1MN0A

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-xylose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 97
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mn0A00
3OBAA 1J0MA 1K1WA 4TTGA 1HM3A 2WVZA 3DCDA 4BZFA 1JZ7A 3CZJA 3E1F1 3MV01 2CIRA 1HMUA 2BRWA 3IAQA 3NJXA 3Q1NA 3DYPA 1L7KA 3MV11 2D73A 1X1IA 1YQ2A 3T0BA 2WCOA 1JYXA 1NSXA 1PX3A 1SNZA 2WW1A 3OS7A 3VD9A 1JZ8A 2JKEA 1CB8A 1HM2A 1NS8A 1C82A 1JYNA 1RWHA 4BZEA 4BZHA 1N7OA 3T2OA 1W3YA 1DP0A 1MMYA 3A24A 3K25A 1TXKA 2WZSA 1JYVA 2CISA 1HN0A 3DYOA 3VD7A 2ZXQA 1F9GA 2HTAA 1UG9A 2WW3A 3NJVA 1NSMA 1SO0A 4RNLA 1RWCA 3VDAA 4DUWA 1OJMA 1PX4A 3BGAA 3VD5A 5A1AA 3WFAA 4DUVA 3I3EA 1NSUA 3ECQA 3OB8A 2E24A 1NSZA 1NSSA 1N7RA 1LOHA 2JKAA 2WVXB 1OJOA 2BRVX 2WVYA 1LURA 1MMXA 1F4AA 2E22A 1L7JA 1HMWA 1K1YA 1NKGA 1LXKA 3I3DA 4AQ0A 1LF6A 1NS4A 1JZ3A 1EGUA 3DYMA 2WW2A 3J7HA 3T2QA 1NSRA 1ULVA 1NS0A 1N7NA 2WDAA 2BRPA 3IMHA 1X1HA 1NSVA 3MWXA 3VDBA 1OJNA 1F1SA 1F4HA 1JOVA 3IAPA 1Z45A 1OJPA 3MUZ1 5E1QA 1MN0A 2WVXA 1RW9A 1I8QA 2CIQA 1JYWA 2X03A 1RWFA 1RWAA 2JKPA 1K1XA 1HN1A 1N7PA 1JZ4A 1N7QA 3VD4A 3I3BA 1JZ6A 3VD3A 3T0DA 2WW0A 2XHNA 3MUY1 1NS2A 1JZ2A 3T0AA 3SEPA 1X1JA 3NREA 1LXMA 1YGAA 2ZQ0A 1MMZA 3T2PA 4BZGA 1J0NA 2XSGA 1JZ5A 1MMUA 1NS7A 3VDCA 4DUXA 1LF9A 3T08A 3T09A 2HTBA 2Q1FA 1RWGA 3DECA
chains in the Genus database with same CATH superfamily
2OW6A 3OBAA 1K1WA 2WVZA 4BZFA 3E1F1 2CWUA 2CIRA 3BVTA 1HMUA 1TQUA 3DYPA 3D50A 3X3YA 2XN0A 1L7KA 4NEIA 3KN4A 3S4CA 2D73A 3NBBA 1A2VA 2FYVA 3QFZA 3OS7A 3VD9A 2CWVA 1HM2A 1NS8A 5CA3A 1HXKA 1JRQA 1N7OA 4K35A 1W3YA 5KBPA 1PU4A 1TQVA 3A24A 3DDGA 3DX4A 2WZSA 3S4AA 2C11A 4OJZA 2CFKA 2E2TA 2WGQA 3DYOA 3RSYA 2HTAA 1SO0A 1IQXA 3VDAA 2PNCA 1PX4A 3WFAA 1QWUA 3I3EA 3X41A 1NSSA 1OJOA 2E2UA 2WVYA 1TU5A 3X42A 1HMWA 4FNUA 1V7WA 1JZ3A 3DYMA 2CQSA 3J7HA 3T2QA 1N7NA 2BRPA 1NSVA 2F7PA 1F4HA 