1MN0A

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-xylose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 97
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mn0A00
1F9GA 3VDCA 2HTBA 1NSRA 1J0NA 2X03A 3DYPA 3T08A 1HM2A 2WW0A 4BZGA 1K1WA 1HN1A 1X1JA 3VD3A 1NSVA 1RWHA 3IMHA 1HMWA 3VDBA 3SEPA 1N7NA 1F4AA 1LXKA 1SO0A 2WW3A 2HTAA 1JZ7A 1C82A 2WVYA 1MMZA 1ULVA 1W3YA 2JKAA 3CZJA 1X1HA 3VD4A 1HN0A 2E24A 1UG9A 2ZQ0A 1MN0A 1EGUA 3MV01 1JOVA 3ECQA 4BZEA 1NS7A 1JYVA 1JZ8A 2WVXA 3NJXA 4DUWA 1I8QA 2WVZA 1K1XA 1NSUA 2WZSA 1MMUA 1NSMA 3I3DA 1K1YA 1L7JA 3VD9A 1LF9A 3BGAA 4AQ0A 2XSGA 2BRVX 4BZHA 1NS4A 1JYWA 2CISA 1RWGA 3I3EA 3T2OA 1NS8A 1LOHA 3VD7A 1MMYA 3OB8A 1JZ6A 3T09A 1LXMA 3VD5A 2ZXQA 3NJVA 2JKPA 1LURA 3IAQA 4DUXA 1LF6A 1N7PA 2WDAA 2BRWA 3J7HA 3WFAA 1PX4A 1JZ4A 1J0MA 2JKEA 2Q1FA 4DUVA 4BZFA 1YQ2A 3OS7A 1N7QA 2D73A 3E1F1 3MUZ1 1N7OA 4TTGA 3I3BA 5A1AA 3MUY1 1OJMA 2WCOA 1F1SA 1JZ5A 1HM3A 3OBAA 3Q1NA 2BRPA 2WW2A 3MWXA 1JYNA 1DP0A 1NSSA 1OJOA 2XHNA 1TXKA 3DECA 1MMXA 3DYOA 1X1IA 3K25A 3MV11 3T0BA 2WW1A 1JZ3A 3A24A 2CIQA 3DCDA 1RWCA 1L7KA 1OJPA 1OJNA 2E22A 1JZ2A 1PX3A 1NS0A 1RW9A 3NREA 1NKGA 1HMUA 1RWFA 1NS2A 3DYMA 1SNZA 3IAPA 1F4HA 2WVXB 3VDAA 1RWAA 1YGAA 3T2QA 1N7RA 3T0AA 1NSXA 3T2PA 1JYXA 5E1QA 3T0DA 4RNLA 2CIRA 1NSZA 1Z45A 1CB8A
chains in the Genus database with same CATH superfamily
4FNQA 3VDCA 3AFLA 1NSRA 1J0NA 4EV2A 2CFGA 1D6ZA 1IVUA 3MPHA 1SIHA 2CQTA 1HN1A 2CG0A 4FNUA 4K35A 1NSVA 1RWHA 1IVXA 3ACTA 3ALAA 3QDEA 2XN0A 1F4AA 3LVTA 1JZ7A 2WYIA 1W3YA 3QG0A 3VD4A 3WA3A 2E2VA 4BZEA 2CFDA 3BLCA 1JZ8A 3NJXA 4DUWA 1I8QA 2WVZA 3W7TA 2WZSA 1AVLA 1NSMA 2CG1A 2CWVA 3VD9A 3DDGA 3BGAA 3RSYA 2OOVC 1RWGA 3T2OA 2W0QA 1LOHA 3T09A 4BTWA 2RDYA 1PU4A 2WDAA 3J7HA 3WFAA 1W7CA 2WOFA 2Q1FA 3BUBA 1HXKA 3WA2X 4BZFA 1YQ2A 3SXXA 2D73A 4OK4A 1N7OA 2C11A 1H54A 2FUTA 5A1AA 2E2TA 