1NS2A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns2A00
2WVYA 3VD5A 1NSUA 4DUVA 1JYVA 1L7KA 2XHNA 1HM3A 1NS7A 3T09A 2XSGA 3Q1NA 2CISA 4BZFA 1HMUA 3VDBA 1PX3A 1Z45A 2JKAA 1X1HA 3J7HA 1F4HA 1MMYA 3I3BA 3MUZ1 4BZGA 3IMHA 4BZEA 1MMXA 4AQ0A 1JZ6A 2ZQ0A 1OJPA 3MUY1 1I8QA 1RWHA 1NKGA 1RWGA 1YQ2A 2HTAA 3DCDA 1YGAA 1JZ2A 3I3DA 3NJVA 1HM2A 3VD7A 1NSVA 1NS4A 1K1WA 2Q1FA 2HTBA 2WW2A 2WVZA 1DP0A 2CIQA 3SEPA 3K25A 2BRPA 1RWCA 2E22A 1LXKA 3T2QA 4TTGA 1JYWA 2WDAA 1LXMA 3E1F1 2X03A 1LF9A 1N7OA 2BRVX 1OJMA 1MMUA 1RW9A 4DUWA 1X1IA 2WW1A 1LF6A 1LURA 3IAQA 1MMZA 3MV11 2BRWA 2ZXQA 1NSMA 1JZ7A 4BZHA 3OB8A 3MWXA 3OBAA 3WFAA 1NS0A 1W3YA 3ECQA 2JKEA 2D73A 3DECA 3T0BA 3T08A 1ULVA 2JKPA 3NREA 1NS2A 1N7RA 1TXKA 1CB8A 1SNZA 1LOHA 1K1XA 3DYOA 1UG9A 2WCOA 1JZ5A 1N7NA 2WW3A 1OJNA 1RWAA 3CZJA 3IAPA 3MV01 1MN0A 1RWFA 2WW0A 1NSXA 1NSZA 2CIRA 1K1YA 1JZ3A 1HN1A 5A1AA 1EGUA 2E24A 3VD4A 1JYXA 3VD3A 1NSSA 1L7JA 1NSRA 1JZ4A 1JYNA 1HMWA 1F1SA 3DYPA 3VD9A 1X1JA 2WZSA 3OS7A 3T2OA 1C82A 1F9GA 1OJOA 3I3EA 5E1QA 3VDCA 4DUXA 3DYMA 3VDAA 1JZ8A 1HN0A 4RNLA 3T2PA 3T0AA 2WVXA 3NJXA 1F4AA 1N7PA 1N7QA 1J0MA 1PX4A 1SO0A 2WVXB 1JOVA 3T0DA 1NS8A 3A24A 1J0NA 3BGAA
chains in the Genus database with same CATH superfamily
3VD5A 1OACA 3X40A 1EKMA 2OOVA 2XSGA 3BLCA 1HMUA 3VDBA 1Z45A 3DX4A 1H54A 1RJOA 3EJTA 4FNSA 1HXKA 1TQSA 2EAEA 1OJPA 1IVVA 1I8QA 1RWHA 1NKGA 3LOYA 1YGAA 4FNPA 4K3AA 3W7WA 3W7XA 2YFNA 3BUQA 1NS4A 4FNVA 2F1BA 1JRQA 1DP0A 3SEPA 4KTRA 1R34A 3MPHA 1RWCA 2E22A 3ACTA 3T2QA 4FNTA 1MMUA 3AMOA 1RW9A 1SIHA 4KFDA 2E2TA 1LF6A 3IAQA 4BTXA 1JZ7A 1NSMA 1US1A 3MWXA 3OBAA 1IQXA 3WFAA 1W3YA 1LVNA 3BLBA 3ECQA 2YFOA 3DECA 3NREA 2F7PA 1N7RA 1SNZA 1W2ZA 1TQVA 2ZL8A 3QDEA 3DYOA 2WW3A 1OJNA 1MN0A 1QALA 1NSXA 3TY1A 1N9EA 1IU7A 5JMFA 1HN1A 3D51A 1EGUA 3D52A 1HWWA 3VD4A 3BUIA 1WMPA 3VD9A 1X1JA 3DX3A 2FYVA 