3IAPA 3BUDA 5E1QA 1MN0A 1RW9A 2CIQA 2CWTA 2FUQA 3ACTA 1RWFA 4OK2A 3DX1A 2WYIA 2Y73A 3S4BA 4MMIA 3T0DA 4KFFA 3N9HA 3SEPA 1MMZA 3BVWA 2XSGA 1JZ5A 1WMNA 2WOHA 3T08A 3T09A 3WA2X 2HTBA 2Q1FA 3DECA 1QAKA 3BUQA 5JMDA 1J0MA 2EABA 1HM3A 1JZ7A 3X3XA 4KTRA 3IAQA 3Q1NA 2YFOA 3TY1A 3AFLA 3DX2A 1YQ2A 2WCOA 1HWWA 1IU7A 2WW1A 1JZ8A 4KFDA 2JKEA 1IQYA 4K3AA 3T0UA 1CB8A 3SX1A 1JYNA 1RWHA 3T2OA 2OQEC 2ZL8A 1DP0A 1MMYA 3D4ZA 1TXKA 2F18A 1DYUA 1SIIA 3VD7A 3NBJA 1UG9A 2WW3A 3NJVA 1NSMA 3QG0A 1AVLA 2D1WA 3X3ZA 3BGAA 4BTYA 5GW7A 1W4NA 2E2VA 4DUVA 3EJUA 3W7TA 1RJOA 1NSZA 3BVXA 1RKYA 2WVXB 1O7DD 2CG0A 1MMXA 2E22A 1L7JA 3WIRA 1K1YA 3I3DA 4AQ0A 1UI7A 2WW2A 2WOFA 2C10A 4BTXA 2F7OA 3HIGA 1NS0A 3IMHA 1X1HA 3MWXA 3VDBA 3DX3A 2F1BA 1Z45A 3VSNA 2WVXA 4FNPA 3S4DA 5JMFA 1TQSA 3W7UA 1WMPA 1W2ZA 3EJQA 1HN1A 3D51A 1JZ4A 1N7QA 3QDEA 3VD3A 4EV2A 2WW0A 1NS2A 1EKMA 1HTYA 4FNQA 3T2PA 3WVFA 1NS7A 3W7WA 1QALA 1SIHA 2OOVC 3T0AA 3CZSA 3KIIA 1TQTA 4TTGA 3MV01 2EAEA 1PS3A 1V7VA 1X1IA 3T0BA 3WA3A 1SNZA 4FNVA 1D6ZA 3EJPA 2OW7A 3BUIA 2BT3A 3PGBA 3WIQA 2WYHA 3QFYA 4OK4A 1JYVA 3HIIA 2ZXQA 1F9GA 3EJRA 1D6YA 3AFJA 3LOYA 1RWCA 4DUWA 3E7JA 3VD5A 3K5TA 1LVNA 2E24A 1W6GA 2CFGA 1N7RA 1LOHA 2JKAA 3DX0A 1D6UA 1F4AA 3D52A 3EJSA 1NKGA 1LF6A 1NS4A 1W6CA 1NSRA 2WDAA 1IVXA 1V7XA 2WO0A 3MUZ1 1QX1A 2XN2A 3D4YA 2X03A 4J5TA 3W7SA 4FNSA 1R34A 1N7PA 2RDYA 4KFEA 1JZ6A 4EV5A 2XHNA 3MUY1 2XN1A 4FNTA 1X1JA 1W7CA 1J0NA 1MMUA 3BVUA 2EACA 1RWGA 3W7XA 3DDFA 4FNRA 3DCDA 3CZJA 2BRWA 3NJXA 2EADA 3MV11 4MMHA 2F7QA 2F7RA 1JYXA 1NSXA 1PX3A 3AMOB 3CZNA 3BVVA 3VSMA 2CG1A 3RRSA 3BLCA 2OQEA 1C82A 2CFWA 2W0QA 4BZEA 1AVKA 4KTPA 2FUTA 4BZHA 2ALWA 3ACSA 1UI8A 3K25A 1US1A 4BTWA 2CISA 3MPHA 1HN0A 3AMOA 1IVUA 1W5ZA 1WMOA 4RNLA 2Y74A 3HI7A 1OJMA 2YFNA 2F1AA 3BUBA 5A1AA 1NSUA 3ECQA 3OB8A 2CFLA 1R33A 2CFDA 2BRVX 1LURA 3E80A 3MI6A 1LXKA 3D3IA 1TQWA 1EGUA 3BUPA 1ULVA 3LVTA 4UFCA 1OJNA 1F1SA 1JOVA 1OJPA 1IVWA 3BLBA 3CV5A 1QWNA 1I8QA 1JYWA 1RWAA 2JKPA 1K1XA 3EJTA 1N9EA 1IVVA 3X40A 3VD4A 3I3BA 1KSIA 1QAFA 3BS6A 1JZ2A 3NREA 1LXMA 1YGAA 2ZQ0A 3SXXA 2CQTA 4BZGA 1H54A 1SPUA 2OOVA 3A0OA 3VDCA 4DUXA 1LF9A 2YX9A 1AV4A 1OACA 3ALAA
