1MN0A

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-xylose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 97
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mn0A00
1I8QA 1NSMA 1F1SA 3IAQA 3MUY1 2BRWA 2HTBA 1HN1A 1YQ2A 3T2PA 1JOVA 1JZ3A 3DYMA 3BGAA 1ULVA 1CB8A 1OJNA 1N7NA 1HM2A 1L7JA 1JZ4A 3T0DA 3VD4A 1F4HA 1LXMA 3NJXA 1MMZA 1MN0A 1JYXA 2BRVX 1NSSA 2E22A 3OBAA 1NSZA 2WW1A 2CIQA 1HN0A 1K1YA 1TXKA 1NS2A 4DUWA 3IMHA 1JYVA 4DUVA 1NSVA 3VD3A 2E24A 2JKPA 1N7QA 3Q1NA 2BRPA 4DUXA 1JZ6A 1LF6A 2X03A 3SEPA 4BZHA 3DCDA 1HMWA 1LF9A 1N7RA 1RWHA 4BZGA 1NS0A 1RW9A 1DP0A 3MV11 3DYOA 1HM3A 1JZ2A 1L7KA 1J0NA 2WVXA 1RWFA 3T2OA 3OB8A 1X1HA 2XHNA 3VDBA 4BZFA 1RWAA 1HMUA 1SNZA 2WZSA 3MUZ1 3J7HA 4BZEA 2WW2A 3T0BA 1X1JA 1C82A 1OJMA 2Q1FA 2WVYA 1X1IA 1YGAA 2JKEA 1LURA 2WVZA 2XSGA 4RNLA 2HTAA 3DECA 3CZJA 3IAPA 2ZQ0A 1Z45A 2JKAA 2ZXQA 3NREA 1J0MA 2WDAA 1RWGA 4AQ0A 4TTGA 5A1AA 5E1QA 1UG9A 1OJPA 3A24A 3NJVA 1JZ5A 3VD7A 1N7OA 3T0AA 1JYNA 1NKGA 1K1WA 3MV01 3OS7A 1MMYA 3DYPA 3VD5A 1K1XA 3T08A 3T2QA 1OJOA 1NSXA 3ECQA 1F9GA 1LXKA 1RWCA 3I3DA 3I3BA 2WCOA 2CIRA 1NSRA 1NSUA 1PX3A 2WVXB 1F4AA 1N7PA 3VDAA 2WW0A 3I3EA 2CISA 1EGUA 3T09A 3E1F1 3MWXA 1NS8A 1LOHA 1PX4A 1JZ8A 3WFAA 1NS7A 2WW3A 1JYWA 3VDCA 1W3YA 1SO0A 1MMXA 1NS4A 1JZ7A 2D73A 3K25A 3VD9A 1MMUA
chains in the Genus database with same CATH superfamily
1I8QA 3EJTA 2OW7A 3T0UA 2F7RA 1JOVA 3EJSA 1OJNA 3KN4A 1N7NA 4KFFA 3VD4A 1HTYA 1EKMA 1LXMA 1JYXA 3AFJA 3EJPA 2E22A 4EV5A 2ZL8A 2FYVA 3X3ZA 4DUWA 3IMHA 1NSVA 3VD3A 1WMOA 3HIGA 3RRSA 2ALWA 2CQTA 1UI8A 1QX1A 1SPUA 3X40A 4DUXA 2X03A 3SEPA 4BZHA 3DX1A 3X3XA 1HMWA 4KTPA 1N7RA 2CFKA 1RW9A 2BT3A 3QFZA 1HM3A 1L7KA 1US1A 3QG0A 1RKYA 4BZFA 1V7VA 1HMUA 1SNZA 4BTWA 2WW2A 2WVYA 1YGAA 3VSMA 1LURA 2WVZA 3WA3A 4RNLA 4MMHA 1IQYA 1Z45A 3S4DA 2WDAA 1RWGA 1IVUA 3VD7A 3BVXA 4KFEA 3CV5A 3SXXA 