 3AE3C 5KLVJ 3JSVC 3T2OA 3A2FA 1JA8A 2LP7A 5B1BB 1GK9A 2AHYA 2HG5D 4BIUA 3EJPA 3R66A 4JAUA 3FYEB 1FZCA 4MSWC 3BVXA 1A02F 1GM7A 2X6BA 4DV6O 4FK5C 5IY5C 1OCZB 1J2JB 4U3FD 2ZCEA 1CPYA 1J5EO 2O01J 5A1AA 4PJ0E 1H54A 1LF6A 1OJOA 4EDFA 2VQFB 2W0FC 4LF5B 3DC6A 5EK0A 4O4HB 1P49A 3OW2U 5BY1A 1E1RG 1RJOA 3A0RA 3A0BE 1NTME 5IJ0A 1U96A 4AQYB 4G2KA 2K1AA 1FAFA 2Q9IA 1QHTA 3IAPA 1VQ9V 4KFMA 3SGIA 1JYNA 2FKWB 4X20A 3DYPA 2V7QH 4U3FG 3IMHA 1XMQB 1NS7A 4UVCA 1AQTA 2P1JA 3BUBA 3FKSG 3JC22 1SFCB 3VMXA 1F1SA 1HNXB 1CZQA 3DYOA 5B66E 2FYUH 2WSFJ 2IW5A 4UB6H 5K5GB 1SF9A 2QSAA 3E8HA 3RL0B 1NU1D 4I55A 4X65O 5EBWC 4GIFA 4OVNF 1K5QA 3E7JA 2CISA 3NJVA 2FYUG 2R72A 4X88A 1R8EA 1QR9A 4X9QA 1AVKA 1NTMH 1I94O 4K8XA 1Y9BA 2HFED 2WITA 5JJEB 3H32B 1XNQB 3RFRA 1SQBK 2VS0A 4FM2A 3AG2B 3VYIA 1A02J 1N7PA 2W0XA 2IU0A 4PDLA 2KB7P 1K3EA 2XZRA 4OJZA 3TJTA 4WF9V 1ENVA 5JMDA 2QG4A 4OGQC 3D3QA 2PF4E 4RAIA 3O9OA 1RFYA 3HUSC 4C7UA 1KC8Q 5JJNB 1LP1A 4DZOA 5ITZA 1BE3J 3D50A 1XMQO 3E83A 2IYPA 3FGAD 2OTJV 1NJIW 5B66H 4LFAO 2WAMA 1J1EB 5EYPA 1UG9A 1MFTA 1SS1A 5E1QA 5EC2C 2Z5IA 2ZXQA 1HNZO 3HE5B 2A3QA 1NO4A 1QLED 4KUMA 4NR1A 4Z1VA 1KILC 3EVKA 3KHUA 3K3WA 1EDIA 5J9PC 2V1DA 2B87B 3IR9A 3DDFA 5A9GA 2XNXA 3T0AA 1LNQA 4MTGA 3DXRA 2JJLA 2PRRA 3LSQA 1W3YA 1OCCB 1YJWP 3VD3A 2JKVA 1K92A 2CPBA 3MV01 3A0BH 3U1CA 3H1HD 5GONA 4WBAA 3I56V 3Q1MA 4NYKA 1WJZA 3K08A 3S3XA 3BLBA 1WN7A 5BMVA 1PGQA 2CFKA 1S5LX 1SP4A 4OX9O 1RWCA 1HM3A 1S0VA 2KZIA 3J80N 4ABMA 3C3SA 2XDJA 4R4MA 1CEZA 1ROPA 4FFBB 1USEA 5FPOA 2EIJC 3A0HH 2QWNB 2OYHB 2GTAA 1WB7A 3CRAA 3F7YC 3AG3C 3FX0A 3HB3B 4JYBA 4X1IB 2H88C 4H44C 3AK2A 3DECA 1BGYD 1OCCC 3MUY1 2CIQA 2UXNA 5APSA 1R6KA 1YJ9V 1ZW0A 3RK3C 1JYWA 4YXDC 2A06D 1IVUA 3RYFB 1OW7A 5AW4B 3AMOA 1S9KD 2UXDB 3BAAA 3IC7A 2B9BA 4GLXA 3GLMA 4D6TD 1ZP0C 3D51A 1V54B 1Q6HA 4I0XB 3ECQA 3OS7A 3DX0A 2J59M 1S3JA 2YIAA 2GUZA 1K33A 4LF4O 3RVYA 2CK3H 2YO2A 1F4AA 2QIWA 4R50A 4UVBA 5CA0A 1VQ7V 2FL4A 3UO3A 4JPRA 2ODMA 3F7VC 3AE8C 5AVTB 1TUEB 4FZ0A 1YJWV 5KHHA 3UO2A 4JI6O 3AG1C 2DJVA 4O4JA 3N2KA 3EJSA 4YHHO 3CXHH 4BIOA 2Y0DA 2ZNJA 1QX8A 3CI9A 1P84H 1N36O 1L7KA 5CCHA 3X3ZA 4LF5O 4X1YA 3WMM0 3HKEB 1L0NJ 4MS2A 2GHYA 5GTIZ 3M9QA 1A32A 4FVMA 1SQPJ 1LUVA 1NKNA 4DR6O 4Z1MH 2VWKA 4IOIH 3L72E 3VQVA 3CX5E 2BSKB 4A7PA 3D4ZA 1DEBA 2ZINA 3S3WA 2WVRA 2N9BA 2ZXEB 1JCHA 4J7KA 3D70A 3P3PA 3L73D 3CRMA 4LF7O 3MUDC 5FNVA 3Q1NA 1VF5B 1BCCD 2EULA 1URFA 2JJ1G 4R6ZA 2POHA 2IFNA 3CS5A 2IJIA 2ZM6B 3OB8A 1DGSA 4AUWA 3MTUE 2QKAA 1OVRA 4KT0J 3JD4A 2NZ2A 4O2AB 2IZ0A 5CB4A 1N33B 5F2VO 3Q5SA 4CS2A 4DRXB 1MUUA 5AW3B 2ZQMA 1I8QA 3I55P 2Q0AA 2YI8A 1JY2N 1AI6A 3JARA 3UT5B 1L0LG 2Y0CA 1H2MA 3L74H 4U3JB 2P7JA 2UU9O 4H0LB 4B7EA 4JI3O 5LXTA 3SWFA 3CCVP 1HMWA 2YSUB 4OGQB 2Q9LA 1PGOA 1YTZI 3EXAA 3HTKB 5JCOA 5EC1C 1NWQA 4QJFB 4W80A 2RKLA 1R6TA 2RQ6A 3CC7V 4FM0A 3L71D 1L2PA 2CK3G 3E1IA 1SKVA 1JZ6A 3QFZA 1FZCC 1FXKB 4CC6A 2QJ1A 3G71V 1KFNA 4BRYA 4YJ3B 5TJHA 5APXA 1Q86W 3G3ZA 1GL2D 3TGUJ 1JJ2U 5B66Z 2GV9A 2GBOA 3AEIA 2Y9ZA 2ZIMA 2DW4A 2OW7A 1Q6IA 1BHAA 3RBXA 3K25A 1PP9E 1OCOC 1RF1B 2DYSB 1L0NK 1GN4A 4U3FJ 2P58A 1NTMK 1GM9A 4E2LA 1DYUA 1ZAUA 2QTOA 1HWYA 1SQBJ 1BL8A 1MMUA 4DR2B 1XOUA 1Q90D 2CTPA 4B3RB 1OZ0A 5K1PA 4PA3A 4G28B 1MSWD 2WT7B 2A45I 4JYYA 3CV5A 2R9IA 3KCXA 2FXOA 1N7SD 4XDLA 3OJAB 4CH6A 5LYJB 1T8ZA 3JATB 1T2KC 4JI5O 3RYIB 5JJJB 3GHGA 4I6MC 3AE5C 1N34B 3B8EB 4UB8Z 3ZJZA 1AB3A 3KYQA 1Q7YQ 2XHNA 1HR0O 3QG0A 2UUCO 2R3SA 4BW9A 1Q7YW 4FFKA 1EN6A 3OR6C 4PV1D 2WA4A 3CCLP 1XHZA 3K5MA 2ZYAA 2M0BA 4TT3G 1OW8A 4O2BB 3AE4C 3APOA 3M8AA 4UV9A 2ZYGA 4XA4A 3RL0g 3MI6A 2R70A 4KFFA 1F7YA 1NGMB 1G6UA 3AEGC 4JQ0D 1W59A 4TUYB 4X64O 1L0LD 3CP1A 4QIWF 1VQ9P 1RWAA 3OAAG 5IYZA 2C0WA 4HKZH 4LFCO 2WOFA 4DV0B 1JZ2A 3L72G 1AJQA 1LR1A 5LL6Y 2C9NY 3KN4A 3E86A 2WZ7A 2KG7A 1GMJA 3RN4A 1LWUA 4RO0A 1FOSE 3BCCH 1NH4A 2NR5A 3OEEG 1QCEA 3B09A 1WT6A 5J2TA 3H1JD 3VDBA 1ZV8A 1IO4A 3L75E 5KA6A 5AVSB 4I4TB 1G2CA 2W27A 1Z5WA 1N34O 4H13D 1GMGA 1X1JA 4PD4F 2JGDA 4X8AA 1X0TA 2ZYDA 5LP6A 3QNEA 3M0DC 4UUJC 1OFCX 2YO3A 3Q5RA 5AVXB 1N8RQ 4LBEC 3O65A 1FFXA 1TAEA 4PA6A 3BVVA 3S4CA 1NVOA 1EDJA 4BZGA 1JY2P 3KDPB 5AVRB 1JZ4A 1M56D 2KKWA 3I5DA 2ARHA 1LP1B 1FZAA 1GU4A 1G4YB 1FZEA 3PGBA 3BEHA 3FB8C 2WLLA 2AEJA 2KIKA 4MVRA 2F66C 1NU1J 2LFSA 2OCHA 1GK6A 5LOVB 1SQVD 3HIIA 1RE4C 4L76A 3V2NA 3T1HB 2IBZH 5TISZ 4QPKA 2IU3A 3P7KA 2KLVA 1UPGA 3H1HJ 2CFLA 3H25A 1AI5A 2CWVA 2IX7C 3MZWB 3H1KD 4K35A 2WTYA 1OJHA 1I0HA 4UCRA 3OBAA 5LHIA 1PV0A 1MMMA 2Y69C 1YITV 2FTKA 1RM1C 4JZGA 4DR3B 1D6UA 4DUZB 3JCUE 2QTSA 1P4RA 1VQNP 2O01N 4DV1B 4JI7B 3ZCCA 5IJ9A 3TDKA 3NXSA 3VD9A 1K7DA 1VQOP 1K4CC 1Z2GA 3EFFK 1OZHA 5IJ0B 2LW1A 3EJRA 1YI2V 3R4YA 5CBFA 1PGJA 1NOHA 2A06E 2H8PD 2ZVOB 2JVDA 1NAFA 1JOCA 1Y4MA 3B5NB 2ZR2A 1NKGA 1KECA 1XTCC 5AVZB 1EZVI 3RSYA 5E79H 1VQ5P 4GX5A 4JPZB 2LGQA 4JGSA 4DV7B 3F5HA 1EDLA 3VBBA 1I94B 2XUMA 4MW3A 1RH5B 2FYNB 4WY4A 1AFOA 1V9PA 1EZVE 1VQPP 2Y9YA 3NJXA 1TQSA 5CCHC 1Y76B 2WW2A 3M91A 2KK7A 3ETEA 1HNXO 2WLIA 2BCCH 1H0TA 1J1EC 1GZLA 4IIJB 2XAGA 3T1HO 2QJYC 2WSCH 5KJ7A 1M90Q 4BAYA 3DX3A 2FYUJ 3OUFA 4AQRD 2UUCB 2K9JB 2OTLP 4OX9B 3L70D 2OW6A 2BTOA 1P7GA 1GAXA 1LJ2A 1BE3G 1UI8A 2L6LA 1IQYA 3VMZA 2O01H 3HKBB 1YHQV 1MMYA 5IWAB 3H1LH 3HI7A 4HBNA 3SFEC 2UWJE 1SQQH 3UIAA 5H9CA 1YI2P 4JTCB 1THZA 1NSMA 2QVAA 3CCUV 1XHXA 2P22C 1U7MA 3MD0A 3U11A 1L0ND 2HR3A 5LOVA 1Q2NA 4DR4B 4TV9B 3QF7A 3JSNA 1VIBA 4LP8A 2V4HA 3LW5J 3EHBB 2BCCE 1R5SA 2R5DA 2Y48A 4LH6A 3K79A 2Q7GA 5BR8B 1S5LH 2WSSG 1R3KC 2Y73A 3DYMA 3K5BA 3JALB 1KILD 3OMAB 2CE4A 2IBZD 1FOSF 2CG1A 2IH1C 3OMNB 1VQ8P 5CA1A 4U3FE 1SQVK 1FXVA 3N27A 4UCVA 4CPGA 4LFCB 2Q1KA 4WWIA 4FLTA 2GDSA 3OW2O 2QEXV 5JCOC 1N7NA 4W4LA 1D5NA 1KKCA 2AEFA 2K9PA 1BSMA 3H6PA 4IL6X 2B9ZA 3ABTA 3FB6C 1S5HC 4LWSB 2OOVA 3TGUG 2ZFCA 2ETNA 4K0KO 1KYOD 4TV8B 2WDAA 3SYQA 3ABUA 3OFNG 2DYRB 4FNTA 3T1YO 2F43G 2D2CD 1NS0A 2YIBD 3L9DA 3ABLC 3OMIB 4RUFA 1VQPV 1HN0A 1JYVA 1MG1A 5IYZB 2FUTA 3MAQA 1FZCB 1RWHA 2EIJB 3JAKA 1KMIZ 2Q3IA 4LFBO 2YXLA 5E1AC 3VD4A 1EXIA 4D7TA 2XAFA 1PIXA 3QH9A 2UUAO 2OARA 3I3BA 1G8MA 1IFPA 1KQLA 2WZSA 1ZTEA 3T0BA 3T2PA 1D6YA 3CD6P 2CWUA 1IC2A 1GU5A 4WB4A 2H7HA 2RMKB 1KFMA 1K1XA 4MVSA 2DW3A 3TETA 1KYOH 1HWWA 1YIJP 2WCOA 2M7WA 1NTZG 2N9YB 1RM1B 1N36B 5LHHA 1MA1A 2WSEJ 1M56C