chains in the Genus database with same CATH topology
3OBAA 1J0MA 1K1WA 4TTGA 1HM3A 2WVZA 3DCDA 4BZFA 1JZ7A 3CZJA 3E1F1 3MV01 2CIRA 1HMUA 2BRWA 3IAQA 3NJXA 3Q1NA 3TY1A 3DYPA 3AFLA 1L7KA 3MV11 4NEIA 2D73A 4MMHA 1X1IA 1YQ2A 3T0BA 2WCOA 1JYXA 1NSXA 1PX3A 1SNZA 4FNVA 2WW1A 3VSMA 3OS7A 3VD9A 1JZ8A 2JKEA 3BLCA 1CB8A 1HM2A 1NS8A 1C82A 1JYNA 1RWHA 4BZEA 4BZHA 1N7OA 2FUTA 3T2OA 1W3YA 1DP0A 1MMYA 3A24A 3K25A 1TXKA 4OK4A 2WZSA 4OJZA 1JYVA 2CISA 1HN0A 3DYOA 3VD7A 2ZXQA 1F9GA 2HTAA 1UG9A 2WW3A 3NJVA 1NSMA 1SO0A 4RNLA 1RWCA 3VDAA 4DUWA 1OJMA 3E7JA 1PX4A 3BGAA 3VD5A 5A1AA 3WFAA 4DUVA 3I3EA 1NSUA 3ECQA 3OB8A 2E24A 1NSZA 1NSSA 1N7RA 1LOHA 2JKAA 2WVXB 1OJOA 2BRVX 2WVYA 1LURA 1MMXA 1F4AA 2E22A 3E80A 1L7JA 1HMWA 1K1YA 1NKGA 1LXKA 3I3DA 4AQ0A 1LF6A 1NS4A 1JZ3A 1EGUA 3DYMA 2WW2A 3J7HA 3T2QA 1NSRA 1ULVA 1NS0A 1N7NA 2WDAA 2BRPA 3IMHA 1X1HA 1NSVA 3MWXA 3VDBA 1OJNA 1F1SA 1F4HA 1JOVA 3IAPA 1Z45A 1OJPA 3VSNA 3MUZ1 5E1QA 1MN0A 2WVXA 1RW9A 1I8QA 2CIQA 5JMFA 2FUQA 1JYWA 2X03A 1RWFA 1RWAA 2JKPA 1K1XA 1HN1A 4J5TA 4OK2A 1N7PA 1JZ4A 1N7QA 3VD4A 3I3BA 1JZ6A 3VD3A 4MMIA 3T0DA 3BS6A 2WW0A 2XHNA 3MUY1 1NS2A 1JZ2A 3T0AA 3SEPA 1X1JA 3NREA 1LXMA 1YGAA 2ZQ0A 1MMZA 3T2PA 4BZGA 1J0NA 2XSGA 1JZ5A 1MMUA 3WVFA 1NS7A 3A0OA 3VDCA 4DUXA 1LF9A 3T08A 3T09A 2HTBA 2Q1FA 1RWGA 3DECA 5JMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBA A;  1J0M A;  1K1W A;  4TTG A;  1HM3 A;  2WVZ A;  3DCD A;  4BZF A;  1JZ7 A;  3CZJ A;  3E1F 1;  3MV0 1;  2CIR A;  1HMU A;  2BRW A;  3IAQ A;  3NJX A;  3Q1N A;  3DYP A;  1L7K A;  3MV1 1;  2D73 A;  1X1I A;  1YQ2 A;  