1MN0A

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-xylose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 97
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mn0A00
1OJOA 1N7OA 1PX3A 3NJVA 1SNZA 1JOVA 1HMUA 3OBAA 1RWFA 4DUWA 1N7NA 1JZ5A 3MUZ1 3T08A 4DUVA 2JKPA 3VDAA 3IAPA 1PX4A 4TTGA 2CIQA 3T2QA 1JYNA 2JKAA 1K1WA 3J7HA 1HM3A 1K1YA 3MV01 1N7RA 3T2PA 1JZ6A 1YGAA 3IAQA 1J0NA 1NSUA 1X1HA 3T0AA 1JZ8A 2WVXB 4BZEA 3VD7A 4DUXA 3VD4A 2CIRA 1TXKA 3DYMA 1NSSA 1JZ7A 3T0DA 2BRWA 3VD5A 4BZHA 2WVYA 1NSRA 3NJXA 1L7JA 2Q1FA 1DP0A 1MMUA 1RWCA 1HMWA 1W3YA 3VD9A 3IMHA 1RWHA 1F4HA 3DYPA 3T0BA 3MWXA 4RNLA 1NSMA 1OJNA 2D73A 1F1SA 3ECQA 1SO0A 3OB8A 3DECA 3MV11 5E1QA 4BZGA 1NSXA 2BRVX 2X03A 1JYXA 2WW0A 3WFAA 1JZ2A 1ULVA 3I3EA 1JZ4A 1NS7A 2BRPA 3VDBA 1NSVA 1RWGA 3NREA 2ZXQA 2WW3A 2XHNA 1I8QA 3MUY1 3VDCA 3I3DA 3T2OA 3I3BA 1JYWA 1MMZA 1K1XA 1EGUA 1UG9A 1NKGA 2WVXA 2WW1A 3A24A 3Q1NA 4BZFA 2HTBA 1LXMA 1NS0A 1JYVA 1LXKA 2WW2A 1MN0A 1HM2A 1HN1A 1F9GA 4AQ0A 3DCDA 3SEPA 1LF6A 1NS8A 2WDAA 3DYOA 3E1F1 1YQ2A 1L7KA 1MMXA 1LOHA 1N7QA 1OJPA 1CB8A 1X1IA 1RWAA 1Z45A 2E22A 1JZ3A 1F4AA 2E24A 2HTAA 3T09A 3OS7A 1NS2A 1N7PA 1NS4A 3CZJA 3VD3A 2ZQ0A 1LURA 2JKEA 3BGAA 2WZSA 1OJMA 1J0MA 1NSZA 1LF9A 2WVZA 3K25A 1MMYA 1C82A 1HN0A 1RW9A 1X1JA 5A1AA 2XSGA 2WCOA 2CISA
chains in the Genus database with same CATH superfamily
1OJOA 3E7JA 1HMUA 1IVWA 1RWFA 3SXXA 1W2ZA 2JKPA 3BVUA 3VDAA 2F1AA 1HXKA 1HM3A 2CG0A 3PGBA 3IAQA 3T0AA 1JZ8A 2WVXB 2CIRA 1NSSA 4KFDA 1JZ7A 2BRWA 4BZHA 3D3IA 3BS6A 2WVYA 3TY1A 2CWVA 3ACSA 1TQTA 3HIIA 1HMWA 1IVVA 1HWWA 3IMHA 2E2TA 4J5TA 2CWTA 2D1WA 3VSMA 3MV11 2C10A 1NSXA 1V7WA 2WW0A 3WFAA 1JZ2A 2OOVA 4BTXA 4BTYA 1NSVA 4FNTA 2CFKA 2XHNA 3VDCA 3I3BA 4BTWA 4K35A 3T0UA 1SPUA 3EJPA 1QAKA 4MMHA 3RSYA 3A24A 1D6ZA 3CV5A 1LXMA 2F7QA 1LXKA 1R34A 2FUTA 1MN0A 2YX9A 1HM2A 1HTYA 2OOVC 