chains in the Genus database with same CATH topology
1EDLA 4BXLA 5DJTB 2B87A 3EJSA 1Y47A 1U7JA 5K5GB 3LVTA 4HB1A 3DX2A 4ASWA 2LXCB 2B89A 1TQSA 3FXEA 1TQVA 3BUPA 1TQWA 1LT1A 1HXKA 3D4YA 5CBOA 2M0BA 5CBNA 1H0TA 1DEEG 2LXBA 4EYYQ 3CZNA 3DX3A 4IOIH 2F7PA 2KI7B 2OW6A 3D4ZA 1EC5A 1QWUA 5EFWB 1QX1A 4HKZH 3DX1A 4GODA 1LP1A 2UWJE 1TQUA 3D52A 2F7OA 3D50A 2M5AB 1HTYA 4JBZA 1ZXGA 2QVAA 1U7MA 3BUQA 2F1AA 2HR3A 4ZNCA 2ZAEB 1Q2NA 3BVWA 1MFTA 1SS1A 1OVRA 1OVUA 1BDDA 2F1BA 1X0TA 1FC2C 3BVUA 4NPFX 1JM0A 4ASVA 3BVVA 5KBPA 1NVOA 1EDIA 2WMMA 1EDJA 2B87B 1QWNA 2F18A 1TQTA 3DDFA 2KZJA 1BDCA 1R34A 4K3AA 2M5AA 4NPEA 3RGUA 2I8DA 3FXDA 5DJUB 2LR2A 1LP1B 4CPGA 4ZMDA 2B88A 2Q1KA 4WWIA 2KIKA 3BVTA 3EJQA 2JWDA 3CZSA 1R33A 2RKLA 4HJGH 3BLBA 2FYVA 1EDKA 3EJPA 3BUDA 1JMBA 1OVVA 1O7DD 3BVXA 2KZIA 3MZWB 4K35A 2K3RA 2WYHA 3DX4A 2WYIA 2OW7A 4NPDA 2OTKE 4GOFA 3QWOC 3EJTA 4GOEA 1ZW0A 4KJMA 5C39A 3BUIA 3S1KA 2P58A 3EJRA 2ALWA 4MN4C 2KS1B 3DDGA 2SPZA 2F7QA 3D51A 3DX0A 1PS3A 3ZDMA 3EJUA 1S3JA 2F7RA 1HWWA 3CV5A 2KUBA 3PH0A 2R44A 1H0TB 3MHVA 2QRXA 3BUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDL A;  4BXL A;  5DJT B;  2B87 A;  3EJS A;  1Y47 A;  1U7J A;  5K5G B;  3LVT A;  4HB1 A;  3DX2 A;  4ASW A;  2LXC B;  2B89 A;  1TQS A;  3FXE A;  1TQV A;  3BUP A;  1TQW A;  1LT1 A;  1HXK A;  3D4Y A;  5CBO A;  2M0B A;  5CBN A;  1H0T A;  1DEE G;  2LXB A;  4EYY Q;  3CZN A;  3DX3 A;  4IOI H;  2F7P A;  2KI7 B;  2OW6 A;  3D4Z A;  1EC5 A;  1QWU A;  5EFW B;  1QX1 A;  4HKZ H;  3DX1 A;  4GOD A;  1LP1 A;  2UWJ E;  1TQU A;  3D52 A;  2F7O A;  3D50 A;  2M5A B;  1HTY A;  4JBZ A;  1ZXG A;  2QVA A;  1U7M A;  3BUQ A;  2F1A A;  2HR3 A;  4ZNC A;  2ZAE B;  1Q2N A;  3BVW A;  1MFT A;  1SS1 A;  1OVR A;  1OVU A;  1BDD A;  2F1B A;  1X0T A;  1FC2 C;  3BVU A;  4NPF X;  1JM0 A;  4ASV A;  3BVV A;  5KBP A;  1NVO A;  1EDI A;  2WMM A;  1EDJ A;  2B87 B;  1QWN A;  2F18 A;  1TQT A;  3DDF A;  2KZJ A;  1BDC A;  1R34 A;  4K3A A;  2M5A A;  4NPE A;  3RGU A;  2I8D A;  3FXD A;  5DJU B;  2LR2 A;  1LP1 B;  4CPG A;  4ZMD A;  2B88 A;  2Q1K A;  4WWI A;  2KIK A;  3BVT A;  3EJQ A;  2JWD A;  3CZS A;  1R33 A;  2RKL A;  4HJG H;  3BLB A;  2FYV A;  1EDK A;  3EJP A;  3BUD A;  1JMB A;  1OVV A;  1O7D D;  3BVX A;  2KZI A;  3MZW B;  4K35 A;  2K3R A;  2WYH A;  3DX4 A;  2WYI A;  2OW7 A;  4NPD A;  2OTK E;  4GOF A;  3QWO C;  3EJT A;  4GOE A;  1ZW0 A;  4KJM A;  5C39 A;  3BUI A;  3S1K A;  2P58 A;  3EJR A;  2ALW A;  4MN4 C;  2KS1 B;  3DDG A;  2SPZ A;  2F7Q A;  3D51 A;  3DX0 A;  1PS3 A;  3ZDM A;  3EJU A;  1S3J A;  2F7R A;  1HWW A;  3CV5 A;  2KUB A;  3PH0 A;  2R44 A;  1H0T B;  3MHV A;  2QRX A;  3BUB A; 
#chains in the Genus database with same CATH topology
 4RWU A;  2D3O W;  2XHB A;  4P9O A;  3G6E P;  2Q67 A;  3GHG C;  2O57 A;  4I55 B;  1H2S B;  1ZME C;  2W6I G;  3CX5 D;  3CCS P;  2M8R A;  4N78 D;  2JP3 A;  4J11 A;  4ASW A;  1IVX A;  5JQG B;  4DV3 O;  4IFD K;  2PUS A;  1MNG A;  4DUV A;  2HTB A;  4O4L B;  4JI0 O;  3D4Y A;  3VSN A;  2JKE A;  5CBN A;  1FAV A;  1M90 W;  4WVZ A;  4NTW A;  3HR0 A;  4FNP A;  1L8D A;  2Q3E A;  5DM6 V;  3ZRW A;  2WT7 A;  2OWO A;  2QA4 P;  2E76 B;  3B8N A;  1LTI C;  2WW1 A;  4H0L C;  4JTD B;  2YFO A;  1VQK V;  3PP5 A;  5IYB O;  4LF4 B;  1SVF A;  2BAS A;  3X42 A;  3RBZ A;  2YX9 A;  2CTR A;  4PJ0 H;  4JYA O;  2IJJ A;  1LWU C;  1EN5 A;  3BPZ A;  4H0L D;  2E74 C;  2FYN C;  2E75 B;  5LMN O;  2ZIO A;  3HE5 A;  5KUK A;  4X65 B;  4ZNC A;  3HIG A;  2C2A A;  2CH7 B;  1GL2 B;  4GX0 A;  3H1H E;  3AEB C;  1SET A;  3VDC A;  4X1Y B;  3K04 A;  5LP6 C;  2RN0 A;  2CFD A;  4QPJ A;  2N1T D;  3M0D A;  5KKZ B;  3CCU P;  2QJY B;  2HEP A;  1M8O B;  4MTO A;  3FWL A;  4DW1 A;  4GZR B;  5KAF Z;  5H2F E;  3WFV A;  1R1B A;  2YXY A;  2Q0O C;  4U3J A;  2KZJ A;  4ZKU A;  3AED C;  1W6C A;  1HJ0 A;  2KSD A;  1HTL C;  1FS0 E;  4BZF A;  3L72 D;  2I8D A;  3CXH E;  3NBJ A;  2ZKO A;  3CC7 P;  1K1Y A;  4CS4 A;  1IFD A;  4ZMD A;  4N6J A;  4FNQ A;  1KB9 E;  2F93 B;  2WPV B;  2E74 B;  4PDV A;  4TOI A;  3OR7 C;  5LMN B;  3GHG B;  4OWF A;  4AQ0 A;  2LKM A;  2KNC A;  1NTK K;  4YJ2 A;  3KZI H;  1TUB A;  1XIL A;  5B1O A;  4WY4 D;  1RE4 A;  4F4L A;  5FL7 G;  1J1D B;  2XND G;  4KTR A;  1HJB A;  2BE3 A;  1URQ B;  2X03 A;  1I5X A;  3BUD A;  1JOY A;  2YKQ A;  1VF5 D;  1DH3 A;  5BMV B;  3AE2 C;  2YIU B;  3OAK A;  4X1I A;  3KCY A;  4C7N B;  3U10 A;  3SFD C;  1HNW O;  3L71 J;  4PA4 A;  4PD4 E;  4IL6 E;  1H8H G;  1E1Q G;  3H9V A;  1IBM B;  4WFH A;  4UCT A;  3CC4 P;  4D6T G;  3QWO C;  1OCR C;  4KJM A;  1W4N A;  5B1A C;  2YMY A;  2RCV A;  3SPC A;  3S1K A;  1JCD A;  5EBL C;  1IK9 A;  1QL1 A;  3HD7 D;  2KS1 B;  2E75 C;  2ZE5 A;  5KA5 A;  2SPZ A;  2CPS A;  4DV4 O;  2IDB A;  3ZDM A;  3OGI B;  1IX9 A;  