3T0B A;  2WCO A;  1JYX A;  1NSX A;  1PX3 A;  1SNZ A;  2WW1 A;  3OS7 A;  3VD9 A;  1JZ8 A;  2JKE A;  1CB8 A;  1HM2 A;  1NS8 A;  1C82 A;  1JYN A;  1RWH A;  4BZE A;  4BZH A;  1N7O A;  3T2O A;  1W3Y A;  1DP0 A;  1MMY A;  3A24 A;  3K25 A;  1TXK A;  2WZS A;  1JYV A;  2CIS A;  1HN0 A;  3DYO A;  3VD7 A;  2ZXQ A;  1F9G A;  2HTA A;  1UG9 A;  2WW3 A;  3NJV A;  1NSM A;  1SO0 A;  4RNL A;  1RWC A;  3VDA A;  4DUW A;  1OJM A;  1PX4 A;  3BGA A;  3VD5 A;  5A1A A;  3WFA A;  4DUV A;  3I3E A;  1NSU A;  3ECQ A;  3OB8 A;  2E24 A;  1NSZ A;  1NSS A;  1N7R A;  1LOH A;  2JKA A;  2WVX B;  1OJO A;  2BRV X;  2WVY A;  1LUR A;  1MMX A;  1F4A A;  2E22 A;  1L7J A;  1HMW A;  1K1Y A;  1NKG A;  1LXK A;  3I3D A;  4AQ0 A;  1LF6 A;  1NS4 A;  1JZ3 A;  1EGU A;  3DYM A;  2WW2 A;  3J7H A;  3T2Q A;  1NSR A;  1ULV A;  1NS0 A;  1N7N A;  2WDA A;  2BRP A;  3IMH A;  1X1H A;  1NSV A;  3MWX A;  3VDB A;  1OJN A;  1F1S A;  1F4H A;  1JOV A;  3IAP A;  1Z45 A;  1OJP A;  3MUZ 1;  5E1Q A;  1MN0 A;  2WVX A;  1RW9 A;  1I8Q A;  2CIQ A;  1JYW A;  2X03 A;  1RWF A;  1RWA A;  2JKP A;  1K1X A;  1HN1 A;  1N7P A;  1JZ4 A;  1N7Q A;  3VD4 A;  3I3B A;  1JZ6 A;  3VD3 A;  3T0D A;  2WW0 A;  2XHN A;  3MUY 1;  1NS2 A;  1JZ2 A;  3T0A A;  3SEP A;  1X1J A;  3NRE A;  1LXM A;  1YGA A;  2ZQ0 A;  1MMZ A;  3T2P A;  4BZG A;  1J0N A;  2XSG A;  1JZ5 A;  1MMU A;  1NS7 A;  3VDC A;  4DUX A;  1LF9 A;  3T08 A;  3T09 A;  2HTB A;  2Q1F A;  1RWG A;  3DEC A; 
#chains in the Genus database with same CATH topology
 2OW6 A;  3OBA A;  1K1W A;  2WVZ A;  4BZF A;  3E1F 1;  2CWU A;  2CIR A;  3BVT A;  1HMU A;  1TQU A;  3DYP A;  3D50 A;  3X3Y A;  2XN0 A;  1L7K A;  4NEI A;  3KN4 A;  3S4C A;  2D73 A;  3NBB A;  1A2V A;  2FYV A;  3QFZ A;  3OS7 A;  3VD9 A;  2CWV A;  1HM2 A;  1NS8 A;  5CA3 A;  1HXK A;  1JRQ A;  1N7O A;  4K35 A;  1W3Y A;  5KBP A;  1PU4 A;  1TQV A;  