1F1SA 2EACA 1W5ZA 3W7WA 1JYNA 1DP0A 1NSSA 1OJOA 3WIRA 1MMXA 3K25A 4MMIA 4FNSA 3A24A 3CV5A 1OJPA 1OJNA 3AMOB 5KBPA 2OQEA 1PX3A 3W7SA 1TQWA 1D6UA 3DX3A 1NKGA 1HMUA 3NREA 3VSMA 5JMFA 3X3XA 2OOVA 3BVXA 2EABA 3BLBA 1V7WA 3N9HA 1IVWA 3T0DA 1W2ZA 3DX4A 1Z45A 2X03A 2C10A 3RRSA 3AMOA 3BUIA 1X1JA 3HIGA 1IVVA 3VDBA 1N7NA 1TQSA 3BUQA 2FYVA 1SO0A 2WW3A 2JKAA 2WO0A 3MV01 1EGUA 3BVUA 2OW6A 2EADA 4FNRA 3WVFA 3X3ZA 1NS7A 3E7JA 1QWNA 3D3IA 1WMOA 1NSUA 3NBJA 3CZNA 1K1YA 1LF9A 3BVVA 2XSGA 2BRVX 3EJPA 1JYWA 5CA3A 2F7RA 1NS8A 1MMYA 1LXMA 3X42A 1LF6A 2Y73A 3EJQA 3TY1A 4K3AA 4UFCA 2OQEC 1AV4A 1AVKA 1N7QA 2WOHA 4EV5A 1JRQA 2WGQA 1DYUA 1HM3A 3Q1NA 2WW2A 2YFNA 1TXKA 3DYOA 3T0BA 2WW1A 3W7UA 2CIQA 2F7QA 1W4NA 3KIIA 3WIQA 1NS0A 1OACA 1RWFA 2FUQA 3S4BA 1NS2A 1RJOA 3DYMA 3BVWA 3A0OA 3VDAA 2F7OA 4FNPA 2OW7A 1US1A 1N7RA 1NSXA 2ZL8A 3T2PA 3HI7A 1JYXA 1W6CA 2WYHA 2WVXB 2CWTA 1CB8A 3DYPA 1WMNA 4OK2A 1HM2A 1SPUA 4NEIA 4BZGA 1KSIA 3MI6A 3BS6A 3VD3A 1SIIA 3W7XA 1HMWA 2YFOA 4KFFA 2CWUA 4KTRA 3CZJA 2D1WA 1QX1A 1HN0A 2E24A 1MN0A 3QFZA 3AFJA 3D4ZA 2WVXA 3BVTA 2PNCA 3LOYA 1A2VA 2YX9A 2E2UA 1R34A 3D50A 3I3DA 1NS4A 2XN2A 3KN4A 1HTYA 3S4CA 1JZ6A 3EJTA 3VD5A 3NJVA 2JKPA 3IAQA 1O7DD 1TU5A 3T0UA 3S4AA 3DDFA 2BRWA 1JZ4A 1PX4A 5GW7A 4DUVA 3OS7A 3E80A 2WCOA 3OBAA 3MWXA 2BRPA 1V7XA 3ACSA 1W6GA 1JZ3A 3D4YA 1X1IA 3MV11 3NBBA 1TQUA 3DCDA 2Y74A 1L7KA 2CQSA 2E22A 3CZSA 3VSNA 2CFKA 1HWWA 1WMPA 3HIIA 1QWUA 1SNZA 3IAPA 1N9EA 2F7PA 3T2QA 3T0AA 3X40A 4RNLA 2CIRA 1RKYA 3DX2A 1F9GA 2HTBA 1UI7A 3T08A 3BUPA 1QALA 2WW0A 1K1WA 3EJSA 1LVNA 3IMHA 2ALWA 3SEPA 4MMHA 1LXKA 1TQVA 2HTAA 1C82A 2WVYA 1MMZA 1ULVA 3DX1A 1X1HA 3S4DA 1UG9A 2ZQ0A 1JOVA 3ECQA 3SX1A 5JMDA 1UI8A 1JYVA 2EAEA 1IQYA 2CFLA 1K1XA 1MMUA 1R33A 2F1BA 1L7JA 2F18A 4KFEA 4AQ0A 4BZHA 2CISA 3DX0A 3I3EA 4KFDA 2F1AA 3VD7A 3OB8A 3D51A 4OJZA 1D6YA 2XN1A 4J5TA 2ZXQA 1LURA 4DUXA 1N7PA 1J0MA 2JKEA 3QFYA 1PS3A 3D52A 3MUZ1 3E1F1 3EJRA 3PGBA 4TTGA 3I3BA 1QAKA 3MUY1 1OJMA 1JZ5A 3X3YA 4KTPA 2XHNA 3DECA 2BT3A 1RWCA 1QAFA 1JZ2A 3BUDA 3X41A 3EJUA 3K5TA 1RW9A 1EKMA 1F4HA 4BTYA 1IQXA 1IU7A 4FNTA 1TQTA 1RWAA 2CFWA 1YGAA 4FNVA 4BTXA 5E1QA 1V7VA 1NSZA