4F6R A;  2WSC J;  2F7R A;  2C9L Y;  4IL6 Z;  2UXD O;  4DR7 B;  4X20 B;  3CL3 D;  1M9N A;  2P06 A;  3G6E V;  1MN0 A;  1MMX A;  4J9Z B;  1YGA A;  4RNL A;  1WA8 A;  3C3T A;  3H1K G;  5C8Y A;  1TVK A;  2XTA A;  4EEQ A;  2UUA B;  4BXL A;  3UKM A;  2YKP A;  3VP9 A;  4WY4 C;  1SQB D;  3D36 C;  1AR1 B;  1PNL A;  3V6I A;  3VMY A;  1I08 A;  3H1I D;  5AVU B;  5EBM C;  4HB1 A;  3DX2 A;  3DCD A;  2HP8 A;  1BCC G;  4J7J A;  1NJI Q;  3FXE A;  4FNS A;  1SS3 A;  2OYI B;  2JEE A;  5B3S B;  3BGA A;  5CMU A;  3ZMU A;  3ZBH A;  2KSJ A;  1LVN A;  4UVA A;  5DN6 G;  5KJ7 C;  4DV5 O;  1I7F A;  4DCK A;  3A0H Z;  1VMG A;  2AW9 A;  3JAT A;  5GTH Z;  4CBC A;  4BWA A;  1M1J B;  4NXM B;  3UM7 A;  4OK2 A;  4J80 A;  2V4D A;  3TGU H;  1IVV A;  5H2F Z;  3CWB G;  2EAB A;  2GSM B;  1KTM A;  4YTP C;  4KHP O;  2HJD A;  2N04 A;  1RSO A;  4JF3 A;  3FAV B;  2D2C C;  1HTY A;  1IQX A;  3K5T A;  4QE7 A;  2QWQ B;  3UQ8 A;  3KZI E;  1IBL O;  4W4K A;  4LGD E;  3X2Q B;  1OCR B;  1JMK C;  3RK3 B;  4E4E A;  2ZT9 C;  3IJ4 A;  4GYC B;  5HFM A;  2Q1F A;  3PLN A;  3APQ A;  2Y74 A;  1KSI A;  1FFX B;  1NH2 D;  4DR4 O;  1L4A A;  3HKD A;  4QE9 A;  3RW0 A;  1NVP D;  2WSS H;  1X4T A;  3RK2 C;  1TQT A;  5IYD O;  2QJP B;  2DN9 A;  4DR1 O;  1R34 A;  1WNS A;  3ZED A;  1HGV A;  1MV8 A;  1J5E B;  3CYO A;  4EB6 B;  3B8M A;  4U7O A;  1GH6 A;  1X9V A;  1HMU A;  2B88 A;  4BIZ A;  1LTB C;  1W2E A;  1SIH A;  5GTI E;  1C82 A;  2BEQ D;  1VQK P;  2VRS A;  1MZF A;  4DYL A;  1USD A;  5GON B;  3X2Q C;  1X22 A;  1R33 A;  1XQ8 A;  3LSU A;  3HTK A;  1NSU A;  3H01 A;  2OOV C;  3RYF A;  3WB0 A;  3CCL V;  1IBK B;  3H1I H;  3ZMS A;  1VQM P;  1Z45 A;  1YDX A;  3GMA A;  1AIL A;  2X6A A;  5APU A;  1N73 A;  1IXM A;  1FFT B;  4DOJ A;  1JFF B;  3E1R A;  1T3J A;  3LSS A;  5IYC O;  5AW6 B;  3SJQ C;  4DK0 A;  2ITC C;  3BCC J;  2JIZ G;  1JY3 P;  3V4Q A;  4CH3 A;  5KLV G;  4GOF A;  3LDC A;  2ZR3 A;  1Q3E A;  5BZB A;  2DQ0 A;  1SFC D;  1GL2 A;  3IAO A;  2QM4 A;  4DV2 O;  3JCZ A;  2PYJ A;  3PTZ A;  2GM4 A;  2XKM A;  1YZB A;  5FLX N;  2KP8 A;  3RL0 D;  4TV8 A;  5BU8 B;  1JB0 J;  1EZV D;  2YXR B;  2IBZ I;  3GWK C;  5KLI B;  2BCC J;  2W6J H;  3MIW A;  1AR4 A;  2ZXX A;  2YXQ B;  2HVJ C;  2W6B A;  3ABK C;  3T97 A;  2BSK A;  5IJ9 B;  3OE7 G;  1LTJ C;  5L3E A;  1V55 C;  1IVW A;  1DK1 A;  2JEX A;  1WLE A;  2F4V O;  4TTG A;  4DV6 B;  3BRV B;  1GTW A;  4MW8 A;  3K57 A;  3T4D A;  4RQE A;  4N3Y B;  1K73 Q;  1HF9 A;  4UB6 Z;  1MKM A;  3AG7 A;  1NU1 E;  1S4X A;  2YXH A;  1NTK D;  4YIP A;  2OQE A;  1URQ D;  2JDI H;  3V2Q A;  2WOH A;  2KQX A;  2EIM C;  1KYO I;  3TGU E;  3SJC C;  3F89 A;  4X62 B;  3AEA C;  1W2B U;  2JDI G;  1M4U A;  4JI5 B;  1AJP A;  3IC9 A;  4TUY A;  1BCC H;  4OPH A;  3ZHU A;  4WFA V;  4FLY A;  1W7C A;  2CTQ A;  1QVF U;  3NRE A;  3RYH B;  3ETQ A;  2I1J A;  1DF4 A;  2WWW A;  2HHH O;  3C1L A;  5CMZ A;  3AFJ A;  1JVM A;  1W5Z A;  1L7J A;  2CQT A;  3I3D A;  1WB8 A;  1IJD B;  1J95 A;  1GD2 E;  4FZ1 A;  1HBW A;  1WAZ A;  1R3J C;  2FYZ A;  1HNW B;  1YEW A;  3H1K H;  4FLU A;  2FKX A;  1XEQ A;  2N1T B;  4M3L A;  3SX1 A;  2NLJ C;  4WFB V;  3V4W A;  1N73 B;  1E79 H;  3WFA A;  1KQS U;  1JY3 O;  3LNM B;  1Y74 A;  5CCG C;  2XT9 A;  2P6J A;  1JO5 A;  4FPP A;  2FFD C;  1FXK A;  2D2C B;  1NSR A;  5KAI Z;  1KB9 H;  2WW0 A;  3NTN A;  1VQO V;  4FLV A;  4FLW A;  2UU9 B;  1NBM G;  5LA6 B;  1IBL B;  2BOC C;  1ZSP A;  3CXH D;  4JI4 O;  4ZBM A;  2J5U A;  4GKG A;  4LNU B;  3JAS A;  4YPC A;  2WVX B;  1LUW A;  3R65 A;  3SJB C;  1VQ4 V;  2OTL V;  4AYC A;  3AMO B;  2EJR A;  5KLV H;  3CCM V;  2WLL B;  4NKG B;  3TNU A;  2DQ3 A;  1Q43 A;  1PPJ E;  4KL1 A;  4NTX A;  1S72 V;  3WG7 C;  3J7H A;  3O8Z A;  4U7J A;  3QVN A;  1O7D D;  2LO1 A;  1VQM V;  1DX7 A;  1AP5 A;  2JKP A;  5BR8 O;  2F1M A;  3CCQ V;  3JAK B;  4TT3 H;  4EOT A;  1SQP G;  3ETD A;  1IBK O;  5DEC A;  1KIL E;  5M1B A;  2CUG A;  1OHH G;  2A06 G;  1VPC A;  4XBF A;  2ADQ B;  5KUM A;  5L3B A;  5KAI E;  3S4R A;  1BGY E;  1JY3 N;  2OIE A;  5DED A;  3HD7 B;  5EYP B;  3WU2 Z;  2ALW A;  3SWK A;  2ZT9 D;  2WLH A;  4IGG A;  3DTU B;  3T2Q A;  3VDA A;  3RYC A;  1BSN A;  3M99 B;  2E76 C;  5FPR A;  3ICX A;  5EZY B;  5CJ0 A;  4UV8 A;  1T6A A;  2R44 A;  4O2B A;  5APQ A;  2IJH A;  1YF2 A;  3PJS K;  1VQN V;  3WIR A;  4TLF A;  1YBK A;  1VF7 A;  1K1W A;  1RQU A;  1JZ3 A;  3D36 A;  3S4B A;  4CZZ A;  1TU3 F;  2ZL8 A;  4KHX A;  2Q8V A;  3CME P;  5GTI H;  1K97 A;  1U97 A;  2JGD B;  3H1H G;  1HH0 A;  3P8M C;  3K5N A;  3T0U A;  2OGU A;  3BY6 A;  5J2T B;  1H38 A;  1NH2 B;  2Y0P A;  1CI6 B;  2QGN A;  1EQ7 A;  1SQB H;  4R7C A;  1QWU A;  1QX1 A;  1TVK B;  3RK3 D;  1N7O A;  1F51 A;  1GM8 A;  3QDE A;  1S1C X;  5KLI C;  5D5P A;  3ASN C;  3GF7 A;  3V2R A;  3BRC A;  4JI3 B;  1NR1 A;  2AXT H;  1M1J C;  3ITK A;  1BSH A;  5LXT B;  1JYX A;  2KG7 B;  2DE0 X;  3E1F 1;  5CHX A;  2IBZ G;  1QAK A;  3G9R A;  1GW3 A;  1YVW A;  3CB2 A;  5D5Q A;  3CZJ A;  3QFY A;  5APY A;  3FX7 A;  4P2Z A;  1IUR A;  1OVU A;  2IZ1 A;  2O1J A;  1PD3 A;  4PDM A;  3E2E A;  3L70 H;  2IPP A;  2N1T C;  1JOV A;  4GX2 A;  3CWB E;  1EFR G;  3P30 A;  3JAW B;  1YSC A;  1L4A C;  1N7Q A;  1SA0 A;  4ASV A;  1MOF A;  2WLN A;  4OPA A;  2XV5 A;  3H1L D;  3L71 H;  1CSB A;  4YJ3 A;  1AVM A;  3X3X A;  3B2E E;  1PNM A;  2WLK A;  3HPL C;  4B3R O;  1IFN A;  2M5A A;  4LC1 A;  2AZ2 A;  4PD4 I;  5L8R J;  2ITD C;  4G27 B;  2ZNI A;  3FFQ A;  1SII A;  4DR5 O;  2Q68 A;  1W2Z A;  1PU4 A;  3CCJ V;  