2C10A 3I3EA 4DUXA 1HN0A 4RNLA 3EJRA 5JMDA 1F4AA 1N7PA 1W7CA 3T0UA 2PNCA 2CQSA 4EV5A 3A0OA 1HM3A 3SXXA 3CV5A 1AVKA 3AFJA 3BVXA 3Q1NA 1D6ZA 1PU4A 2CFDA 2WOFA 3E80A 1F4HA 4BTWA 3VSNA 1W4NA 1D6UA 1AV4A 4BZGA 2ALWA 4OK2A 2C11A 3X3ZA 3BVVA 1YQ2A 3X41A 3DCDA 1JZ2A 1IQYA 3NJVA 5KBPA 1HM2A 3VD7A 3EJQA 2W0QA 2OOVC 3EJSA 3E7JA 4UFCA 2WVZA 1TQTA 3K25A 2BRPA 2Y74A 1LXKA 1RKYA 3E1F1 1LXMA 1LF9A 2BRVX 1OJMA 3KIIA 3VSMA 1LURA 3S4AA 2ZXQA 3WIQA 4BTYA 1NS0A 2YX9A 1UI8A 1QAKA 3T0BA 3RRSA 3D50A 3T08A 1WMOA 2JKPA 2WYHA 1NS2A 3QFYA 4EV2A 1K1XA 3D4YA 2E2UA 1UG9A 3S4BA 2FUQA 1RWAA 3DX2A 1WMNA 2D1WA 5A1AA 3K5TA 2CG0A 1KSIA 3VD3A 1L7JA 1NSRA 1JZ4A 4MMIA 2CQTA 3OS7A 4KFEA 3T2OA 5E1QA 1F9GA 1JZ8A 3NJXA 1HTYA 5GW7A 3X3YA 3BVWA 3EJPA 3BGAA 2WVYA 2CFKA 1L7KA 1QAFA 1NS7A 3T09A 3DDGA 1PX3A 3J7HA 3I3BA 3DX1A 3AFLA 3IMHA 2BT3A 1MMXA 2OQEC 1QWNA 2OQEA 1D6YA 3MUY1 2EABA 2EADA 3QFZA 3I3DA 4FNQA 1V7WA 2CWUA 3ACSA 1K1WA 1W6GA 2HTBA 3EJUA 2CIQA 3QG0A 2F7QA 1W5ZA 1W6CA 2CFGA 2EACA 2WDAA 3BUDA 3HI7A 1N7OA 1V7XA 3X42A 1X1IA 2WW1A 4KTPA 3HIIA 3OB8A 2OW7A 2JKEA 3LVTA 3ALAA 1DYUA 1TXKA 2Y73A 2CWVA 2WO0A 1A2VA 2WCOA 1IVWA 2XN1A 2FUTA 3HIGA 2WW0A 1NSZA 2CIRA 3AMOB 2F1AA 1JZ3A 2E2VA 2E24A 2XN0A 1JYXA 1NSSA 3W7UA 3BVUA 1HMWA 3NBBA 1F1SA 3DYPA 2WZSA 1QX1A 1SPUA 3DX0A 3VDCA 3DYMA 4OK4A 3SX1A 1IVXA 3T0AA 2WVXA 4FNUA 3D3IA 1N7QA 1PX4A 1JOVA 1NS8A 1J0NA 1AVLA 1NSUA 4J5TA 2CFLA 4DUVA 1JYVA 2CWTA 2XHNA 3KN4A 3MI6A 1O7DD 2CISA 4BZFA 2JKAA 1R33A 1X1HA 1MMYA 3DDFA 3MUZ1 4BZEA 4NEIA 4K35A 4AQ0A 4OJZA 1JZ6A 2ZQ0A 1TU5A 1QWUA 2WGQA 1RWGA 2HTAA 2WYIA 2CFWA 1NSVA 3BUBA 2Q1FA 2WW2A 2OW6A 1SIIA 2RDYA 3D4ZA 4TTGA 1JYWA 2X03A 3CZSA 1IVUA 3W7TA 3S4CA 4DUWA 3RSYA 1MMZA 2F7RA 2BRWA 3MV11 1UI7A 2F7OA 3X3XA 2F18A 4MMHA 4BZHA 2D73A 2XN2A 1ULVA 1CB8A 3WA3A 1LOHA 3BUPA 3CZNA 3BVTA 3WVFA 1JZ5A 1N7NA 3IAPA 3CZJA 3MV01 1RWFA 3N9HA 1K1YA 1PS3A 1JYNA 2CG1A 3W7SA 5CA3A 4KFFA 3WA2X 3NBJA 1C82A 1OJOA 3VDAA 1TQUA 3T2PA 2WOHA 3S4DA 3WIRA 1J0MA 1SO0A 2WVXB 3BS6A 3T0DA 4FNRA 1V7VA 3A24A 3PGBA 1TQWA