chains in the Genus database with same CATH topology
1F9GA 3VDCA 2HTBA 3AFLA 1NSRA 1J0NA 2X03A 3DYPA 4OK2A 3T08A 1HM2A 2WW0A 4NEIA 4BZGA 1K1WA 1HN1A 1X1JA 3BS6A 3VD3A 1NSVA 1RWHA 3IMHA 1HMWA 3VDBA 3SEPA 1N7NA 1F4AA 4MMHA 1LXKA 1SO0A 2WW3A 2HTAA 1JZ7A 1C82A 2WVYA 1MMZA 1ULVA 1W3YA 2JKAA 3CZJA 1X1HA 3VD4A 1HN0A 2E24A 1UG9A 2ZQ0A 1MN0A 1EGUA 3MV01 1JOVA 3ECQA 5JMDA 3WVFA 4BZEA 1NS7A 3E7JA 1JYVA 3BLCA 1JZ8A 2WVXA 3NJXA 4DUWA 1I8QA 2WVZA 1K1XA 1NSUA 2WZSA 1MMUA 1NSMA 3I3DA 1K1YA 1L7JA 3VD9A 1LF9A 3BGAA 4AQ0A 2XSGA 2BRVX 4BZHA 1NS4A 1JYWA 2CISA 1RWGA 3I3EA 3T2OA 1NS8A 1LOHA 3VD7A 1MMYA 3OB8A 4OJZA 1JZ6A 3T09A 1LXMA 4J5TA 3VD5A 2ZXQA 3NJVA 2JKPA 1LURA 3IAQA 4DUXA 1LF6A 1N7PA 2WDAA 3TY1A 2BRWA 3J7HA 3WFAA 1PX4A 1JZ4A 1J0MA 2JKEA 2Q1FA 4DUVA 4BZFA 1YQ2A 3OS7A 1N7QA 2D73A 3E80A 3E1F1 3MUZ1 4OK4A 1N7OA 4TTGA 2FUTA 3I3BA 5A1AA 3MUY1 1OJMA 2WCOA 1F1SA 1JZ5A 1HM3A 3OBAA 3Q1NA 2BRPA 2WW2A 3MWXA 1JYNA 1DP0A 1NSSA 1OJOA 2XHNA 1TXKA 3DECA 1MMXA 3DYOA 1X1IA 3K25A 3MV11 4MMIA 2WW1A 3T0BA 3A24A 2CIQA 3DCDA 1RWCA 1L7KA 1OJPA 1OJNA 2E22A 1JZ2A 1PX3A 3VSNA 1NS0A 1RW9A 3NREA 5JMFA 1NKGA 1HMUA 1RWFA 3VSMA 2FUQA 1NS2A 3DYMA 1SNZA 3IAPA 1F4HA 2WVXB 3A0OA 3VDAA 1RWAA 1JZ3A 1YGAA 3T2QA 4FNVA 1N7RA 3T0AA 1NSXA 3T2PA 1JYXA 5E1QA 3T0DA 4RNLA 2CIRA 1NSZA 1Z45A 1CB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9G A;  3VDC A;  2HTB A;  1NSR A;  1J0N A;  2X03 A;  3DYP A;  3T08 A;  1HM2 A;  2WW0 A;  4BZG A;  1K1W A;  1HN1 A;  1X1J A;  3VD3 A;  1NSV A;  1RWH A;  3IMH A;  1HMW A;  3VDB A;  3SEP A;  1N7N A;  1F4A A;  1LXK A;  