1RE3 C;  1P84 E;  4MVZ A;  4JYA B;  4WBN B;  1U57 A;  2JWD A;  2JEU A;  3CZS A;  4LF7 B;  1KC8 W;  1N7S B;  2CAZ C;  3USS A;  3BCC G;  2FYV A;  1TGO A;  1IZ3 A;  4R8C A;  3EWK A;  1N73 C;  4KTP A;  3L72 H;  2WVZ A;  4IHJ A;  2UUB B;  4WY4 B;  3I56 P;  2RN9 A;  4JAV A;  4TQF A;  1W6G A;  1ZRT D;  2Y69 B;  4GKJ B;  2W90 A;  2WYH A;  3SJA C;  2E24 A;  2Z5U A;  4ZOL B;  2K37 A;  1EM1 A;  1EZV H;  1Q6U A;  1KU9 A;  1K8A W;  1BQ0 A;  4LFA B;  2VQE B;  1COW G;  1O9H A;  3OTO O;  1M1K W;  3G67 A;  4DUY B;  2E5T A;  1XDC A;  1VP7 A;  4YXW G;  1JQ0 A;  1GL2 C;  3MGN A;  1QR8 A;  2XSG A;  4MN4 C;  2E2U A;  1NSX A;  4NXN B;  3CCE V;  2F7Q A;  2JGU A;  3ZMV A;  3H1I E;  1Q81 W;  2KXP B;  1WMP A;  3OEH G;  4DV2 B;  5A2Q N;  3T97 B;  3BFR A;  2KUB A;  3CPW O;  3OT7 A;  4X64 B;  3PH0 A;  1NTM J;  1H0T B;  1LXM A;  5LHG A;  1JX9 A;  3W7U A;  5AVW B;  1SQV H;  4FFB A;  4UB8 H;  1EXJ A;  4CS3 A;  2K9J A;  3NFQ A;  2JJ2 G;  4I1L A;  2GA1 A;  3Q4H A;  1LTJ A;  2PAJ A;  5JQG A;  1Y66 A;  1NS8 A;  2EX3 A;  1ZUQ A;  1Z5V A;  4YY3 O;  1KP3 A;  1V55 B;  3KKY A;  1TQV A;  3L75 H;  2D1W A;  2QR4 A;  5GTH E;  3QO5 A;  4WFF A;  4P30 A;  3A0B Z;  3DGE A;  1QU7 A;  2BTQ A;  2Y4T A;  2A0L A;  2J58 A;  1YCI A;  2Q6A A;  1SQV G;  1YQ3 C;  2Z3Y A;  2QSI A;  4EYY Q;  2OQE C;  3CZN A;  1J0M A;  3GWO A;  4GCZ A;  4LF8 O;  2VWJ A;  3B71 A;  3OUS A;  4CC5 A;  5KX5 B;  4Y99 B;  2WLM A;  3SYA A;  5CA0 B;  4LF6 B;  3NBB A;  2PY5 A;  2WLJ A;  1NTK J;  1BT8 A;  3HKB A;  4DR2 O;  1M57 B;  2YUA A;  3RWR D;  3Q3D A;  1NS2 A;  5KTB A;  4JI0 B;  3BLC A;  4ZKP A;  2OYI A;  1BGY H;  4JF7 A;  4IYH A;  5KLV K;  3OTF A;  4LWS A;  3F5W C;  1IFI A;  4DUZ O;  2QE7 H;  3RK3 E;  1NVP B;  2WQY C;  1L0N E;  1QVG O;  3E22 B;  3E89 A;  4TSF G;  3SYO A;  1QEX A;  2HLO A;  3HE4 A;  1BE3 E;  1HP8 A;  3G80 A;  3B77 A;  2KOG A;  5BXZ A;  5KAF E;  2XAS A;  5KBP A;  5APW A;  4RKU J;  3SSU A;  1QWN A;  3W68 A;  2G3A A;  4UCS A;  5CCG A;  2FFD A;  1L0L H;  3K06 A;  1FXK C;  2R9A A;  1L1F A;  3WUU A;  1NKD A;  2LR2 A;  2KNC B;  1QNM A;  2HFE C;  4JV5 O;  1KN7 A;  2X6C A;  2QKC A;  1GN3 A;  2WLI B;  1LT9 A;  4DR5 B;  1FD9 A;  3HKC B;  5KLV D;  2E42 A;  1HM2 A;  3IF4 A;  2P10 A;  3CLQ A;  2M3E A;  2BRW A;  1SQX D;  3ZRS A;  4OGQ D;  4LF6 O;  5L3F A;  3A8T A;  4ZIB A;  3M7M X;  1DD3 A;  2XN2 A;  1KB9 D;  2BRV X;  3SEP A;  4ZKI A;  2ITA A;  3K0D A;  3ZHS A;  2K3R A;  1TXK A;  1YTF B;  2ILM A;  3CC2 V;  5CJ4 A;  2KSE A;  4YIO A;  2L91 A;  2WPR A;  1LXK A;  4ICG A;  2JS5 A;  3ABK B;  1F4N A;  2ATK C;  4TV9 A;  1SQQ K;  2NPS B;  3HUS B;  2ZE6 A;  1HW7 A;  3WVF A;  4GKK B;  3SDL A;  2RDY A;  2QWR B;  1NSS A;  4UFC A;  3THO A;  5AW5 B;  3KPE A;  1L0N H;  5KHK A;  2ZE7 A;  1SQP K;  1VQL V;  1CXZ B;  4NEI A;  1ZR2 A;  2PI4 A;  2Z0A A;  4IFF A;  3TXS A;  2KS1 A;  4I9Q A;  3ML0 A;  4AI8 A;  1CB8 A;  2VQE O;  3MUZ 1;  2BOB C;  1DTO A;  2AXC A;  2YID A;  4J5T A;  4NXN O;  4X66 O;  3RVZ A;  1ZN5 A;  1AQ5 A;  5ITZ B;  4PA7 A;  1YIJ V;  2Z5H A;  1OJM A;  1NTK H;  4I50 A;  2BCC D;  4DV3 B;  2R32 A;  2VQF O;  1GN2 A;  1SQP E;  2IFM A;  1JEK A;  2DWD C;  3K59 A;  1MAB G;  3JAS B;  1KKD A;  1GO3 F;  1V7W A;  2WVX A;  2OCC B;  4ZHQ A;  1FJK A;  5LBQ A;  1SQB E;  5AVV B;  1AI4 A;  1FYJ A;  1DEE G;  3BHP A;  1URQ C;  4DUX A;  2WSF H;  1BE3 D;  5EZY A;  2LFR A;  3TNU B;  1J1D C;  3ACT A;  4FNU A;  4JI2 O;  1FJG B;  2KI7 B;  4LF8 B;  3W67 A;  2ZD9 A;  2H43 A;  2FFD B;  2WSE H;  1FZF A;  1QLN A;  4UCO A;  3EFG A;  2YDE A;  1M1J A;  2JRI A;  2Q7H A;  3B4S A;  5BU5 A;  4BTX A;  3CRR A;  1GDT A;  3W7X A;  3M9H A;  1ZXG A;  3VOP A;  4BW5 A;  2IH3 C;  1YJN V;  1KQG B;  1ULV A;  3X40 A;  3BVW A;  2M6Y A;  1K9M W;  1NHL A;  1L4A B;  3STZ C;  1VAR A;  5J2U A;  3CCQ P;  1XNR B;  2F1B A;  5KMG B;  2H8P C;  2N1T A;  1IZN B;  4LFB B;  1CI6 A;  1XBL A;  1AVL A;  3SR2 C;  4DV7 O;  1AVY A;  1X1I A;  3BVU A;  2WMM A;  2WPD G;  5E79 E;  1JR9 A;  2QWP B;  4MTF A;  4PEL A;  5LGN A;  1WRG A;  4O4I A;  4DT0 A;  3CCM P;  1K9M Q;  2FYU E;  1NTK G;  1UII A;  1PP9 H;  1R5L A;  3CJH A;  2HG5 C;  1H88 A;  1WPB A;  3J7A U;  3BVT A;  4MVU A;  1RE3 A;  4EB6 A;  4QMA A;  4OXS A;  1G1I A;  4YJ2 B;  3D3I A;  4BZH A;  2H89 C;  1AP6 A;  4Z2W A;  2GUZ B;  3H1K E;  4J7Z A;  3JAW A;  3P32 A;  4AIL C;  4JI8 B;  4GKJ O;  5B3S C;  2OT5 A;  4X89 A;  3SYP A;  1JMB A;  1S2E A;  4JI4 B;  2YMK A;  4PV1 C;  5JMF A;  1FZB A;  3CRQ A;  1GW4 A;  1H89 A;  1D2D A;  2OYH C;  2HPC B;  1YQ2 A;  3ABL B;  3L4F A;  1N8R W;  5IWA O;  4H33 A;  5JWP A;  4NPD A;  2OTK E;  3CMA P;  2KYV A;  3DSQ A;  1L0L J;  3P3N A;  2RNB A;  3ZN1 A;  1NTM G;  3LID A;  3LW5 H;  2LQT A;  2Y4U A;  1RKY A;  1HGZ A;  3FYI B;  2UXC B;  3FB7 C;  3HD7 C;  1N7S A;  3H1J H;  2ZDI C;  3JD1 A;  3BS6 A;  3ASO C;  2E76 D;  1N32 B;  2EZP A;  1VDF A;  1Y8A A;  2PGG A;  2R5B A;  3CMA V;  1JRQ A;  3L74 E;  4DR6 B;  3TGU D;  3RK2 D;  1L0L E;  4X1K A;  1PPJ G;  3E8F A;  4MVQ A;  1VQ5 V;  1GTO A;  3BCC E;  3T09 A;  5LMU O;  4W7Z A;  3ZRV A;  2A7W A;  1RPO A;  4EV5 A;  4H44 B;  1GK4 A;  1V54 C;  5AW8 B;  4TQD A;  2W0Q A;  2X0L A;  5CN0 A;  3H1J J;  1NSV A;  2A79 B;  4XDJ A;  1H2N A;  2AHZ A;  3HKD B;  3QG5 A;  1WP7 A;  3MHS C;  1ORQ C;  4N21 A;  3JD3 A;  4L75 A;  2JR8 A;  3RRS A;  3E8B A;  3B40 A;  4JI8 O;  1EC5 A;  1YXB A;  2AXT Z;  3D6Z A;  4GDO A;  4O4I B;  1VQ6 V;  3IAQ A;  3A7O A;  1NT2 B;  4EKW A;  1TU5 A;  4DR3 O;  3AE6 