chains in the Genus database with same CATH topology
2WVYA 3VD5A 1NSUA 4J5TA 4DUVA 1JYVA 3A0OA 1L7KA 2XHNA 1HM3A 1NS7A 3T09A 2XSGA 3Q1NA 2CISA 3BLCA 4BZFA 1HMUA 3VDBA 1PX3A 1Z45A 2JKAA 1X1HA 3E80A 3J7HA 1F4HA 1MMYA 3I3BA 3MUZ1 3VSNA 3AFLA 4BZGA 3IMHA 4BZEA 4NEIA 1MMXA 4AQ0A 4OJZA 1JZ6A 4OK2A 2ZQ0A 1OJPA 3MUY1 1I8QA 1RWHA 1NKGA 1RWGA 1YQ2A 2HTAA 3DCDA 1YGAA 1JZ2A 3I3DA 3NJVA 1HM2A 3VD7A 1NSVA 3E7JA 1NS4A 1K1WA 4FNVA 2Q1FA 2HTBA 2WW2A 2WVZA 1DP0A 2CIQA 3SEPA 3K25A 2BRPA 1RWCA 2E22A 1LXKA 3T2QA 4TTGA 1JYWA 2WDAA 1LXMA 3E1F1 2X03A 1LF9A 1N7OA 2BRVX 1OJMA 1MMUA 1RW9A 4DUWA 1X1IA 2WW1A 1LF6A 3VSMA 1LURA 3IAQA 1MMZA 3MV11 2BRWA 2ZXQA 1NSMA 1JZ7A 4MMHA 4BZHA 3OB8A 3MWXA 3OBAA 3WFAA 1NS0A 1W3YA 3ECQA 2JKEA 2D73A 3DECA 3T0BA 3T08A 1ULVA 2JKPA 3NREA 1NS2A 1N7RA 1TXKA 1CB8A 1SNZA 1LOHA 1K1XA 3WVFA 3DYOA 1UG9A 2WCOA 1JZ5A 1N7NA 2FUTA 2WW3A 2FUQA 1OJNA 1RWAA 3CZJA 3IAPA 3MV01 1MN0A 1RWFA 2WW0A 1NSXA 1NSZA 3TY1A 2CIRA 1K1YA 5JMFA 1HN1A 5A1AA 1EGUA 1JZ3A 2E24A 3VD4A 1JYXA 3VD3A 1NSSA 1L7JA 1NSRA 1JZ4A 1JYNA 1HMWA 4MMIA 1F1SA 3DYPA 3VD9A 1X1JA 2WZSA 3OS7A 3T2OA 1C82A 1F9GA 1OJOA 3I3EA 5E1QA 3VDCA 4DUXA 3DYMA 3VDAA 1JZ8A 1HN0A 4OK4A 4RNLA 3T2PA 5JMDA 3T0AA 2WVXA 3NJXA 1F4AA 1N7PA 1N7QA 1J0MA 1PX4A 1SO0A 2WVXB 1JOVA 3BS6A 3T0DA 1NS8A 3A24A 1J0NA 3BGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVY A;  3VD5 A;  1NSU A;  4DUV A;  1JYV A;  1L7K A;  2XHN A;  1HM3 A;  1NS7 A;  3T09 A;  2XSG A;  3Q1N A;  2CIS A;  4BZF A;  1HMU A;  3VDB A;  1PX3 A;  1Z45 A;  2JKA A;  1X1H A;  3J7H A;  1F4H A;  1MMY A;  3I3B A;  3MUZ 1;  4BZG A;  3IMH A;  4BZE A;  1MMX A;  4AQ0 A;  1JZ6 A;  2ZQ0 A;  1OJP