1SO0 A;  2WW3 A;  2HTA A;  1JZ7 A;  1C82 A;  2WVY A;  1MMZ A;  1ULV A;  1W3Y A;  2JKA A;  3CZJ A;  1X1H A;  3VD4 A;  1HN0 A;  2E24 A;  1UG9 A;  2ZQ0 A;  1MN0 A;  1EGU A;  3MV0 1;  1JOV A;  3ECQ A;  4BZE A;  1NS7 A;  1JYV A;  1JZ8 A;  2WVX A;  3NJX A;  4DUW A;  1I8Q A;  2WVZ A;  1K1X A;  1NSU A;  2WZS A;  1MMU A;  1NSM A;  3I3D A;  1K1Y A;  1L7J A;  3VD9 A;  1LF9 A;  3BGA A;  4AQ0 A;  2XSG A;  2BRV X;  4BZH A;  1NS4 A;  1JYW A;  2CIS A;  1RWG A;  3I3E A;  3T2O A;  1NS8 A;  1LOH A;  3VD7 A;  1MMY A;  3OB8 A;  1JZ6 A;  3T09 A;  1LXM A;  3VD5 A;  2ZXQ A;  3NJV A;  2JKP A;  1LUR A;  3IAQ A;  4DUX A;  1LF6 A;  1N7P A;  2WDA A;  2BRW A;  3J7H A;  3WFA A;  1PX4 A;  1JZ4 A;  1J0M A;  2JKE A;  2Q1F A;  4DUV A;  4BZF A;  1YQ2 A;  3OS7 A;  1N7Q A;  2D73 A;  3E1F 1;  3MUZ 1;  1N7O A;  4TTG A;  3I3B A;  5A1A A;  3MUY 1;  1OJM A;  2WCO A;  1F1S A;  1JZ5 A;  1HM3 A;  3OBA A;  3Q1N A;  2BRP A;  2WW2 A;  3MWX A;  1JYN A;  1DP0 A;  1NSS A;  1OJO A;  2XHN A;  1TXK A;  3DEC A;  1MMX A;  3DYO A;  1X1I A;  3K25 A;  3MV1 1;  3T0B A;  2WW1 A;  1JZ3 A;  3A24 A;  2CIQ A;  3DCD A;  1RWC A;  1L7K A;  1OJP A;  1OJN A;  2E22 A;  1JZ2 A;  1PX3 A;  1NS0 A;  1RW9 A;  3NRE A;  1NKG A;  1HMU A;  1RWF A;  1NS2 A;  3DYM A;  1SNZ A;  3IAP A;  1F4H A;  2WVX B;  3VDA A;  1RWA A;  1YGA A;  3T2Q A;  1N7R A;  3T0A A;  1NSX A;  3T2P A;  1JYX A;  5E1Q A;  3T0D A;  4RNL A;  2CIR A;  1NSZ A;  1Z45 A;  1CB8 A; 
#chains in the Genus database with same CATH topology
 4FNQ A;  3VDC A;  3AFL A;  1NSR A;  1J0N A;  4EV2 A;  2CFG A;  1D6Z A;  1IVU A;  3MPH A;  1SIH A;  2CQT A;  1HN1 A;  2CG0 A;  4FNU A;  4K35 A;  1NSV A;  1RWH A;  1IVX A;  3ACT A;  3ALA A;  3QDE A;  2XN0 A;  1F4A A;  3LVT A;  1JZ7 A;  2WYI A;  1W3Y A;  3QG0 A;  3VD4 A;  3WA3 A;  2E2V A;  4BZE A;  2CFD A;  3BLC A;  1JZ8 A;  3NJX A;  4DUW A;  