1F9GA 4OK4A 3W7TA 3BUIA 1NS8A 1YQ2A 3S4DA 3BUQA 3BUPA 1LOHA 2E22A 1F4AA 2ALWA 2YFOA 1NS2A 2ZQ0A 1LURA 3ALAA 2C11A 1NSZA 3ACTA 1HN0A 1RW9A 2XSGA 1N7OA 3WA3A 3NJVA 1OACA 3OBAA 1N7NA 3N9HA 3T08A 3RRSA 1PX4A 2W0QA 2YFNA 4TTGA 1DYUA 4K3AA 3BUBA 3AMOA 3MV01 3BVWA 3T2PA 2RDYA 1JZ6A 1J0NA 4KTRA 3E80A 3VD7A 3VD4A 1D6YA 1TXKA 3S4CA 1TQWA 3BUDA 3WVFA 3AFJA 3NJXA 2CG1A 1W3YA 3VD9A 1W6CA 1W7CA 3S4AA 4FNPA 3DDGA 1AV4A 1F4HA 2CFGA 3X40A 2D73A 1SO0A 3OB8A 4BZGA 2BRVX 2OQEA 1IQXA 2X03A 1US1A 3I3EA 2FUQA 3D4ZA 3D51A 3BVXA 3EJSA 3D52A 4OK2A 3MUY1 4FNRA 1D6UA 5JMFA 1NKGA 4FNUA 3DX0A 3X3YA 3Q1NA 3X3ZA 3WIRA 2OQEC 2F18A 2F7OA 3MI6A 2EABA 4AQ0A 2F7PA 4OJZA 1QAFA 1PU4A 3X42A 3BVVA 1L7KA 1X1IA 1O7DD 1CB8A 1Z45A 3NBJA 3DX1A 1TQVA 2XN0A 1V7XA 2JKEA 1R33A 3BGAA 3CZSA 2BT3A 1QWUA 1IVUA 2CQSA 1SIIA 2WO0A 4KFEA 3D4YA 3A0OA 1TQSA 1SNZA 2CWUA 1W5ZA 4DUWA 1JZ5A 3MUZ1 3W7XA 3MPHA 3T2QA 1QX1A 3J7HA 3QDEA 4FNVA 1K1YA 1YGAA 3DX2A 1NSUA 1X1HA 4DUXA 1WMNA 3HIGA 3X3XA 3DYMA 3VD5A 2WOHA 1UI7A 4MMIA 2F7RA 4FNSA 1L7JA 3DX4A 1DP0A 1RWCA 2OW6A 3W7WA 1KSIA 3QFZA 2WYHA 3T0BA 2CFLA 3DDFA 3ECQA 3DECA 1JYXA 3BLCA 1TU5A 2XN1A 4KFFA 2ZXQA 2WW3A 1I8QA 3EJTA 3T2OA 1JYWA 2OW7A 1EGUA 1UG9A 3KN4A 3HI7A 2WVXA 4BZFA 2HTBA 1AVLA 3K5TA 3LVTA 3KIIA 1HN1A 3AMOB 2PNCA 1V7VA 3DCDA 2WDAA 3CZNA 3BVTA 1TQUA 3NBBA 1RWAA 4KTPA 2E24A 2HTAA 3WA2X 3X41A 3D50A 1NS4A 3CZJA 3VD3A 3BLBA 2WZSA 2CFDA 1OJMA 1PS3A 1LF9A 3K25A 3WIQA 1AVKA 4EV5A 1W6GA 2WCOA 2CISA 1WMPA 1H54A 1PX3A 5CA3A 1JOVA 2E2UA 2E2VA 1IU7A 4DUVA 3W7UA 1RJOA 3IAPA 1RKYA 2CIQA 1JYNA 3S4BA 2JKAA 1K1WA 2XN2A 2EACA 1N7RA 2F1BA 1A2VA 1EKMA 2CQTA 4BZEA 1SIHA 5GW7A 3QG0A 4UFCA 1LVNA 5KBPA 3T0DA 3LOYA 3EJQA 4EV2A 1NSRA 2Y74A 2Q1FA 1MMUA 3SX1A 1RWHA 5JMDA 3EJUA 3DYPA 3MWXA 4RNLA 1NSMA 1OJNA 3DX3A 1F1SA 2EADA 5E1QA 4FNQA 1ULVA 2EAEA 1JZ4A 1NS7A 2BRPA 3VDBA 1RWGA 2WGQA 3NREA 1UI8A 4NEIA 3I3DA 1MMZA 1K1XA 2ZL8A 2Y73A 1WMOA 3QFYA 2WW1A 3AFLA 1NS0A 1JYVA 1JRQA 2WW2A 1QALA 1QWNA 1IVXA 2FYVA 3SEPA 1LF6A 3DYOA 3E1F1 2CFWA 3W7SA 1MMXA 1N7QA 1OJPA 1W4NA 1JZ3A 3T09A 3OS7A 1N7PA 1J0MA 2WVZA 2WOFA 1MMYA 3VSNA 1C82A 1IQYA 1N9EA 2WYIA 1X1JA 3EJRA 5A1AA