C;  1SZT A;  1NKZ B;  4B3M O;  3AEC C;  2UXB B;  1OW6 A;  3D52 A;  4JBZ A;  2OYI C;  4JZ2 A;  4IFM A;  2F1A A;  1B6Q A;  1SRY A;  4J42 A;  4RES B;  3GVM A;  2Q4P A;  2P5O A;  4OH8 B;  2HLD G;  4TWK A;  3ZS8 C;  2E2T A;  1NI8 A;  2YFN A;  2QA4 V;  1OCO B;  1KIL B;  1Q86 Q;  2C11 A;  1BDD A;  3AEE C;  5KAF H;  1T2K D;  1JFF A;  1LGH B;  3CXC U;  2EIL B;  1QL2 A;  1OX3 A;  5LGU A;  2JK5 C;  2YI9 A;  3F5T A;  5IY5 B;  3W7W A;  2RMZ A;  3CCS V;  3L75 G;  1PL4 A;  4HNA B;  4LNU A;  5H5N A;  1NYH A;  2PTM A;  1PL5 A;  3KZI Z;  1K04 A;  1PX4 A;  2MJZ A;  2Q5U A;  5AW0 B;  3CRC A;  1M57 D;  1S77 D;  3SPI A;  2HHH B;  3EJQ A;  1LT9 C;  4WBN A;  1ZRT E;  2N05 A;  3HKE A;  3C90 A;  1AR5 A;  1ZL8 A;  4L73 A;  4XFJ A;  5KLV E;  3WUT A;  3NR7 A;  1SQF A;  2FYU D;  2EBO A;  4F6R B;  1PFI A;  1FJG O;  2YIB A;  3A0H E;  3GB7 C;  4X1K B;  3D6Y A;  2CDY A;  2FB5 A;  2P4K A;  4YXW H;  3L37 A;  2WO0 A;  2CGO A;  4FJC C;  1MMZ A;  5L3G A;  2YIC A;  2ZE8 A;  4NVP A;  1PP9 J;  3HRN A;  1EGU A;  2AZ0 A;  4B3S B;  2KB1 A;  1SPU A;  3EJT A;  4BR6 A;  1FU1 A;  4K8Z A;  1NU1 K;  2VRZ A;  1JNM A;  1WP8 A;  1SC5 B;  1RQV A;  2EJ7 A;  3AG2 C;  3H1K J;  2QEX P;  3L73 E;  1JZ5 A;  1O9G A;  3C9I A;  2IM9 A;  3E22 A;  3K58 A;  1DF5 A;  1UFI A;  3RYC B;  2LW7 A;  3M0A A;  4LH7 A;  1OWA A;  4O4H A;  5LMU B;  1XNR O;  2B87 A;  3VN0 A;  3ABM B;  1VQ8 V;  4NXM O;  3MP7 B;  1EKM A;  4YY3 B;  5BVZ A;  3II6 A;  2LXC B;  4XDK A;  4PI2 A;  1M7L A;  1AJY A;  3QTC A;  4PD4 D;  3BA8 A;  4B3T B;  4HYT B;  2DOS A;  3L71 G;  1LT9 B;  1LTG C;  3CX5 H;  1URQ A;  5AW1 B;  3B5N C;  2F7P A;  2FBW C;  3L70 G;  3ZN0 A;  2P90 A;  2WA3 A;  5KX5 A;  4L8J A;  1RW9 A;  2JWA A;  1N32 O;  5EIB D;  4Z1M G;  3N9H A;  4DV4 B;  1CW5 A;  5GW7 A;  3SPG A;  3CCE P;  2D73 A;  3H1J G;  3BAB A;  1X8Y A;  2RDC A;  4DUY O;  3T08 A;  1H2K A;  1RP3 B;  2ZT9 B;  1XRE A;  2FXP A;  4Y28 J;  4D6T H;  3H32 A;  2CG0 A;  3WB2 A;  1OXZ A;  2IYO A;  4O4L A;  3ZHQ A;  4XE5 B;  3H1J E;  2EZO A;  4KXR A;  2V7Q G;  1QLE C;  2AGA A;  1SLQ A;  3CCR V;  1A2V A;  3S4D A;  2YEV A;  1PGP A;  3L70 E;  1KYO E;  1AV4 A;  3CPW U;  2JKA A;  4H13 B;  2BTQ B;  2WGQ A;  5AVY B;  1WA8 B;  2WVY A;  4FMT A;  4JAS A;  3ZMT A;  2WPQ A;  1Y74 B;  5CCG D;  1BDC A;  4B3M B;  1G1X B;  4NPE A;  2YNY A;  3SXX A;  1PV3 A;  3MPH A;  2C10 A;  4KHP B;  1SQB G;  2HOD B;  3OA7 A;  5FNV B;  4JI1 B;  1QBZ A;  1TA8 A;  4D7S A;  3W7S A;  1Q5O A;  1EZJ A;  2MKV A;  5B1N A;  2CH7 A;  3H1H H;  1PP9 G;  4I5S A;  3LIE A;  2EIK C;  3BVO A;  3OD4 A;  4LLH A;  1N33 O;  1P84 I;  1JPX A;  1AVO A;  2RH0 A;  2B1G A;  5KJ7 D;  4RO2 A;  1NTZ K;  1IU7 A;  1PPJ D;  3NMD A;  4RJT A;  4CH4 A;  1AJN A;  3AG1 B;  4DV5 B;  1L0L K;  1S5L E;  3GW6 A;  1KYO F;  1Q82 W;  1KBH A;  4H37 A;  1YYC A;  1SQX K;  2OYH A;  1RPR A;  1X59 A;  3N2G A;  2X7R B;  4H44 D;  4EI2 A;  3LUT B;  4QNH B;  1HUC A;  1RF0 A;  1SQQ E;  4OK4 A;  3TSI A;  3CJH B;  2QJK B;  1NS1 A;  1RSO B;  2ZXW C;  1MZ9 A;  2BEZ F;  4Q6G A;  1YIT P;  1BHB A;  4ZOL A;  5C39 A;  3H1L J;  4JTA B;  1SQP H;  3IGA C;  1KD1 W;  1US6 A;  5AVQ B;  3HD7 A;  5L3D A;  2CWT A;  1N7S C;  1S5J A;  2ZDI A;  4LF9 O;  1BZK A;  3T2M A;  1WMK A;  1RF1 C;  1OJN A;  5H6Q A;  1YHQ P;  3L75 J;  3HKC A;  4UCU A;  3WA3 A;  3ZRX A;  2ZJS E;  3VP8 A;  1SQQ D;  4DR1 B;  1QLE B;  2E2V A;  2UXC O;  1NQT A;  3KQG A;  1QQC A;  4DR7 O;  3K9S A;  4Y99 C;  2OQQ A;  1KP2 A;  2IJK A;  4GX1 A;  5DJT B;  4IYI A;  1X1H A;  3OM3 B;  1ZWI C;  3K5O A;  4Q20 A;  3SPH A;  3K03 A;  1ZOY C;  2EAD A;  1NTZ D;  5CA3 A;  2CFW A;  3OTO B;  2W6A A;  3E80 A;  3Q4H B;  1LTJ B;  2PNC A;  3AE9 C;  1S9K E;  5JVD B;  1FJP A;  1IBM O;  3S9O A;  2PP6 A;  2N74 A;  1HNZ B;  2IBZ E;  1SA0 B;  5IT9 N;  1NSZ A;  3AG4 C;  3W7T A;  4R4L A;  5GTH H;  3U1A A;  3U59 A;  1R6N A;  2OYO A;  2P67 A;  1YJ9 P;  4LCU C;  3CCJ P;  5H2F H;  2FXM A;  2Q6Q A;  1N9E A;  4F6E A;  1XL6 A;  5EFW B;  2E43 A;  4WCE V;  2YS8 A;  3IAY A;  2EIM B;  3ASN B;  2A9H A;  4I7Z B;  4ASU G;  1KQS O;  1JMM A;  2A45 G;  1E79 G;  1ZLZ A;  2XN1 A;  1I5Y A;  4GT1 A;  1OIP A;  5B1A B;  3JCU H;  1L0N G;  4N78 E;  5B5E E;  2M5A B;  2ZXW B;  2Q69 A;  3CCR P;  1NU1 G;  4C7R A;  4HAM A;  1LTS C;  3V2P A;  4ZHQ B;  4PI0 A;  3O6Q A;  1LTT C;  3MV1 1;  1QAL A;  4NTY A;  2WPS A;  1K8A Q;  4GKK O;  3CC2 P;  3L73 H;  1L4A D;  3ZHV A;  1BQZ A;  1IFJ A;  2L5G B;  3A5T A;  2P2U A;  4U3F H;  1PNK A;  2F18 A;  1DLB A;  1EN4 A;  4IL6 H;  1LUR A;  4IHJ B;  2QDO A;  1S72 P;  1JUN A;  1ARO P;  5DJU B;  2HKO A;  2CIR A;  1MFZ A;  1W5C E;  3G4S V;  5HFL A;  3CWB J;  3SYC A;  1VQ6 P;  2GTS A;  4AQY O;  1RHZ B;  1BCC E;  2Q73 A;  4B86 A;  2Q7E A;  5J2U B;  5B5E H;  1FBM A;  4DO2 A;  1LTA C;  3RT3 C;  3TYY A;  2OTJ P;  5CBH A;  2W8Z A;  1FZG A;  1WPX A;  3AK1 A;  1NZ6 A;  3CXH F;  1P84 D;  3CXH I;  2H94 A;  2MW2 B;  2YC0 A;  2GUV A;  3FWN A;  3KXD A;  1N4C A;  3AG4 B;  1EDK A;  3A2A A;  4BZE A;  2F23 A;  3P8C E;  3VOU A;  5IE9 A;  1LOH A;  5CCH D;  5LGT A;  4BTW A;  2QM8 A;  5KHI A;  4JV5 B;  1BS3 A;  4I9W A;  2W6J G;  1K05 A;  1DIP A;  2NPS A;  3TCU A;  2UXX A;  2ADP A;  1UJW B;  1JTH A;  2QJK C;  4J41 A;  2QE7 G;  1VF6 C;  1IFM A;  4RUE A;  3G71 P;  1FE6 A;  4GOE A;  3BUI A;  4I0X A;  1QGK B;  4ZI7 A;  1BGY G;  2BRP A;  1SQQ G;  5JH7 B;  2L35 A;  4O9B A;  3M9B A;  4FLX A;  1UIX A;  1MZE A;  2XU6 A;  3BCC D;  3L36 A;  3EJU A;  1N7L A;  3TXQ A;  4LF9 