3A24 A;  3DDG A;  3DX4 A;  2WZS A;  3S4A A;  2C11 A;  4OJZ A;  2CFK A;  2E2T A;  2WGQ A;  3DYO A;  3RSY A;  2HTA A;  1SO0 A;  1IQX A;  3VDA A;  2PNC A;  1PX4 A;  3WFA A;  1QWU A;  3I3E A;  3X41 A;  1NSS A;  1OJO A;  2E2U A;  2WVY A;  1TU5 A;  3X42 A;  1HMW A;  4FNU A;  1V7W A;  1JZ3 A;  3DYM A;  2CQS A;  3J7H A;  3T2Q A;  1N7N A;  2BRP A;  1NSV A;  2F7P A;  1F4H A;  3IAP A;  3BUD A;  5E1Q A;  1MN0 A;  1RW9 A;  2CIQ A;  2CWT A;  2FUQ A;  3ACT A;  1RWF A;  4OK2 A;  3DX1 A;  2WYI A;  2Y73 A;  3S4B A;  4MMI A;  3T0D A;  4KFF A;  3N9H A;  3SEP A;  1MMZ A;  3BVW A;  2XSG A;  1JZ5 A;  1WMN A;  2WOH A;  3T08 A;  3T09 A;  3WA2 X;  2HTB A;  2Q1F A;  3DEC A;  1QAK A;  3BUQ A;  5JMD A;  1J0M A;  2EAB A;  1HM3 A;  1JZ7 A;  3X3X A;  4KTR A;  3IAQ A;  3Q1N A;  2YFO A;  3TY1 A;  3AFL A;  3DX2 A;  1YQ2 A;  2WCO A;  1HWW A;  1IU7 A;  2WW1 A;  1JZ8 A;  4KFD A;  2JKE A;  1IQY A;  4K3A A;  3T0U A;  1CB8 A;  3SX1 A;  1JYN A;  1RWH A;  3T2O A;  2OQE C;  2ZL8 A;  1DP0 A;  1MMY A;  3D4Z A;  1TXK A;  2F18 A;  1DYU A;  1SII A;  3VD7 A;  3NBJ A;  1UG9 A;  2WW3 A;  3NJV A;  1NSM A;  3QG0 A;  1AVL A;  2D1W A;  3X3Z A;  3BGA A;  4BTY A;  5GW7 A;  1W4N A;  2E2V A;  4DUV A;  3EJU A;  3W7T A;  1RJO A;  1NSZ A;  3BVX A;  1RKY A;  2WVX B;  1O7D D;  2CG0 A;  1MMX A;  2E22 A;  1L7J A;  3WIR A;  1K1Y A;  3I3D A;  4AQ0 A;  1UI7 A;  2WW2 A;  2WOF A;  2C10 A;  4BTX A;  2F7O A;  3HIG A;  1NS0 A;  3IMH A;  1X1H A;  3MWX A;  3VDB A;  3DX3 A;  2F1B A;  1Z45 A;  3VSN A;  2WVX A;  4FNP A;  3S4D A;  5JMF A;  1TQS A;  3W7U A;  1WMP A;  1W2Z A;  3EJQ A;  1HN1 A;  3D51 A;  1JZ4 A;  1N7Q A;  3QDE A;  3VD3 A;  4EV2 A;  2WW0 A;  1NS2 A;  1EKM A;  1HTY A;  4FNQ A;  3T2P A;  3WVF A;  1NS7 A;  3W7W A;  1QAL A;  1SIH A;  2OOV C;  3T0A A;  3CZS A;  3KII A;  1TQT A;  4TTG A;  3MV0 1;  2EAE A;  1PS3 A;  1V7V A;  1X1I