1I8Q A;  2WVZ A;  3W7T A;  2WZS A;  1AVL A;  1NSM A;  2CG1 A;  2CWV A;  3VD9 A;  3DDG A;  3BGA A;  3RSY A;  2OOV C;  1RWG A;  3T2O A;  2W0Q A;  1LOH A;  3T09 A;  4BTW A;  2RDY A;  1PU4 A;  2WDA A;  3J7H A;  3WFA A;  1W7C A;  2WOF A;  2Q1F A;  3BUB A;  1HXK A;  3WA2 X;  4BZF A;  1YQ2 A;  3SXX A;  2D73 A;  4OK4 A;  1N7O A;  2C11 A;  1H54 A;  2FUT A;  5A1A A;  2E2T A;  1F1S A;  2EAC A;  1W5Z A;  3W7W A;  1JYN A;  1DP0 A;  1NSS A;  1OJO A;  3WIR A;  1MMX A;  3K25 A;  4MMI A;  4FNS A;  3A24 A;  3CV5 A;  1OJP A;  1OJN A;  3AMO B;  5KBP A;  2OQE A;  1PX3 A;  3W7S A;  1TQW A;  1D6U A;  3DX3 A;  1NKG A;  1HMU A;  3NRE A;  3VSM A;  5JMF A;  3X3X A;  2OOV A;  3BVX A;  2EAB A;  3BLB A;  1V7W A;  3N9H A;  1IVW A;  3T0D A;  1W2Z A;  3DX4 A;  1Z45 A;  2X03 A;  2C10 A;  3RRS A;  3AMO A;  3BUI A;  1X1J A;  3HIG A;  1IVV A;  3VDB A;  1N7N A;  1TQS A;  3BUQ A;  2FYV A;  1SO0 A;  2WW3 A;  2JKA A;  2WO0 A;  3MV0 1;  1EGU A;  3BVU A;  2OW6 A;  2EAD A;  4FNR A;  3WVF A;  3X3Z A;  1NS7 A;  3E7J A;  1QWN A;  3D3I A;  1WMO A;  1NSU A;  3NBJ A;  3CZN A;  1K1Y A;  1LF9 A;  3BVV A;  2XSG A;  2BRV X;  3EJP A;  1JYW A;  5CA3 A;  2F7R A;  1NS8 A;  1MMY A;  1LXM A;  3X42 A;  1LF6 A;  2Y73 A;  3EJQ A;  3TY1 A;  4K3A A;  4UFC A;  2OQE C;  1AV4 A;  1AVK A;  1N7Q A;  2WOH A;  4EV5 A;  1JRQ A;  2WGQ A;  1DYU A;  1HM3 A;  3Q1N A;  2WW2 A;  2YFN A;  1TXK A;  3DYO A;  3T0B A;  2WW1 A;  3W7U A;  2CIQ A;  2F7Q A;  1W4N A;  3KII A;  3WIQ A;  1NS0 A;  1OAC A;  1RWF A;  2FUQ A;  3S4B A;  1NS2 A;  1RJO A;  3DYM A;  3BVW A;  3A0O A;  3VDA A;  2F7O A;  4FNP A;  2OW7 A;  1US1 A;  1N7R A;  1NSX A;  2ZL8 A;  3T2P A;  3HI7 A;  1JYX A;  1W6C A;  2WYH A;  2WVX B;  2CWT A;  1CB8 A;  3DYP A;  1WMN A;  4OK2 A;  1HM2 A;  1SPU A;  4NEI A;  4BZG A;  1KSI A;  3MI6 A;  3BS6 A;  3VD3 A;  1SII A;  3W7X A;  1HMW A;  2YFO