3OS7A 2WYIA 2C10A 1D6ZA 1NSXA 4OJZA 3DX4A 4FNSA 1F9GA 1LXKA 3D4YA 3S4AA 2WCOA 3NBBA 2CIRA 1NSUA 1F4AA 3VDAA 2CISA 1NS8A 1LOHA 2WOHA 2CQSA 1JZ8A 4EV2A 2D1WA 1NS7A 2F7QA 3VDCA 1QAKA 5KBPA 1W3YA 3D4ZA 4KTRA 3D51A 1IQXA 1LVNA 3ALAA 3VD9A 1MMUA 1NSMA 1QWUA 3MUY1 2CFLA 3DDGA 3W7TA 2F18A 2HTBA 3BUIA 1YQ2A 1JRQA 3T2PA 4FNQA 1TQUA 2EACA 5CA3A 4FNUA 2FUTA 1HM2A 1L7JA 1JZ4A 3NBJA 3MPHA 1RJOA 1F4HA 3NJXA 3BVTA 2BRVX 1NSSA 3OBAA 1UI7A 1NSZA 3EJUA 2CIQA 2OOVA 4BTXA 1W2ZA 4FNRA 2EABA 1DYUA 2E24A 2CFGA 3HI7A 1W6CA 2BRPA 2EAEA 2F7PA 4BZGA 3SX1A 2W0QA 2YFOA 3LVTA 1AV4A 3T2OA 1X1HA 2PNCA 3BUBA 2CG0A 1WMPA 1RWAA 3D52A 3DDFA 3J7HA 1W6GA 3PGBA 3T0BA 1QAFA 1OJMA 3K5TA 3S4BA 1X1IA 1W4NA 3BVUA 3DECA 3IAPA 2ZQ0A 2ZXQA 4TTGA 1UG9A 3NJVA 1IVVA 1N7OA 3T0AA 1IU7A 2CFDA 3BUQA 3X41A 3AMOA 1MMYA 3DYPA 3VD5A 1K1XA 3BS6A 2YFNA 3ECQA 3LOYA 1RWCA 3I3BA 2CWTA 2E2UA 2WW0A 2EADA 3T09A 3AFLA 2OQEC 4MMIA 3WA2X 4BTYA 1V7XA 1R33A 1SO0A 2OOVC 3ACTA 3D3IA 1KSIA 2WO0A 2RDYA 2F1AA 1HN1A 3W7UA 1QALA 3BGAA 1CB8A 3T0DA 2WGQA 4OK2A 3WVFA 3CZSA 3CZNA 2WW1A 1HN0A 1WMNA 1K1YA 1TXKA 1NS2A 4UFCA 4DUVA 2JKPA 1N7QA 2FUQA 1HWWA 3Q1NA 1LF6A 3DCDA 1SIHA 1D6YA 1LF9A 4OK4A 1O7DD 3DX2A 5JMDA 2XN2A 2OQEA 1J0NA 2WVXA 1RWFA 3OB8A 2XHNA 3BLBA 3VDBA 2WZSA 3MUZ1 1C82A 1H54A 2Q1FA 2HTAA 3CZJA 1J0MA 4AQ0A 1W7CA 5A1AA 1AVLA 1JYNA 1QWNA 1NKGA 2E2VA 1TU5A 3MV01 3T08A 1AVKA 1OJOA 2F7OA 1TQWA 5JMFA 3I3DA 2CFWA 3TY1A 1NSRA 1PX3A 1N7PA 3I3EA 4FNPA 3MI6A 2F1BA 1PS3A 3W7XA 1PX4A 1D6UA 3WFAA 3HIIA 3DX0A 2E2TA 4KFDA 3QDEA 1A2VA 1MMXA 1NS4A 2D73A 3K25A 3ACSA 3BVWA 1W5ZA 1F1SA 3IAQA 2BRWA 3WIQA 3N9HA 1JZ3A 3DYMA 1ULVA 1V7WA 2CWVA 3W7SA 3AMOB 1MMZA 1MN0A 1IVWA 3QFYA 3EJRA 3DX3A 1JYVA 1TQTA 4J5TA 1PU4A 3BVVA 1JZ6A 2CG1A 2WOFA 1RWHA 2WYHA 1NS0A 1DP0A 3MV11 2XN1A 3DYOA 1JZ2A 1TQVA 3KIIA 3BLCA 5GW7A 3X42A 3D50A 4BZEA 1TQSA 1HXKA 1X1JA 2Y73A 3X3YA 3E80A 2JKEA 1R34A 4K3AA 2XSGA 4FNTA 2JKAA 3NREA 4FNVA 1N9EA 4K35A 5E1QA 2YX9A 3BUPA 1OACA 1OJPA 3A24A 1JZ5A 3WIRA 1K1WA 2C11A 4NEIA 1IVXA 2CWUA 3T2QA 3EJQA 1SIIA 2XN0A 3BUDA 2WVXB 1EGUA 3W7WA 3E1F1 3MWXA 3A0OA 2Y74A 3VSNA 3RSYA 2WW3A 1JYWA 2OW6A 3S4CA 1JZ7A 3E7JA