chains in the Genus database with same CATH topology
1OJOA 1N7OA 1PX3A 3NJVA 3E7JA 1SNZA 1JOVA 1HMUA 3OBAA 1RWFA 4DUWA 1N7NA 1JZ5A 3MUZ1 3T08A 4DUVA 2JKPA 3VDAA 3IAPA 1PX4A 4TTGA 2CIQA 3T2QA 1JYNA 2JKAA 1K1WA 3J7HA 4FNVA 1HM3A 1K1YA 3MV01 1N7RA 3T2PA 1JZ6A 1YGAA 3IAQA 1J0NA 1NSUA 1X1HA 3T0AA 1JZ8A 3E80A 2WVXB 4BZEA 3VD7A 4DUXA 3VD4A 2CIRA 1TXKA 3DYMA 1NSSA 1JZ7A 3T0DA 2BRWA 3VD5A 4BZHA 3WVFA 3BS6A 2WVYA 3TY1A 1NSRA 4MMIA 3NJXA 1L7JA 2Q1FA 1DP0A 1MMUA 1RWCA 1HMWA 1W3YA 3VD9A 3IMHA 1RWHA 5JMDA 4J5TA 1F4HA 3DYPA 3T0BA 3MWXA 4RNLA 1NSMA 1OJNA 2D73A 1F1SA 3ECQA 1SO0A 3VSMA 3OB8A 3DECA 3MV11 5E1QA 4BZGA 1NSXA 2BRVX 2X03A 1JYXA 2WW0A 3WFAA 1JZ2A 1ULVA 3BLCA 3I3EA 2FUQA 1JZ4A 1NS7A 2BRPA 3VDBA 1NSVA 1RWGA 4OK2A 3NREA 2ZXQA 2WW3A 2XHNA 1I8QA 3MUY1 4NEIA 3VDCA 3I3DA 3T2OA 3I3BA 1JYWA 1MMZA 1K1XA 1EGUA 1UG9A 1NKGA 5JMFA 2WVXA 4MMHA 2WW1A 3A24A 3AFLA 3Q1NA 4BZFA 2HTBA 1LXMA 1NS0A 1JYVA 1LXKA 2FUTA 2WW2A 1MN0A 1HM2A 1HN1A 1F9GA 4AQ0A 4OJZA 3DCDA 4OK4A 3SEPA 1LF6A 1NS8A 2WDAA 3DYOA 3E1F1 1YQ2A 1L7KA 1MMXA 1LOHA 1N7QA 1OJPA 1CB8A 1X1IA 1RWAA 1Z45A 2E22A 1JZ3A 1F4AA 2E24A 2HTAA 3T09A 3OS7A 1NS2A 1N7PA 1NS4A 3CZJA 3VD3A 2ZQ0A 1LURA 2JKEA 3BGAA 2WZSA 1OJMA 1J0MA 1NSZA 1LF9A 2WVZA 3K25A 1MMYA 3VSNA 1C82A 1HN0A 1RW9A 1X1JA 5A1AA 2XSGA 3A0OA 2WCOA 2CISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJO A;  1N7O A;  1PX3 A;  3NJV A;  1SNZ A;  1JOV A;  1HMU A;  3OBA A;  1RWF A;  4DUW A;  1N7N A;  1JZ5 A;  3MUZ 1;  3T08 A;  4DUV A;  2JKP A;  3VDA A;  3IAP A;  1PX4 A;  4TTG A;  2CIQ A;  3T2Q A;  1JYN A;  2JKA A;  