B;  4MMI A;  1BE3 H;  2K88 A;  4L74 A;  5KKZ C;  1SQQ J;  2I1K A;  3H1I G;  1BCC J;  1ZX3 A;  3CX5 F;  1FDO A;  5AW9 B;  4D6T J;  1M56 B;  2HVK C;  1OCZ C;  3BAT A;  1KV4 A;  3FD9 A;  1H8E G;  3MHH C;  3AE7 C;  4B3T O;  2EAE A;  3VTP C;  3A0O A;  3D8C A;  5LA6 A;  4DJG A;  2CQS A;  3G6B A;  3KII A;  2QM7 A;  4JAA A;  4P9P A;  1H2G A;  3N2K B;  5AG2 A;  2F4V B;  3ABM C;  2B89 A;  2FYU K;  1SZX A;  3BRT B;  1NTK E;  3VMA A;  3ALA A;  1TQW A;  1RWG A;  1LT1 A;  5CBO A;  4I50 B;  3IFX A;  3RGB A;  3I55 V;  1OV9 A;  1PL0 A;  2LJ2 A;  4AHC A;  4IT5 A;  1FS0 G;  3B5N A;  3WIQ A;  1RY3 A;  2HJF C;  2FML A;  3STL C;  3PHL A;  1KB9 F;  1GRJ A;  1DP0 A;  4MVO A;  5TIS E;  4I7Z C;  1SQP D;  1X79 B;  2W83 C;  2NPS D;  1ZLL A;  1K34 A;  1LWU B;  4A5U B;  3DXR B;  2AEM A;  4KFE A;  1KD1 Q;  1VEW A;  2QWO B;  2NNU A;  5CB4 B;  1Y76 A;  4B3S O;  3BUQ A;  2RJZ A;  4JI1 O;  2GUS A;  1EBO A;  1EZV G;  2NRG A;  2B1I A;  1JCC A;  3AEF C;  3HE4 B;  3OGC C;  1FC2 C;  4O2A A;  1SFC A;  4LR3 A;  3AE1 C;  3JSL A;  4J9Y B;  4JYC A;  3ZMZ A;  1SQX H;  3CWB H;  3X3Y A;  1AI7 A;  2UUB O;  4C7N A;  3VQW A;  3LNN A;  2B5U A;  3L71 E;  3BAS A;  2E5Y A;  3L73 G;  3AK3 A;  3DC5 A;  3RGU A;  1HVV A;  1HWT C;  4FNR A;  3J81 N;  1IDS A;  1KUQ A;  3TK1 A;  3TY1 A;  2EIK B;  3CX5 I;  4EV2 A;  4UFZ A;  1GN6 A;  4ZI7 B;  1QAF A;  1FDM A;  2DYS C;  2O3J A;  4UXN A;  3S4A A;  4HJG H;  1SQX J;  1NU1 H;  5L3C A;  2DYR C;  2R9R B;  1XNQ O;  4EIJ A;  2E5L B;  4FLZ A;  1PX3 A;  1FKA O;  4MT8 A;  3WG7 B;  3ASO B;  2O1K A;  1OVV A;  3CME V;  2PFX A;  2Y0E A;  4DK1 A;  4O4J B;  1Y67 A;  4IIJ A;  2OYQ A;  4FNV A;  2ZQ0 A;  1FXH A;  3JCU Z;  1NR7 A;  4J10 A;  1B3Q A;  5IDJ A;  4RQF A;  3L74 D;  5CBG A;  3VD7 A;  2AXT E;  4BRY B;  1RF0 C;  3L73 J;  1R3I C;  1QVF O;  3VSM A;  3CHX A;  3ACS A;  1JY2 O;  1D6Z A;  3P8C D;  3Q2Y A;  2E3C A;  1GKF A;  2F95 B;  3O6Q B;  2XAQ A;  4BTY A;  4HYO A;  4DV0 O;  1RF1 A;  2G38 A;  1SQX G;  2FY8 A;  1M93 A;  2PYL A;  2E74 D;  2LGW A;  5AW2 B;  2C0X A;  3ETG A;  1F23 A;  3K0G A;  4EFE A;  2P7T C;  1S5L Z;  1W2B O;  3VD5 A;  2XAH A;  2YIU C;  1XUQ A;  5K1X A;  2E22 A;  1R3L C;  5B5E Z;  3I3E A;  1F4M A;  1U7J A;  1PP9 D;  1P7B A;  3ZHT A;  2NN4 A;  3T4Z A;  2HOD A;  2XND H;  3I5C A;  5KAI H;  4BWN A;  1Q81 Q;  2R3C A;  5KMG A;  4PA9 A;  1XTG B;  1OAC A;  1HXK A;  2BT3 A;  1VQ4 P;  4DUW A;  2ZM6 O;  1R73 A;  3E35 A;  1P84 F;  2WW3 A;  5TIS H;  1YTZ T;  2QKS A;  3D71 A;  4MMH A;  1SQV J;  1JJO A;  1V7X A;  5EIB C;  1S76 D;  3JAR B;  3UT5 A;  4KFD A;  1B06 A;  3HUS A;  1W0J G;  4GOD A;  1WMO A;  3ABV C;  1VF5 C;  4W7Y A;  1TQU A;  1XL4 A;  5C93 A;  1T5E A;  3FB5 C;  3IFM A;  1SO0 A;  4WFG A;  5B1B C;  2MK3 A;  1XMO O;  5JVD A;  4B7K A;  2OCC C;  4L87 A;  1H2L A;  1PM9 A;  5JH7 A;  5KHJ A;  2KLU A;  2PGD A;  3H1I J;  3BVH A;  3CC4 V;  1F9G A;  2A06 H;  2V7Q J;  4FIP C;  1BMF G;  4DW0 A;  3ZRW B;  1KQF B;  3PN1 A;  4I4T A;  2CTW A;  1G2C B;  1KIL A;  1JM0 A;  4NPF X;  3MDS A;  2HPC A;  1HN1 A;  1KZU B;  5LP6 B;  3TF5 A;  1Q8I A;  1YTF D;  1SQV E;  4UB8 E;  2QJP C;  4B08 A;  2UXB O;  5H6R A;  4JI6 B;  3X41 A;  5E79 Z;  2H3O A;  2PZS A;  2XOK G;  3LDE A;  3WU2 E;  3JD0 A;  3MWX A;  1VL2 A;  1ZL8 B;  1CP9 A;  3QO8 A;  1Q82 Q;  3CCV V;  1ZR4 A;  2P4V A;  3CSX A;  4QGP A;  3VQX A;  2DMX A;  4DV1 O;  1IVS A;  4JI7 O;  3N4X A;  3LOY A;  1N0N A;  1FPO A;  1SNZ A;  3A3Y B;  1NTZ H;  3ZHR A;  3B5N D;  3L74 G;  2EIL C;  3BA9 A;  3E7K A;  1BGY J;  3Q5P A;  4GUN A;  2G8Y A;  4N23 A;  3C8V A;  5CA1 B;  3RYI A;  1XMO B;  3AFL A;  3WA2 X;  3ZX6 A;  4C46 A;  1OMI A;  3RK2 B;  3WUV A;  2HYN A;  3L74 J;  5KHG A;  3JAL A;  3CWB D;  3DX4 A;  2ZVN B;  3M06 A;  2NPS C;  2WYI A;  2E75 D;  1N2D C;  3FAV A;  1VF6 A;  1V7V A;  1OJP A;  2XN0 A;  3AG3 B;  1FDI A;  1PZQ A;  1YQ4 C;  3L70 J;  4D6T E;  4PJ0 Z;  3PRJ A;  4JI2 B;  1N86 A;  4MTX A;  3LDD A;  2EIN C;  2OIG A;  4WFE A;  2YKO A;  1F4H A;  2Y0I A;  2K1E A;  3DDG A;  4PV1 B;  4H13 C;  3ZIA G;  1PS3 A;  1AV1 A;  1PPJ H;  3A24 A;  1NTZ E;  2JS3 A;  4FM1 A;  2K9Y A;  3N2G B;  3K9A A;  3MHV A;  1SQX E;  4NB5 A;  2QRX A;  3IN6 A;  2CGN A;  1AA0 A;  3G4S P;  1G1J A;  1J0N A;  3K5L A;  5APT A;  2DWE C;  3UCS C;  5APV A;  1YJN P;  4X62 O;  1Y47 A;  3RYH A;  1T3U A;  1JZ8 A;  3SWY A;  3LVT A;  2Q5Z A;  1HDJ A;  1MSD A;  3KG2 A;  1M57 C;  1H8A A;  1NTM D;  2A45 H;  1SES A;  1SER A;  2JO1 A;  2Z4E A;  3U0Z A;  1N7R A;  2EIN B;  4YHH B;  3BUP A;  1LF9 A;  1NAY A;  4HZ3 A;  4I2L C;  1KB9 I;  3JAM N;  2CFG A;  1RWF A;  1IXB A;  1US1 A;  2Q7C A;  2HTA A;  2LXB A;  1VQ7 P;  4DRX A;  1D7M A;  3QO7 A;  3N7N A;  4KP4 A;  3H1L E;  4MVM A;  5AW7 B;  3WB1 A;  1UI7 A;  1IK7 A;  2EAC A;  4PHZ A;  4X66 B;  1Y6X A;  3CD6 V;  3JD2 A;  3DX1 A;  3T0D A;  4PDR A;  1N0J A;  2XAJ A;  3MUD A;  1XI1 A;  3WU2 H;  1DD4 A;  2F7O A;  1K4D C;  4HNA A;  1K73 W;  3EQ2 A;  4UB6 E;  1JTH B;  1PKX A;  4U7N A;  1NTZ J;  2ZAE B;  1HR0 B;  4CH5 A;  2YEV B;  3JYC A;  1KOR A;  3L35 A;  2E5L O;  3V5B A;  1B04 A;  3CEI A;  3T1C A;  1Z56 A;  2FUQ A;  1E5W A;  3GG2 A;  1M5I A;  5LYJ A;  3T1Y B;  1SFC C;  3GF3 A;  3H1L G;  1JZ7 A;  1SQG A;  2BCC G;  4K0K B;  1M1K Q;  1VQL P;  1K5S A;  4DXW A;  1WMN A;  3L75 D;  4K3A A;  1QVG U;  4PD4 H;  3RL0 C;  3FXD A;  1D5A A;  3L72 J;  3VQY A;  5C8Y B;  1W0K G;  1NS4 A;  3E8G A;  2PI5 A;  3R2P A;  2M3B A;  3SPJ A;  4EFB A;  3CE2 A;  4HH2 A;  