chains in the Genus database with same CATH topology
1I8QA 1NSMA 1F1SA 3IAQA 3MUY1 2BRWA 2HTBA 1HN1A 1YQ2A 3T2PA 1JOVA 1JZ3A 3DYMA 3BGAA 1ULVA 1CB8A 1OJNA 1N7NA 2FUTA 1HM2A 1L7JA 1JZ4A 4OK2A 3T0DA 3VD4A 3WVFA 1F4HA 1LXMA 3NJXA 1MMZA 1MN0A 1JYXA 2BRVX 1NSSA 2E22A 3OBAA 1NSZA 2WW1A 2CIQA 1HN0A 1K1YA 1TXKA 1NS2A 4DUWA 3IMHA 1JYVA 4DUVA 1NSVA 3VD3A 2E24A 2JKPA 1N7QA 2FUQA 3Q1NA 4J5TA 2BRPA 4DUXA 1JZ6A 1LF6A 2X03A 3SEPA 4BZHA 3DCDA 1HMWA 1LF9A 4OK4A 1N7RA 1RWHA 4BZGA 1NS0A 1RW9A 1DP0A 3MV11 5JMDA 3DYOA 1HM3A 1JZ2A 1L7KA 1J0NA 2WVXA 1RWFA 3T2OA 3OB8A 1X1HA 2XHNA 3VDBA 4BZFA 3BLCA 1RWAA 1HMUA 1SNZA 2WZSA 3MUZ1 3J7HA 4BZEA 2WW2A 3T0BA 1X1JA 1C82A 1OJMA 2Q1FA 2WVYA 3K25A 1X1IA 3E80A 1YGAA 2JKEA 3VSMA 1LURA 2WVZA 2XSGA 4RNLA 2HTAA 3DECA 4MMHA 3CZJA 3IAPA 2ZQ0A 1Z45A 2JKAA 2ZXQA 3NREA 4FNVA 1J0MA 2WDAA 1RWGA 4AQ0A 4TTGA 5A1AA 5E1QA 1UG9A 1OJPA 3A24A 3NJVA 1JZ5A 3VD7A 1N7OA 3T0AA 1JYNA 1NKGA 1K1WA 3MV01 3OS7A 1MMYA 3DYPA 4NEIA 3VD5A 1K1XA 3BS6A 3T08A 3T2QA 1OJOA 1NSXA 3ECQA 4OJZA 5JMFA 1F9GA 1LXKA 1RWCA 3I3DA 3I3BA 2WCOA 2CIRA 1NSRA 1NSUA 1PX3A 2WVXB 1F4AA 1N7PA 3TY1A 3VDAA 2WW0A 3I3EA 2CISA 1EGUA 3T09A 3AFLA 3E1F1 3MWXA 3A0OA 1NS8A 1LOHA 4MMIA 1PX4A 1JZ8A 3WFAA 3VSNA 1NS7A 2WW3A 1JYWA 3VDCA 1W3YA 1SO0A 1MMXA 1NS4A 1JZ7A 2D73A 3E7JA 3VD9A 1MMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8Q A;  1NSM A;  1F1S A;  3IAQ A;  3MUY 1;  2BRW A;  2HTB A;  1HN1 A;  1YQ2 A;  3T2P A;  1JOV A;  1JZ3 A;  3DYM A;  3BGA A;  1ULV A;  1CB8 A;  1OJN A;  1N7N A;  1HM2 A;  1L7J A;  1JZ4 A;  3T0D A;  3VD4 A;  1F4H A;  