A;  4KFF A;  2CWU A;  4KTR A;  3CZJ A;  2D1W A;  1QX1 A;  1HN0 A;  2E24 A;  1MN0 A;  3QFZ A;  3AFJ A;  3D4Z A;  2WVX A;  3BVT A;  2PNC A;  3LOY A;  1A2V A;  2YX9 A;  2E2U A;  1R34 A;  3D50 A;  3I3D A;  1NS4 A;  2XN2 A;  3KN4 A;  1HTY A;  3S4C A;  1JZ6 A;  3EJT A;  3VD5 A;  3NJV A;  2JKP A;  3IAQ A;  1O7D D;  1TU5 A;  3T0U A;  3S4A A;  3DDF A;  2BRW A;  1JZ4 A;  1PX4 A;  5GW7 A;  4DUV A;  3OS7 A;  3E80 A;  2WCO A;  3OBA A;  3MWX A;  2BRP A;  1V7X A;  3ACS A;  1W6G A;  1JZ3 A;  3D4Y A;  1X1I A;  3MV1 1;  3NBB A;  1TQU A;  3DCD A;  2Y74 A;  1L7K A;  2CQS A;  2E22 A;  3CZS A;  3VSN A;  2CFK A;  1HWW A;  1WMP A;  3HII A;  1QWU A;  1SNZ A;  3IAP A;  1N9E A;  2F7P A;  3T2Q A;  3T0A A;  3X40 A;  4RNL A;  2CIR A;  1RKY A;  3DX2 A;  1F9G A;  2HTB A;  1UI7 A;  3T08 A;  3BUP A;  1QAL A;  2WW0 A;  1K1W A;  3EJS A;  1LVN A;  3IMH A;  2ALW A;  3SEP A;  4MMH A;  1LXK A;  1TQV A;  2HTA A;  1C82 A;  2WVY A;  1MMZ A;  1ULV A;  3DX1 A;  1X1H A;  3S4D A;  1UG9 A;  2ZQ0 A;  1JOV A;  3ECQ A;  3SX1 A;  5JMD A;  1UI8 A;  1JYV A;  2EAE A;  1IQY A;  2CFL A;  1K1X A;  1MMU A;  1R33 A;  2F1B A;  1L7J A;  2F18 A;  4KFE A;  4AQ0 A;  4BZH A;  2CIS A;  3DX0 A;  3I3E A;  4KFD A;  2F1A A;  3VD7 A;  3OB8 A;  3D51 A;  4OJZ A;  1D6Y A;  2XN1 A;  4J5T A;  2ZXQ A;  1LUR A;  4DUX A;  1N7P A;  1J0M A;  2JKE A;  3QFY A;  1PS3 A;  3D52 A;  3MUZ 1;  3E1F 1;  3EJR A;  3PGB A;  4TTG A;  3I3B A;  1QAK A;  3MUY 1;  1OJM A;  1JZ5 A;  3X3Y A;  4KTP A;  2XHN A;  3DEC A;  2BT3 A;  1RWC A;  1QAF A;  1JZ2 A;  3BUD A;  3X41 A;  3EJU A;  3K5T A;  1RW9 A;  1EKM A;  1F4H A;  4BTY A;  1IQX A;  1IU7 A;  4FNT A;  1TQT A;  1RWA A;  2CFW A;  1YGA A;  4FNV A;  4BTX A;  5E1Q A;  1V7V A;  1NSZ A; 
#chains in the Genus database with same CATH homology