1TUB B;  3AE3 C;  5KLV J;  3JSV C;  3T2O A;  3A2F A;  1JA8 A;  2LP7 A;  5B1B B;  1GK9 A;  2AHY A;  2HG5 D;  4BIU A;  3EJP A;  3R66 A;  4JAU A;  3FYE B;  1FZC A;  4MSW C;  3BVX A;  1A02 F;  1GM7 A;  2X6B A;  4DV6 O;  4FK5 C;  5IY5 C;  1OCZ B;  1J2J B;  4U3F D;  2ZCE A;  1CPY A;  1J5E O;  2O01 J;  5A1A A;  4PJ0 E;  1H54 A;  1LF6 A;  1OJO A;  4EDF A;  2VQF B;  2W0F C;  4LF5 B;  3DC6 A;  5EK0 A;  4O4H B;  1P49 A;  3OW2 U;  5BY1 A;  1E1R G;  1RJO A;  3A0R A;  3A0B E;  1NTM E;  5IJ0 A;  1U96 A;  4AQY B;  4G2K A;  2K1A A;  1FAF A;  2Q9I A;  1QHT A;  3IAP A;  1VQ9 V;  4KFM A;  3SGI A;  1JYN A;  2FKW B;  4X20 A;  3DYP A;  2V7Q H;  4U3F G;  3IMH A;  1XMQ B;  1NS7 A;  4UVC A;  1AQT A;  2P1J A;  3BUB A;  3FKS G;  3JC2 2;  1SFC B;  3VMX A;  1F1S A;  1HNX B;  1CZQ A;  3DYO A;  5B66 E;  2FYU H;  2WSF J;  2IW5 A;  4UB6 H;  5K5G B;  1SF9 A;  2QSA A;  3E8H A;  3RL0 B;  1NU1 D;  4I55 A;  4X65 O;  5EBW C;  4GIF A;  4OVN F;  1K5Q A;  3E7J A;  2CIS A;  3NJV A;  2FYU G;  2R72 A;  4X88 A;  1R8E A;  1QR9 A;  4X9Q A;  1AVK A;  1NTM H;  1I94 O;  4K8X A;  1Y9B A;  2HFE D;  2WIT A;  5JJE B;  3H32 B;  1XNQ B;  3RFR A;  1SQB K;  2VS0 A;  4FM2 A;  3AG2 B;  3VYI A;  1A02 J;  1N7P A;  2W0X A;  2IU0 A;  4PDL A;  2KB7 P;  1K3E A;  2XZR A;  4OJZ A;  3TJT A;  4WF9 V;  1ENV A;  5JMD A;  2QG4 A;  4OGQ C;  3D3Q A;  2PF4 E;  4RAI A;  3O9O A;  1RFY A;  3HUS C;  4C7U A;  1KC8 Q;  5JJN B;  1LP1 A;  4DZO A;  5ITZ A;  1BE3 J;  3D50 A;  1XMQ O;  3E83 A;  2IYP A;  3FGA D;  2OTJ V;  1NJI W;  5B66 H;  4LFA O;  2WAM A;  1J1E B;  5EYP A;  1UG9 A;  1MFT A;  1SS1 A;  5E1Q A;  5EC2 C;  2Z5I A;  2ZXQ A;  1HNZ O;  3HE5 B;  2A3Q A;  1NO4 A;  1QLE D;  4KUM A;  4NR1 A;  4Z1V A;  1KIL C;  3EVK A;  3KHU A;  3K3W A;  1EDI A;  5J9P C;  2V1D A;  2B87 B;  3IR9 A;  3DDF A;  5A9G A;  2XNX A;  3T0A A;  1LNQ A;  4MTG A;  3DXR A;  2JJL A;  2PRR A;  3LSQ A;  1W3Y A;  1OCC B;  1YJW P;  3VD3 A;  2JKV A;  1K92 A;  2CPB A;  3MV0 1;  3A0B H;  3U1C A;  3H1H D;  5GON A;  4WBA A;  3I56 V;  3Q1M A;  4NYK A;  1WJZ A;  3K08 A;  3S3X A;  3BLB A;  1WN7 A;  5BMV A;  1PGQ A;  2CFK A;  1S5L X;  1SP4 A;  4OX9 O;  1RWC A;  1HM3 A;  1S0V A;  2KZI A;  3J80 N;  4ABM A;  3C3S A;  2XDJ A;  4R4M A;  1CEZ A;  1ROP A;  4FFB B;  1USE A;  5FPO A;  2EIJ C;  3A0H H;  2QWN B;  2OYH B;  2GTA A;  1WB7 A;  3CRA A;  3F7Y C;  3AG3 C;  3FX0 A;  3HB3 B;  4JYB A;  4X1I B;  2H88 C;  4H44 C;  3AK2 A;  3DEC A;  1BGY D;  1OCC C;  3MUY 1;  2CIQ A;  2UXN A;  5APS A;  1R6K A;  1YJ9 V;  1ZW0 A;  3RK3 C;  1JYW A;  4YXD C;  2A06 D;  1IVU A;  3RYF B;  1OW7 A;  5AW4 B;  3AMO A;  1S9K D;  2UXD B;  3BAA A;  3IC7 A;  2B9B A;  4GLX A;  3GLM A;  4D6T D;  1ZP0 C;  3D51 A;  1V54 B;  1Q6H A;  4I0X B;  3ECQ A;  3OS7 A;  3DX0 A;  2J59 M;  1S3J A;  2YIA A;  2GUZ A;  1K33 A;  4LF4 O;  3RVY A;  2CK3 H;  2YO2 A;  1F4A A;  2QIW A;  4R50 A;  4UVB A;  5CA0 A;  1VQ7 V;  2FL4 A;  3UO3 A;  4JPR A;  2ODM A;  3F7V C;  3AE8 C;  5AVT B;  1TUE B;  4FZ0 A;  1YJW V;  5KHH A;  3UO2 A;  4JI6 O;  3AG1 C;  2DJV A;  4O4J A;  3N2K A;  3EJS A;  4YHH O;  3CXH H;  4BIO A;  2Y0D A;  2ZNJ A;  1QX8 A;  3CI9 A;  1P84 H;  1N36 O;  1L7K A;  5CCH A;  3X3Z A;  4LF5 O;  4X1Y A;  3WMM 0;  3HKE B;  1L0N J;  4MS2 A;  2GHY A;  5GTI Z;  3M9Q A;  1A32 A;  4FVM A;  1SQP J;  1LUV A;  1NKN A;  4DR6 O;  4Z1M H;  2VWK A;  4IOI H;  3L72 E;  3VQV A;  3CX5 E;  2BSK B;  4A7P A;  3D4Z A;  1DEB A;  2ZIN A;  3S3W A;  2WVR A;  2N9B A;  2ZXE B;  1JCH A;  4J7K A;  3D70 A;  3P3P A;  3L73 D;  3CRM A;  4LF7 O;  3MUD C;  5FNV A;  3Q1N A;  1VF5 B;  1BCC D;  2EUL A;  1URF A;  2JJ1 G;  4R6Z A;  2POH A;  2IFN A;  3CS5 A;  2IJI A;  2ZM6 B;  3OB8 A;  1DGS A;  4AUW A;  3MTU E;  2QKA A;  1OVR A;  4KT0 J;  3JD4 A;  2NZ2 A;  4O2A B;  2IZ0 A;  5CB4 A;  1N33 B;  5F2V O;  3Q5S A;  4CS2 A;  4DRX B;  1MUU A;  5AW3 B;  2ZQM A;  1I8Q A;  3I55 P;  2Q0A A;  2YI8 A;  1JY2 N;  1AI6 A;  3JAR A;  3UT5 B;  1L0L G;  2Y0C A;  1H2M A;  3L74 H;  4U3J B;  2P7J A;  2UU9 O;  4H0L B;  4B7E A;  4JI3 O;  5LXT A;  3SWF A;  3CCV P;  1HMW A;  2YSU B;  4OGQ B;  2Q9L A;  1PGO A;  1YTZ I;  3EXA A;  3HTK B;  5JCO A;  5EC1 C;  1NWQ A;  4QJF B;  4W80 A;  2RKL A;  1R6T A;  2RQ6 A;  3CC7 V;  4FM0 A;  3L71 D;  1L2P A;  2CK3 G;  3E1I A;  1SKV A;  1JZ6 A;  3QFZ A;  1FZC C;  1FXK B;  4CC6 A;  2QJ1 A;  3G71 V;  1KFN A;  4BRY A;  4YJ3 B;  5TJH A;  5APX A;  1Q86 W;  3G3Z A;  1GL2 D;  3TGU J;  1JJ2 U;  5B66 Z;  2GV9 A;  2GBO A;  3AEI A;  2Y9Z A;  2ZIM A;  2DW4 A;  2OW7 A;  1Q6I A;  1BHA A;  3RBX A;  3K25 A;  1PP9 E;  1OCO C;  1RF1 B;  2DYS B;  1L0N K;  1GN4 A;  4U3F J;  2P58 A;  1NTM K;  1GM9 A;  4E2L A;  1DYU A;  1ZAU A;  2QTO A;  1HWY A;  1SQB J;  1BL8 A;  1MMU A;  4DR2 B;  1XOU A;  1Q90 D;  2CTP A;  4B3R B;  1OZ0 A;  5K1P A;  4PA3 A;  4G28 B;  1MSW D;  2WT7 B;  2A45 I;  4JYY A;  3CV5 A;  2R9I A;  3KCX A;  2FXO A;  1N7S D;  4XDL A;  3OJA B;  4CH6 A;  5LYJ B;  1T8Z A;  3JAT B;  1T2K C;  4JI5 O;  3RYI B;  5JJJ B;  3GHG A;  4I6M C;  3AE5 C;  1N34 B;  3B8E B;  4UB8 Z;  3ZJZ A;  1AB3 A;  3KYQ A;  1Q7Y Q;  2XHN A;  1HR0 O;  3QG0 A;  2UUC O;  2R3S A;  4BW9 A;  1Q7Y W;  4FFK A;  1EN6 A;  3OR6 C;  4PV1 D;  2WA4 A;  3CCL P;  1XHZ A;  3K5M A;  2ZYA A;  2M0B A;  4TT3 G;  1OW8 A;  4O2B B;  3AE4 C;  3APO A;  3M8A A;  4UV9 A;  2ZYG A;  4XA4 A;  3RL0 g;  3MI6 A;  2R70 A;  4KFF A;  1F7Y A;  1NGM B;  1G6U A;  3AEG C;  4JQ0 D;  1W59 A;  4TUY B;  4X64 O;  1L0L D;  3CP1 A;  4QIW F;  1VQ9 P;  