1LXM A;  3NJX A;  1MMZ A;  1MN0 A;  1JYX A;  2BRV X;  1NSS A;  2E22 A;  3OBA A;  1NSZ A;  2WW1 A;  2CIQ A;  1HN0 A;  1K1Y A;  1TXK A;  1NS2 A;  4DUW A;  3IMH A;  1JYV A;  4DUV A;  1NSV A;  3VD3 A;  2E24 A;  2JKP A;  1N7Q A;  3Q1N A;  2BRP A;  4DUX A;  1JZ6 A;  1LF6 A;  2X03 A;  3SEP A;  4BZH A;  3DCD A;  1HMW A;  1LF9 A;  1N7R A;  1RWH A;  4BZG A;  1NS0 A;  1RW9 A;  1DP0 A;  3MV1 1;  3DYO A;  1HM3 A;  1JZ2 A;  1L7K A;  1J0N A;  2WVX A;  1RWF A;  3T2O A;  3OB8 A;  1X1H A;  2XHN A;  3VDB A;  4BZF A;  1RWA A;  1HMU A;  1SNZ A;  2WZS A;  3MUZ 1;  3J7H A;  4BZE A;  2WW2 A;  3T0B A;  1X1J A;  1C82 A;  1OJM A;  2Q1F A;  2WVY A;  1X1I A;  1YGA A;  2JKE A;  1LUR A;  2WVZ A;  2XSG A;  4RNL A;  2HTA A;  3DEC A;  3CZJ A;  3IAP A;  2ZQ0 A;  1Z45 A;  2JKA A;  2ZXQ A;  3NRE A;  1J0M A;  2WDA A;  1RWG A;  4AQ0 A;  4TTG A;  5A1A A;  5E1Q A;  1UG9 A;  1OJP A;  3A24 A;  3NJV A;  1JZ5 A;  3VD7 A;  1N7O A;  3T0A A;  1JYN A;  1NKG A;  1K1W A;  3MV0 1;  3OS7 A;  1MMY A;  3DYP A;  3VD5 A;  1K1X A;  3T08 A;  3T2Q A;  1OJO A;  1NSX A;  3ECQ A;  1F9G A;  1LXK A;  1RWC A;  3I3D A;  3I3B A;  2WCO A;  2CIR A;  1NSR A;  1NSU A;  1PX3 A;  2WVX B;  1F4A A;  1N7P A;  3VDA A;  2WW0 A;  3I3E A;  2CIS A;  1EGU A;  3T09 A;  3E1F 1;  3MWX A;  1NS8 A;  1LOH A;  1PX4 A;  1JZ8 A;  3WFA A;  1NS7 A;  2WW3 A;  1JYW A;  3VDC A;  1W3Y A;  1SO0 A;  1MMX A;  1NS4 A;  1JZ7 A;  2D73 A;  3K25 A;  3VD9 A;  1MMU A; 
#chains in the Genus database with same CATH topology
 1I8Q A;  3EJT A;  2OW7 A;  3T0U A;  2F7R A;  1JOV A;  3EJS A;  1OJN A;  3KN4 A;  1N7N A;  4KFF A;  3VD4 A;  1HTY A;  1EKM A;  1LXM A;  1JYX A;  3AFJ A;  3EJP A;  2E22 A;  4EV5 A;  2ZL8 A;  2FYV A;  3X3Z A;  4DUW A;  3IMH A;  1NSV A;  3VD3 A;  1WMO A;  3HIG A;  3RRS A;  2ALW A;  2CQT A;  1UI8 A;  1QX1 A;  1SPU A;  3X40 A;  4DUX A;  2X03 A;  