A;  3T0B A;  3WA3 A;  1SNZ A;  4FNV A;  1D6Z A;  3EJP A;  2OW7 A;  3BUI A;  2BT3 A;  3PGB A;  3WIQ A;  2WYH A;  3QFY A;  4OK4 A;  1JYV A;  3HII A;  2ZXQ A;  1F9G A;  3EJR A;  1D6Y A;  3AFJ A;  3LOY A;  1RWC A;  4DUW A;  3E7J A;  3VD5 A;  3K5T A;  1LVN A;  2E24 A;  1W6G A;  2CFG A;  1N7R A;  1LOH A;  2JKA A;  3DX0 A;  1D6U A;  1F4A A;  3D52 A;  3EJS A;  1NKG A;  1LF6 A;  1NS4 A;  1W6C A;  1NSR A;  2WDA A;  1IVX A;  1V7X A;  2WO0 A;  3MUZ 1;  1QX1 A;  2XN2 A;  3D4Y A;  2X03 A;  4J5T A;  3W7S A;  4FNS A;  1R34 A;  1N7P A;  2RDY A;  4KFE A;  1JZ6 A;  4EV5 A;  2XHN A;  3MUY 1;  2XN1 A;  4FNT A;  1X1J A;  1W7C A;  1J0N A;  1MMU A;  3BVU A;  2EAC A;  1RWG A;  3W7X A;  3DDF A;  4FNR A;  3DCD A;  3CZJ A;  2BRW A;  3NJX A;  2EAD A;  3MV1 1;  4MMH A;  2F7Q A;  2F7R A;  1JYX A;  1NSX A;  1PX3 A;  3AMO B;  3CZN A;  3BVV A;  3VSM A;  2CG1 A;  3RRS A;  3BLC A;  2OQE A;  1C82 A;  2CFW A;  2W0Q A;  4BZE A;  1AVK A;  4KTP A;  2FUT A;  4BZH A;  2ALW A;  3ACS A;  1UI8 A;  3K25 A;  1US1 A;  4BTW A;  2CIS A;  3MPH A;  1HN0 A;  3AMO A;  1IVU A;  1W5Z A;  1WMO A;  4RNL A;  2Y74 A;  3HI7 A;  1OJM A;  2YFN A;  2F1A A;  3BUB A;  5A1A A;  1NSU A;  3ECQ A;  3OB8 A;  2CFL A;  1R33 A;  2CFD A;  2BRV X;  1LUR A;  3E80 A;  3MI6 A;  1LXK A;  3D3I A;  1TQW A;  1EGU A;  3BUP A;  1ULV A;  3LVT A;  4UFC A;  1OJN A;  1F1S A;  1JOV A;  1OJP A;  1IVW A;  3BLB A;  3CV5 A;  1QWN A;  1I8Q A;  1JYW A;  1RWA A;  2JKP A;  1K1X A;  3EJT A;  1N9E A;  1IVV A;  3X40 A;  3VD4 A;  3I3B A;  1KSI A;  1QAF A;  3BS6 A;  1JZ2 A;  3NRE A;  1LXM A;  1YGA A;  2ZQ0 A;  3SXX A;  2CQT A;  4BZG A;  1H54 A;  1SPU A;  2OOV A;  3A0O A;  3VDC A;  4DUX A;  1LF9 A;  2YX9 A;  1AV4 A;  1OAC A;  3ALA A; 
#chains in the Genus database with same CATH homology