1RWA A;  3OAA G;  5IYZ A;  2C0W A;  4HKZ H;  4LFC O;  2WOF A;  4DV0 B;  1JZ2 A;  3L72 G;  1AJQ A;  1LR1 A;  5LL6 Y;  2C9N Y;  3KN4 A;  3E86 A;  2WZ7 A;  2KG7 A;  1GMJ A;  3RN4 A;  1LWU A;  4RO0 A;  1FOS E;  3BCC H;  1NH4 A;  2NR5 A;  3OEE G;  1QCE A;  3B09 A;  1WT6 A;  5J2T A;  3H1J D;  3VDB A;  1ZV8 A;  1IO4 A;  3L75 E;  5KA6 A;  5AVS B;  4I4T B;  1G2C A;  2W27 A;  1Z5W A;  1N34 O;  4H13 D;  1GMG A;  1X1J A;  4PD4 F;  2JGD A;  4X8A A;  1X0T A;  2ZYD A;  5LP6 A;  3QNE A;  3M0D C;  4UUJ C;  1OFC X;  2YO3 A;  3Q5R A;  5AVX B;  1N8R Q;  4LBE C;  3O65 A;  1FFX A;  1TAE A;  4PA6 A;  3BVV A;  3S4C A;  1NVO A;  1EDJ A;  4BZG A;  1JY2 P;  3KDP B;  5AVR B;  1JZ4 A;  1M56 D;  2KKW A;  3I5D A;  2ARH A;  1LP1 B;  1FZA A;  1GU4 A;  1G4Y B;  1FZE A;  3PGB A;  3BEH A;  3FB8 C;  2WLL A;  2AEJ A;  2KIK A;  4MVR A;  2F66 C;  1NU1 J;  2LFS A;  2OCH A;  1GK6 A;  5LOV B;  1SQV D;  3HII A;  1RE4 C;  4L76 A;  3V2N A;  3T1H B;  2IBZ H;  5TIS Z;  4QPK A;  2IU3 A;  3P7K A;  2KLV A;  1UPG A;  3H1H J;  2CFL A;  3H25 A;  1AI5 A;  2CWV A;  2IX7 C;  3MZW B;  3H1K D;  4K35 A;  2WTY A;  1OJH A;  1I0H A;  4UCR A;  3OBA A;  5LHI A;  1PV0 A;  1MMM A;  2Y69 C;  1YIT V;  2FTK A;  1RM1 C;  4JZG A;  4DR3 B;  1D6U A;  4DUZ B;  3JCU E;  2QTS A;  1P4R A;  1VQN P;  2O01 N;  4DV1 B;  4JI7 B;  3ZCC A;  5IJ9 A;  3TDK A;  3NXS A;  3VD9 A;  1K7D A;  1VQO P;  1K4C C;  1Z2G A;  3EFF K;  1OZH A;  5IJ0 B;  2LW1 A;  3EJR A;  1YI2 V;  3R4Y A;  5CBF A;  1PGJ A;  1NOH A;  2A06 E;  2H8P D;  2ZVO B;  2JVD A;  1NAF A;  1JOC A;  1Y4M A;  3B5N B;  2ZR2 A;  1NKG A;  1KEC A;  1XTC C;  5AVZ B;  1EZV I;  3RSY A;  5E79 H;  1VQ5 P;  4GX5 A;  4JPZ B;  2LGQ A;  4JGS A;  4DV7 B;  3F5H A;  1EDL A;  3VBB A;  1I94 B;  2XUM A;  4MW3 A;  1RH5 B;  2FYN B;  4WY4 A;  1AFO A;  1V9P A;  1EZV E;  1VQP P;  2Y9Y A;  3NJX A;  1TQS A;  5CCH C;  1Y76 B;  2WW2 A;  3M91 A;  2KK7 A;  3ETE A;  1HNX O;  2WLI A;  2BCC H;  1H0T A;  1J1E C;  1GZL A;  4IIJ B;  2XAG A;  3T1H O;  2QJY C;  2WSC H;  5KJ7 A;  1M90 Q;  4BAY A;  3DX3 A;  2FYU J;  3OUF A;  4AQR D;  2UUC B;  2K9J B;  2OTL P;  4OX9 B;  3L70 D;  2OW6 A;  2BTO A;  1P7G A;  1GAX A;  1LJ2 A;  1BE3 G;  1UI8 A;  2L6L A;  1IQY A;  3VMZ A;  2O01 H;  3HKB B;  1YHQ V;  1MMY A;  5IWA B;  3H1L H;  3HI7 A;  4HBN A;  3SFE C;  2UWJ E;  1SQQ H;  3UIA A;  5H9C A;  1YI2 P;  4JTC B;  1THZ A;  1NSM A;  2QVA A;  3CCU V;  1XHX A;  2P22 C;  1U7M A;  3MD0 A;  3U11 A;  1L0N D;  2HR3 A;  5LOV A;  1Q2N A;  4DR4 B;  4TV9 B;  3QF7 A;  3JSN A;  1VIB A;  4LP8 A;  2V4H A;  3LW5 J;  3EHB B;  2BCC E;  1R5S A;  2R5D A;  2Y48 A;  4LH6 A;  3K79 A;  2Q7G A;  5BR8 B;  1S5L H;  2WSS G;  1R3K C;  2Y73 A;  3DYM A;  3K5B A;  3JAL B;  1KIL D;  3OMA B;  2CE4 A;  2IBZ D;  1FOS F;  2CG1 A;  2IH1 C;  3OMN B;  1VQ8 P;  5CA1 A;  4U3F E;  1SQV K;  1FXV A;  3N27 A;  4UCV A;  4CPG A;  4LFC B;  2Q1K A;  4WWI A;  4FLT A;  2GDS A;  3OW2 O;  2QEX V;  5JCO C;  1N7N A;  4W4L A;  1D5N A;  1KKC A;  2AEF A;  2K9P A;  1BSM A;  3H6P A;  4IL6 X;  2B9Z A;  3ABT A;  3FB6 C;  1S5H C;  4LWS B;  2OOV A;  3TGU G;  2ZFC A;  2ETN A;  4K0K O;  1KYO D;  4TV8 B;  2WDA A;  3SYQ A;  3ABU A;  3OFN G;  2DYR B;  4FNT A;  3T1Y O;  2F43 G;  2D2C D;  1NS0 A;  2YIB D;  3L9D A;  3ABL C;  3OMI B;  4RUF A;  1VQP V;  1HN0 A;  1JYV A;  1MG1 A;  5IYZ B;  2FUT A;  3MAQ A;  1FZC B;  1RWH A;  2EIJ B;  3JAK A;  1KMI Z;  2Q3I A;  4LFB O;  2YXL A;  5E1A C;  3VD4 A;  1EXI A;  4D7T A;  2XAF A;  1PIX A;  3QH9 A;  2UUA O;  2OAR A;  3I3B A;  1G8M A;  1IFP A;  1KQL A;  2WZS A;  1ZTE A;  3T0B A;  3T2P A;  1D6Y A;  3CD6 P;  2CWU A;  1IC2 A;  1GU5 A;  4WB4 A;  2H7H A;  2RMK B;  1KFM A;  1K1X A;  4MVS A;  2DW3 A;  3TET A;  1KYO H;  1HWW A;  1YIJ P;  2WCO A;  2M7W A;  1NTZ G;  2N9Y B;  1RM1 B;  1N36 B;  5LHH A;  1MA1 A;  2WSE J;  1M56 C; 
#chains in the Genus database with same CATH homology
 1EDL A;  4BXL A;  5DJT B;  2B87 A;  3EJS A;  1Y47 A;  1U7J A;  5K5G B;  3LVT A;  4HB1 A;  3DX2 A;  4ASW A;  2LXC B;  2B89 A;  1TQS A;  3FXE A;  1TQV A;  3BUP A;  1TQW A;  1LT1 A;  1HXK A;  3D4Y A;  5CBO A;  2M0B A;  5CBN A;  1H0T A;  1DEE G;  2LXB A;  4EYY Q;  3CZN A;  3DX3 A;  4IOI H;  2F7P A;  2KI7 B;  2OW6 A;  3D4Z A;  1EC5 A;  1QWU A;  5EFW B;  1QX1 A;  4HKZ H;  3DX1 A;  4GOD A;  1LP1 A;  2UWJ E;  1TQU A;  3D52 A;  2F7O A;  3D50 A;  2M5A B;  1HTY A;  4JBZ A;  1ZXG A;  2QVA A;  1U7M A;  3BUQ A;  2F1A A;  2HR3 A;  4ZNC A;  2ZAE B;  1Q2N A;  3BVW A;  1MFT A;  1SS1 A;  1OVR A;  1OVU A;  1BDD A;  2F1B A;  1X0T A;  1FC2 C;  3BVU A;  4NPF X;  1JM0 A;  4ASV A;  3BVV A;  5KBP A;  1NVO A;  1EDI A;  2WMM A;  1EDJ A;  2B87 B;  1QWN A;  2F18 A;  1TQT A;  3DDF A;  2KZJ A;  1BDC A;  1R34 A;  4K3A A;  2M5A A;  4NPE A;  3RGU A;  2I8D A;  3FXD A;  5DJU B;  2LR2 A;  1LP1 B;  4CPG A;  4ZMD A;  2B88 A;  2Q1K A;  4WWI A;  2KIK A;  3BVT A;  3EJQ A;  2JWD A;  3CZS A;  1R33 A;  2RKL A;  4HJG H;  3BLB A;  2FYV A;  1EDK A;  3EJP A;  3BUD A;  1JMB A;  1OVV A;  1O7D D;  3BVX A;  2KZI A;  3MZW B;  4K35 A;  2K3R A;  2WYH A;  3DX4 A;  2WYI A;  2OW7 A;  4NPD A;  2OTK E;  4GOF A;  3QWO C;  3EJT A;  4GOE A;  1ZW0 A;  4KJM A;  5C39 A;  3BUI A;  3S1K A;  2P58 A;  3EJR A;  2ALW A;  4MN4 C;  2KS1 B;  3DDG A;  2SPZ A;  2F7Q A;  3D51 A;  3DX0 A;  1PS3 A;  3ZDM A;  3EJU A;  1S3J A;  2F7R A;  1HWW A;  3CV5 A;  2KUB A;  3PH0 A;  2R44 A;  1H0T B;  3MHV A;  2QRX A;  3BUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...