3SEP A;  4BZH A;  3DX1 A;  3X3X A;  1HMW A;  4KTP A;  1N7R A;  2CFK A;  1RW9 A;  2BT3 A;  3QFZ A;  1HM3 A;  1L7K A;  1US1 A;  3QG0 A;  1RKY A;  4BZF A;  1V7V A;  1HMU A;  1SNZ A;  4BTW A;  2WW2 A;  2WVY A;  1YGA A;  3VSM A;  1LUR A;  2WVZ A;  3WA3 A;  4RNL A;  4MMH A;  1IQY A;  1Z45 A;  3S4D A;  2WDA A;  1RWG A;  1IVU A;  3VD7 A;  3BVX A;  4KFE A;  3CV5 A;  3SXX A;  3OS7 A;  2WYI A;  2C10 A;  1D6Z A;  1NSX A;  4OJZ A;  3DX4 A;  4FNS A;  1F9G A;  1LXK A;  3D4Y A;  3S4A A;  2WCO A;  3NBB A;  2CIR A;  1NSU A;  1F4A A;  3VDA A;  2CIS A;  1NS8 A;  1LOH A;  2WOH A;  2CQS A;  1JZ8 A;  4EV2 A;  2D1W A;  1NS7 A;  2F7Q A;  3VDC A;  1QAK A;  5KBP A;  1W3Y A;  3D4Z A;  4KTR A;  3D51 A;  1IQX A;  1LVN A;  3ALA A;  3VD9 A;  1MMU A;  1NSM A;  1QWU A;  3MUY 1;  2CFL A;  3DDG A;  3W7T A;  2F18 A;  2HTB A;  3BUI A;  1YQ2 A;  1JRQ A;  3T2P A;  4FNQ A;  1TQU A;  2EAC A;  5CA3 A;  4FNU A;  2FUT A;  1HM2 A;  1L7J A;  1JZ4 A;  3NBJ A;  3MPH A;  1RJO A;  1F4H A;  3NJX A;  3BVT A;  2BRV X;  1NSS A;  3OBA A;  1UI7 A;  1NSZ A;  3EJU A;  2CIQ A;  2OOV A;  4BTX A;  1W2Z A;  4FNR A;  2EAB A;  1DYU A;  2E24 A;  2CFG A;  3HI7 A;  1W6C A;  2BRP A;  2EAE A;  2F7P A;  4BZG A;  3SX1 A;  2W0Q A;  2YFO A;  3LVT A;  1AV4 A;  3T2O A;  1X1H A;  2PNC A;  3BUB A;  2CG0 A;  1WMP A;  1RWA A;  3D52 A;  3DDF A;  3J7H A;  1W6G A;  3PGB A;  3T0B A;  1QAF A;  1OJM A;  3K5T A;  3S4B A;  1X1I A;  1W4N A;  3BVU A;  3DEC A;  3IAP A;  2ZQ0 A;  2ZXQ A;  4TTG A;  1UG9 A;  3NJV A;  1IVV A;  1N7O A;  3T0A A;  1IU7 A;  2CFD A;  3BUQ A;  3X41 A;  3AMO A;  1MMY A;  3DYP A;  3VD5 A;  1K1X A;  3BS6 A;  2YFN A;  3ECQ A;  3LOY A;  1RWC A;  3I3B A;  2CWT A;  2E2U A;  2WW0 A;  2EAD A;  3T09 A;  3AFL A;  2OQE C;  4MMI A;  3WA2 X;  4BTY A;  1V7X A;  1R33 A;  1SO0 A;  2OOV C;  3ACT A;  3D3I A;  1KSI A;  2WO0 A;  2RDY A;  2F1A