1K1W A;  3J7H A;  1HM3 A;  1K1Y A;  3MV0 1;  1N7R A;  3T2P A;  1JZ6 A;  1YGA A;  3IAQ A;  1J0N A;  1NSU A;  1X1H A;  3T0A A;  1JZ8 A;  2WVX B;  4BZE A;  3VD7 A;  4DUX A;  3VD4 A;  2CIR A;  1TXK A;  3DYM A;  1NSS A;  1JZ7 A;  3T0D A;  2BRW A;  3VD5 A;  4BZH A;  2WVY A;  1NSR A;  3NJX A;  1L7J A;  2Q1F A;  1DP0 A;  1MMU A;  1RWC A;  1HMW A;  1W3Y A;  3VD9 A;  3IMH A;  1RWH A;  1F4H A;  3DYP A;  3T0B A;  3MWX A;  4RNL A;  1NSM A;  1OJN A;  2D73 A;  1F1S A;  3ECQ A;  1SO0 A;  3OB8 A;  3DEC A;  3MV1 1;  5E1Q A;  4BZG A;  1NSX A;  2BRV X;  2X03 A;  1JYX A;  2WW0 A;  3WFA A;  1JZ2 A;  1ULV A;  3I3E A;  1JZ4 A;  1NS7 A;  2BRP A;  3VDB A;  1NSV A;  1RWG A;  3NRE A;  2ZXQ A;  2WW3 A;  2XHN A;  1I8Q A;  3MUY 1;  3VDC A;  3I3D A;  3T2O A;  3I3B A;  1JYW A;  1MMZ A;  1K1X A;  1EGU A;  1UG9 A;  1NKG A;  2WVX A;  2WW1 A;  3A24 A;  3Q1N A;  4BZF A;  2HTB A;  1LXM A;  1NS0 A;  1JYV A;  1LXK A;  2WW2 A;  1MN0 A;  1HM2 A;  1HN1 A;  1F9G A;  4AQ0 A;  3DCD A;  3SEP A;  1LF6 A;  1NS8 A;  2WDA A;  3DYO A;  3E1F 1;  1YQ2 A;  1L7K A;  1MMX A;  1LOH A;  1N7Q A;  1OJP A;  1CB8 A;  1X1I A;  1RWA A;  1Z45 A;  2E22 A;  1JZ3 A;  1F4A A;  2E24 A;  2HTA A;  3T09 A;  3OS7 A;  1NS2 A;  1N7P A;  1NS4 A;  3CZJ A;  3VD3 A;  2ZQ0 A;  1LUR A;  2JKE A;  3BGA A;  2WZS A;  1OJM A;  1J0M A;  1NSZ A;  1LF9 A;  2WVZ A;  3K25 A;  1MMY A;  1C82 A;  1HN0 A;  1RW9 A;  1X1J A;  5A1A A;  2XSG A;  2WCO A;  2CIS A; 
#chains in the Genus database with same CATH topology
 1OJO A;  3E7J A;  1HMU A;  1IVW A;  1RWF A;  3SXX A;  1W2Z A;  2JKP A;  3BVU A;  3VDA A;  2F1A A;  1HXK A;  1HM3 A;  2CG0 A;  3PGB A;  3IAQ A;  3T0A A;  1JZ8 A;  2WVX B;  2CIR A;  1NSS A;  4KFD A;  1JZ7 A;  2BRW A;  4BZH A;  3D3I A;  3BS6 A;  2WVY A;  3TY1 A;  2CWV A;  3ACS A;  1TQT A;  3HII A;  1HMW A;  1IVV A;  1HWW A;  3IMH A;  2E2T A;  