 3OBA A;  1J0M A;  1K1W A;  4TTG A;  1HM3 A;  2WVZ A;  3DCD A;  4BZF A;  1JZ7 A;  3CZJ A;  3E1F 1;  3MV0 1;  2CIR A;  1HMU A;  2BRW A;  3IAQ A;  3NJX A;  3Q1N A;  3TY1 A;  3DYP A;  3AFL A;  1L7K A;  3MV1 1;  4NEI A;  2D73 A;  4MMH A;  1X1I A;  1YQ2 A;  3T0B A;  2WCO A;  1JYX A;  1NSX A;  1PX3 A;  1SNZ A;  4FNV A;  2WW1 A;  3VSM A;  3OS7 A;  3VD9 A;  1JZ8 A;  2JKE A;  3BLC A;  1CB8 A;  1HM2 A;  1NS8 A;  1C82 A;  1JYN A;  1RWH A;  4BZE A;  4BZH A;  1N7O A;  2FUT A;  3T2O A;  1W3Y A;  1DP0 A;  1MMY A;  3A24 A;  3K25 A;  1TXK A;  4OK4 A;  2WZS A;  4OJZ A;  1JYV A;  2CIS A;  1HN0 A;  3DYO A;  3VD7 A;  2ZXQ A;  1F9G A;  2HTA A;  1UG9 A;  2WW3 A;  3NJV A;  1NSM A;  1SO0 A;  4RNL A;  1RWC A;  3VDA A;  4DUW A;  1OJM A;  3E7J A;  1PX4 A;  3BGA A;  3VD5 A;  5A1A A;  3WFA A;  4DUV A;  3I3E A;  1NSU A;  3ECQ A;  3OB8 A;  2E24 A;  1NSZ A;  1NSS A;  1N7R A;  1LOH A;  2JKA A;  2WVX B;  1OJO A;  2BRV X;  2WVY A;  1LUR A;  1MMX A;  1F4A A;  2E22 A;  3E80 A;  1L7J A;  1HMW A;  1K1Y A;  1NKG A;  1LXK A;  3I3D A;  4AQ0 A;  1LF6 A;  1NS4 A;  1JZ3 A;  1EGU A;  3DYM A;  2WW2 A;  3J7H A;  3T2Q A;  1NSR A;  1ULV A;  1NS0 A;  1N7N A;  2WDA A;  2BRP A;  3IMH A;  1X1H A;  1NSV A;  3MWX A;  3VDB A;  1OJN A;  1F1S A;  1F4H A;  1JOV A;  3IAP A;  1Z45 A;  1OJP A;  3VSN A;  3MUZ 1;  5E1Q A;  1MN0 A;  2WVX A;  1RW9 A;  1I8Q A;  2CIQ A;  5JMF A;  2FUQ A;  1JYW A;  2X03 A;  1RWF A;  1RWA A;  2JKP A;  1K1X A;  1HN1 A;  4J5T A;  4OK2 A;  1N7P A;  1JZ4 A;  1N7Q A;  3VD4 A;  3I3B A;  1JZ6 A;  3VD3 A;  4MMI A;  3T0D A;  3BS6 A;  2WW0 A;  2XHN A;  3MUY 1;  1NS2 A;  1JZ2 A;  3T0A A;  3SEP A;  1X1J A;  3NRE A;  1LXM A;  1YGA A;  2ZQ0 A;  1MMZ A;  3T2P A;  4BZG A;  1J0N A;  2XSG A;  1JZ5 A;  1MMU A;  3WVF A;  1NS7 A;  3A0O A;  3VDC A;  4DUX A;  1LF9 A;  3T08 A;  3T09 A;  2HTB A;  2Q1F A;  1RWG A;  3DEC A;  5JMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...