A;  1HN1 A;  3W7U A;  1QAL A;  3BGA A;  1CB8 A;  3T0D A;  2WGQ A;  4OK2 A;  3WVF A;  3CZS A;  3CZN A;  2WW1 A;  1HN0 A;  1WMN A;  1K1Y A;  1TXK A;  1NS2 A;  4UFC A;  4DUV A;  2JKP A;  1N7Q A;  2FUQ A;  1HWW A;  3Q1N A;  1LF6 A;  3DCD A;  1SIH A;  1D6Y A;  1LF9 A;  4OK4 A;  1O7D D;  3DX2 A;  5JMD A;  2XN2 A;  2OQE A;  1J0N A;  2WVX A;  1RWF A;  3OB8 A;  2XHN A;  3BLB A;  3VDB A;  2WZS A;  3MUZ 1;  1C82 A;  1H54 A;  2Q1F A;  2HTA A;  3CZJ A;  1J0M A;  4AQ0 A;  1W7C A;  5A1A A;  1AVL A;  1JYN A;  1QWN A;  1NKG A;  2E2V A;  1TU5 A;  3MV0 1;  3T08 A;  1AVK A;  1OJO A;  2F7O A;  1TQW A;  5JMF A;  3I3D A;  2CFW A;  3TY1 A;  1NSR A;  1PX3 A;  1N7P A;  3I3E A;  4FNP A;  3MI6 A;  2F1B A;  1PS3 A;  3W7X A;  1PX4 A;  1D6U A;  3WFA A;  3HII A;  3DX0 A;  2E2T A;  4KFD A;  3QDE A;  1A2V A;  1MMX A;  1NS4 A;  2D73 A;  3K25 A;  3ACS A;  3BVW A;  1W5Z A;  1F1S A;  3IAQ A;  2BRW A;  3WIQ A;  3N9H A;  1JZ3 A;  3DYM A;  1ULV A;  1V7W A;  2CWV A;  3W7S A;  3AMO B;  1MMZ A;  1MN0 A;  1IVW A;  3QFY A;  3EJR A;  3DX3 A;  1JYV A;  1TQT A;  4J5T A;  1PU4 A;  3BVV A;  1JZ6 A;  2CG1 A;  2WOF A;  1RWH A;  2WYH A;  1NS0 A;  1DP0 A;  3MV1 1;  2XN1 A;  3DYO A;  1JZ2 A;  1TQV A;  3KII A;  3BLC A;  5GW7 A;  3X42 A;  3D50 A;  4BZE A;  1TQS A;  1HXK A;  1X1J A;  2Y73 A;  3X3Y A;  3E80 A;  2JKE A;  1R34 A;  4K3A A;  2XSG A;  4FNT A;  2JKA A;  3NRE A;  4FNV A;  1N9E A;  4K35 A;  5E1Q A;  2YX9 A;  3BUP A;  1OAC A;  1OJP A;  3A24 A;  1JZ5 A;  3WIR A;  1K1W A;  2C11 A;  4NEI A;  1IVX A;  2CWU A;  3T2Q A;  3EJQ A;  1SII A;  2XN0 A;  3BUD A;  2WVX B;  1EGU A;  3W7W A;  3E1F 1;  3MWX A;  3A0O A;  2Y74 A;  3VSN A;  3RSY A;  2WW3 A;  1JYW A;  2OW6 A;  3S4C A;  1JZ7 A;  3E7J A; 
#chains in the Genus database with same CATH homology