4J5T A;  2CWT A;  2D1W A;  3VSM A;  3MV1 1;  2C10 A;  1NSX A;  1V7W A;  2WW0 A;  3WFA A;  1JZ2 A;  2OOV A;  4BTX A;  4BTY A;  1NSV A;  4FNT A;  2CFK A;  2XHN A;  3VDC A;  3I3B A;  4BTW A;  4K35 A;  3T0U A;  1SPU A;  3EJP A;  1QAK A;  4MMH A;  3RSY A;  3A24 A;  1D6Z A;  3CV5 A;  1LXM A;  2F7Q A;  1LXK A;  1R34 A;  2FUT A;  1MN0 A;  2YX9 A;  1HM2 A;  1HTY A;  2OOV C;  1F9G A;  4OK4 A;  3W7T A;  3BUI A;  1NS8 A;  1YQ2 A;  3S4D A;  3BUQ A;  3BUP A;  1LOH A;  2E22 A;  1F4A A;  2ALW A;  2YFO A;  1NS2 A;  2ZQ0 A;  1LUR A;  3ALA A;  2C11 A;  1NSZ A;  3ACT A;  1HN0 A;  1RW9 A;  2XSG A;  1N7O A;  3WA3 A;  3NJV A;  1OAC A;  3OBA A;  1N7N A;  3N9H A;  3T08 A;  3RRS A;  1PX4 A;  2W0Q A;  2YFN A;  4TTG A;  1DYU A;  4K3A A;  3BUB A;  3AMO A;  3MV0 1;  3BVW A;  3T2P A;  2RDY A;  1JZ6 A;  1J0N A;  4KTR A;  3E80 A;  3VD7 A;  3VD4 A;  1D6Y A;  1TXK A;  3S4C A;  1TQW A;  3BUD A;  3WVF A;  3AFJ A;  3NJX A;  2CG1 A;  1W3Y A;  3VD9 A;  1W6C A;  1W7C A;  3S4A A;  4FNP A;  3DDG A;  1AV4 A;  1F4H A;  2CFG A;  3X40 A;  2D73 A;  1SO0 A;  3OB8 A;  4BZG A;  2BRV X;  2OQE A;  1IQX A;  2X03 A;  1US1 A;  3I3E A;  2FUQ A;  3D4Z A;  3D51 A;  3BVX A;  3EJS A;  3D52 A;  4OK2 A;  3MUY 1;  4FNR A;  1D6U A;  5JMF A;  1NKG A;  4FNU A;  3DX0 A;  3X3Y A;  3Q1N A;  3X3Z A;  3WIR A;  2OQE C;  2F18 A;  2F7O A;  3MI6 A;  2EAB A;  4AQ0 A;  2F7P A;  4OJZ A;  1QAF A;  1PU4 A;  3X42 A;  3BVV A;  1L7K A;  1X1I A;  1O7D D;  1CB8 A;  1Z45 A;  3NBJ A;  3DX1 A;  1TQV A;  2XN0 A;  1V7X A;  2JKE A;  1R33 A;  3BGA A;  3CZS A;  2BT3 A;  1QWU A;  1IVU A;  2CQS A;  1SII A;  2WO0 A;  4KFE A;  3D4Y A;  3A0O A;  1TQS A;  1SNZ A;  2CWU A;  1W5Z A;  4DUW A;  1JZ5 A;  3MUZ 1;  3W7X A;  3MPH A;  3T2Q A;  1QX1 A;  3J7H A;  3QDE A;  4FNV A;  1K1Y A;  1YGA A;  3DX2 A;  1NSU A;  1X1H A;  4DUX A;  1WMN A;  3HIG A;  3X3X A;  