 1F9G A;  3VDC A;  2HTB A;  3AFL A;  1NSR A;  1J0N A;  2X03 A;  3DYP A;  4OK2 A;  3T08 A;  1HM2 A;  2WW0 A;  4NEI A;  4BZG A;  1K1W A;  1HN1 A;  1X1J A;  3BS6 A;  3VD3 A;  1NSV A;  1RWH A;  3IMH A;  1HMW A;  3VDB A;  3SEP A;  1N7N A;  1F4A A;  4MMH A;  1LXK A;  1SO0 A;  2WW3 A;  2HTA A;  1JZ7 A;  1C82 A;  2WVY A;  1MMZ A;  1ULV A;  1W3Y A;  2JKA A;  3CZJ A;  1X1H A;  3VD4 A;  1HN0 A;  2E24 A;  1UG9 A;  2ZQ0 A;  1MN0 A;  1EGU A;  3MV0 1;  1JOV A;  3ECQ A;  5JMD A;  3WVF A;  4BZE A;  1NS7 A;  3E7J A;  1JYV A;  3BLC A;  1JZ8 A;  2WVX A;  3NJX A;  4DUW A;  1I8Q A;  2WVZ A;  1K1X A;  1NSU A;  2WZS A;  1MMU A;  1NSM A;  3I3D A;  1K1Y A;  1L7J A;  3VD9 A;  1LF9 A;  3BGA A;  4AQ0 A;  2XSG A;  2BRV X;  4BZH A;  1NS4 A;  1JYW A;  2CIS A;  1RWG A;  3I3E A;  3T2O A;  1NS8 A;  1LOH A;  3VD7 A;  1MMY A;  3OB8 A;  4OJZ A;  1JZ6 A;  3T09 A;  1LXM A;  4J5T A;  3VD5 A;  2ZXQ A;  3NJV A;  2JKP A;  1LUR A;  3IAQ A;  4DUX A;  1LF6 A;  1N7P A;  2WDA A;  3TY1 A;  2BRW A;  3J7H A;  3WFA A;  1PX4 A;  1JZ4 A;  1J0M A;  2JKE A;  2Q1F A;  4DUV A;  4BZF A;  1YQ2 A;  3OS7 A;  1N7Q A;  2D73 A;  3E80 A;  3E1F 1;  3MUZ 1;  4OK4 A;  1N7O A;  4TTG A;  2FUT A;  3I3B A;  5A1A A;  3MUY 1;  1OJM A;  2WCO A;  1F1S A;  1JZ5 A;  1HM3 A;  3OBA A;  3Q1N A;  2BRP A;  2WW2 A;  3MWX A;  1JYN A;  1DP0 A;  1NSS A;  1OJO A;  2XHN A;  1TXK A;  3DEC A;  1MMX A;  3DYO A;  1X1I A;  3K25 A;  3MV1 1;  4MMI A;  2WW1 A;  3T0B A;  3A24 A;  2CIQ A;  3DCD A;  1RWC A;  1L7K A;  1OJP A;  1OJN A;  2E22 A;  1JZ2 A;  1PX3 A;  3VSN A;  1NS0 A;  1RW9 A;  3NRE A;  5JMF A;  1NKG A;  1HMU A;  1RWF A;  3VSM A;  2FUQ A;  1NS2 A;  3DYM A;  1SNZ A;  3IAP A;  1F4H A;  2WVX B;  3A0O A;  3VDA A;  1RWA A;  1JZ3 A;  1YGA A;  3T2Q A;  4FNV A;  1N7R A;  3T0A A;  1NSX A;  3T2P A;  1JYX A;  5E1Q A;  3T0D A;  4RNL A;  2CIR A;  1NSZ A;  1Z45 A;  1CB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...