 1I8Q A;  1NSM A;  1F1S A;  3IAQ A;  3MUY 1;  2BRW A;  2HTB A;  1HN1 A;  1YQ2 A;  3T2P A;  1JOV A;  1JZ3 A;  3DYM A;  3BGA A;  1ULV A;  1CB8 A;  1OJN A;  1N7N A;  2FUT A;  1HM2 A;  1L7J A;  1JZ4 A;  4OK2 A;  3T0D A;  3VD4 A;  3WVF A;  1F4H A;  1LXM A;  3NJX A;  1MMZ A;  1MN0 A;  1JYX A;  2BRV X;  1NSS A;  2E22 A;  3OBA A;  1NSZ A;  2WW1 A;  2CIQ A;  1HN0 A;  1K1Y A;  1TXK A;  1NS2 A;  4DUW A;  3IMH A;  1JYV A;  4DUV A;  1NSV A;  3VD3 A;  2E24 A;  2JKP A;  1N7Q A;  2FUQ A;  3Q1N A;  4J5T A;  2BRP A;  4DUX A;  1JZ6 A;  1LF6 A;  2X03 A;  3SEP A;  4BZH A;  3DCD A;  1HMW A;  1LF9 A;  4OK4 A;  1N7R A;  1RWH A;  4BZG A;  1NS0 A;  1RW9 A;  1DP0 A;  3MV1 1;  5JMD A;  3DYO A;  1HM3 A;  1JZ2 A;  1L7K A;  1J0N A;  2WVX A;  1RWF A;  3T2O A;  3OB8 A;  1X1H A;  2XHN A;  3VDB A;  4BZF A;  3BLC A;  1RWA A;  1HMU A;  1SNZ A;  2WZS A;  3MUZ 1;  3J7H A;  4BZE A;  2WW2 A;  3T0B A;  1X1J A;  1C82 A;  1OJM A;  2Q1F A;  2WVY A;  3K25 A;  1X1I A;  3E80 A;  1YGA A;  2JKE A;  3VSM A;  1LUR A;  2WVZ A;  2XSG A;  4RNL A;  2HTA A;  3DEC A;  4MMH A;  3CZJ A;  3IAP A;  2ZQ0 A;  1Z45 A;  2JKA A;  2ZXQ A;  3NRE A;  4FNV A;  1J0M A;  2WDA A;  1RWG A;  4AQ0 A;  4TTG A;  5A1A A;  5E1Q A;  1UG9 A;  1OJP A;  3A24 A;  3NJV A;  1JZ5 A;  3VD7 A;  1N7O A;  3T0A A;  1JYN A;  1NKG A;  1K1W A;  3MV0 1;  3OS7 A;  1MMY A;  3DYP A;  4NEI A;  3VD5 A;  1K1X A;  3BS6 A;  3T08 A;  3T2Q A;  1OJO A;  1NSX A;  3ECQ A;  4OJZ A;  5JMF A;  1F9G A;  1LXK A;  1RWC A;  3I3D A;  3I3B A;  2WCO A;  2CIR A;  1NSR A;  1NSU A;  1PX3 A;  2WVX B;  1F4A A;  1N7P A;  3TY1 A;  3VDA A;  2WW0 A;  3I3E A;  2CIS A;  1EGU A;  3T09 A;  3AFL A;  3E1F 1;  3MWX A;  3A0O A;  1NS8 A;  1LOH A;  4MMI A;  1PX4 A;  1JZ8 A;  3WFA A;  3VSN A;  1NS7 A;  2WW3 A;  1JYW A;  3VDC A;  1W3Y A;  1SO0 A;  1MMX A;  1NS4 A;  1JZ7 A;  2D73 A;  3E7J A;  3VD9 A;  1MMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...