3DYM A;  3VD5 A;  2WOH A;  1UI7 A;  4MMI A;  2F7R A;  4FNS A;  1L7J A;  3DX4 A;  1DP0 A;  1RWC A;  2OW6 A;  3W7W A;  1KSI A;  3QFZ A;  2WYH A;  3T0B A;  2CFL A;  3DDF A;  3ECQ A;  3DEC A;  1JYX A;  3BLC A;  1TU5 A;  2XN1 A;  4KFF A;  2ZXQ A;  2WW3 A;  1I8Q A;  3EJT A;  3T2O A;  1JYW A;  2OW7 A;  1EGU A;  1UG9 A;  3KN4 A;  3HI7 A;  2WVX A;  4BZF A;  2HTB A;  1AVL A;  3K5T A;  3LVT A;  3KII A;  1HN1 A;  3AMO B;  2PNC A;  1V7V A;  3DCD A;  2WDA A;  3CZN A;  3BVT A;  1TQU A;  3NBB A;  1RWA A;  4KTP A;  2E24 A;  2HTA A;  3WA2 X;  3X41 A;  3D50 A;  1NS4 A;  3CZJ A;  3VD3 A;  3BLB A;  2WZS A;  2CFD A;  1OJM A;  1PS3 A;  1LF9 A;  3K25 A;  3WIQ A;  1AVK A;  4EV5 A;  1W6G A;  2WCO A;  2CIS A;  1WMP A;  1H54 A;  1PX3 A;  5CA3 A;  1JOV A;  2E2U A;  2E2V A;  1IU7 A;  4DUV A;  3W7U A;  1RJO A;  3IAP A;  1RKY A;  2CIQ A;  1JYN A;  3S4B A;  2JKA A;  1K1W A;  2XN2 A;  2EAC A;  1N7R A;  2F1B A;  1A2V A;  1EKM A;  2CQT A;  4BZE A;  1SIH A;  5GW7 A;  3QG0 A;  4UFC A;  1LVN A;  5KBP A;  3T0D A;  3LOY A;  3EJQ A;  4EV2 A;  1NSR A;  2Y74 A;  2Q1F A;  1MMU A;  3SX1 A;  1RWH A;  5JMD A;  3EJU A;  3DYP A;  3MWX A;  4RNL A;  1NSM A;  1OJN A;  3DX3 A;  1F1S A;  2EAD A;  5E1Q A;  4FNQ A;  1ULV A;  2EAE A;  1JZ4 A;  1NS7 A;  2BRP A;  3VDB A;  1RWG A;  2WGQ A;  3NRE A;  1UI8 A;  4NEI A;  3I3D A;  1MMZ A;  1K1X A;  2ZL8 A;  2Y73 A;  1WMO A;  3QFY A;  2WW1 A;  3AFL A;  1NS0 A;  1JYV A;  1JRQ A;  2WW2 A;  1QAL A;  1QWN A;  1IVX A;  2FYV A;  3SEP A;  1LF6 A;  3DYO A;  3E1F 1;  2CFW A;  3W7S A;  1MMX A;  1N7Q A;  1OJP A;  1W4N A;  1JZ3 A;  3T09 A;  3OS7 A;  1N7P A;  1J0M A;  2WVZ A;  2WOF A;  1MMY A;  3VSN A;  1C82 A;  1IQY A;  1N9E A;  2WYI A;  1X1J A;  3EJR A;  5A1A A; 
#chains in the Genus database with same CATH homology
 1OJO A;  1N7O A;  1PX3 A;  3NJV A;  3E7J A;  1SNZ A;  1JOV A;  1HMU A;  3OBA A;  1RWF A;  4DUW A;  1N7N A;  1JZ5 A;  3MUZ 1;  3T08 A;  4DUV A;  2JKP A;  3VDA A;  3IAP A;  1PX4 A;  4TTG A;  2CIQ A;  3T2Q A;  1JYN A;  2JKA A;  1K1W A;  3J7H A;  4FNV A;  1HM3 A;  1K1Y A;  3MV0 1;  1N7R A;  3T2P A;  1JZ6 A;  1YGA A;  3IAQ A;  1J0N A;  1NSU A;  1X1H A;  3T0A A;  1JZ8 A;  3E80 A;  2WVX B;  4BZE A;  3VD7 A;  4DUX A;  3VD4 A;  2CIR A;  1TXK A;  3DYM A;  1NSS A;  1JZ7 A;  3T0D A;  2BRW A;  3VD5 A;  4BZH A;  3WVF A;  3BS6 A;  2WVY A;  3TY1 A;  1NSR A;  4MMI A;  3NJX A;  1L7J A;  2Q1F A;  1DP0 A;  1MMU A;  1RWC A;  1HMW A;  1W3Y A;  3VD9 A;  3IMH A;  1RWH A;  5JMD A;  4J5T A;  1F4H A;  3DYP A;  3T0B A;  3MWX A;  4RNL A;  1NSM A;  1OJN A;  2D73 A;  1F1S A;  3ECQ A;  1SO0 A;  3VSM A;  3OB8 A;  3DEC A;  3MV1 1;  5E1Q A;  4BZG A;  1NSX A;  2BRV X;  2X03 A;  1JYX A;  2WW0 A;  3WFA A;  1JZ2 A;  1ULV A;  3BLC A;  3I3E A;  2FUQ A;  1JZ4 A;  1NS7 A;  2BRP A;  3VDB A;  1NSV A;  1RWG A;  4OK2 A;  3NRE A;  2ZXQ A;  2WW3 A;  2XHN A;  1I8Q A;  3MUY 1;  4NEI A;  3VDC A;  3I3D A;  3T2O A;  3I3B A;  1JYW A;  1MMZ A;  1K1X A;  1EGU A;  1UG9 A;  1NKG A;  5JMF A;  2WVX A;  4MMH A;  2WW1 A;  3A24 A;  3AFL A;  3Q1N A;  4BZF A;  2HTB A;  1LXM A;  1NS0 A;  1JYV A;  1LXK A;  2FUT A;  2WW2 A;  1MN0 A;  1HM2 A;  1HN1 A;  1F9G A;  4AQ0 A;  4OJZ A;  3DCD A;  4OK4 A;  3SEP A;  1LF6 A;  1NS8 A;  2WDA A;  3DYO A;  3E1F 1;  1YQ2 A;  1L7K A;  1MMX A;  1LOH A;  1N7Q A;  1OJP A;  1CB8 A;  1X1I A;  1RWA A;  1Z45 A;  2E22 A;  1JZ3 A;  1F4A A;  2E24 A;  2HTA A;  3T09 A;  3OS7 A;  1NS2 A;  1N7P A;  1NS4 A;  3CZJ A;  3VD3 A;  2ZQ0 A;  1LUR A;  2JKE A;  3BGA A;  2WZS A;  1OJM A;  1J0M A;  1NSZ A;  1LF9 A;  2WVZ A;  3K25 A;  1MMY A;  3VSN A;  1C82 A;  1HN0 A;  1RW9 A;  1X1J A;  5A1A A;  2XSG A;  3A0O A;  2WCO A;  2CIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...