A;  3MUY 1;  1I8Q A;  1RWH A;  1NKG A;  1RWG A;  1YQ2 A;  2HTA A;  3DCD A;  1YGA A;  1JZ2 A;  3I3D A;  3NJV A;  1HM2 A;  3VD7 A;  1NSV A;  1NS4 A;  1K1W A;  2Q1F A;  2HTB A;  2WW2 A;  2WVZ A;  1DP0 A;  2CIQ A;  3SEP A;  3K25 A;  2BRP A;  1RWC A;  2E22 A;  1LXK A;  3T2Q A;  4TTG A;  1JYW A;  2WDA A;  1LXM A;  3E1F 1;  2X03 A;  1LF9 A;  1N7O A;  2BRV X;  1OJM A;  1MMU A;  1RW9 A;  4DUW A;  1X1I A;  2WW1 A;  1LF6 A;  1LUR A;  3IAQ A;  1MMZ A;  3MV1 1;  2BRW A;  2ZXQ A;  1NSM A;  1JZ7 A;  4BZH A;  3OB8 A;  3MWX A;  3OBA A;  3WFA A;  1NS0 A;  1W3Y A;  3ECQ A;  2JKE A;  2D73 A;  3DEC A;  3T0B A;  3T08 A;  1ULV A;  2JKP A;  3NRE A;  1NS2 A;  1N7R A;  1TXK A;  1CB8 A;  1SNZ A;  1LOH A;  1K1X A;  3DYO A;  1UG9 A;  2WCO A;  1JZ5 A;  1N7N A;  2WW3 A;  1OJN A;  1RWA A;  3CZJ A;  3IAP A;  3MV0 1;  1MN0 A;  1RWF A;  2WW0 A;  1NSX A;  1NSZ A;  2CIR A;  1K1Y A;  1JZ3 A;  1HN1 A;  5A1A A;  1EGU A;  2E24 A;  3VD4 A;  1JYX A;  3VD3 A;  1NSS A;  1L7J A;  1NSR A;  1JZ4 A;  1JYN A;  1HMW A;  1F1S A;  3DYP A;  3VD9 A;  1X1J A;  2WZS A;  3OS7 A;  3T2O A;  1C82 A;  1F9G A;  1OJO A;  3I3E A;  5E1Q A;  3VDC A;  4DUX A;  3DYM A;  3VDA A;  1JZ8 A;  1HN0 A;  4RNL A;  3T2P A;  3T0A A;  2WVX A;  3NJX A;  1F4A A;  1N7P A;  1N7Q A;  1J0M A;  1PX4 A;  1SO0 A;  2WVX B;  1JOV A;  3T0D A;  1NS8 A;  3A24 A;  1J0N A;  3BGA A; 
#chains in the Genus database with same CATH topology
 3VD5 A;  1OAC A;  3X40 A;  1EKM A;  2OOV A;  2XSG A;  3BLC A;  1HMU A;  3VDB A;  1Z45 A;  3DX4 A;  1H54 A;  1RJO A;  3EJT A;  4FNS A;  1HXK A;  1TQS A;  2EAE A;  1OJP A;  1IVV A;  1I8Q A;  1RWH A;  1NKG A;  3LOY A;  1YGA A;  4FNP A;  4K3A A;  3W7W A;  3W7X A;  2YFN A;  3BUQ A;  1NS4 A;  4FNV A;  2F1B A;  1JRQ A;  1DP0 A;  3SEP A;  4KTR A;  1R34 A;  3MPH A;  1RWC A;  2E22 A;  3ACT A;  3T2Q A;  4FNT A;  1MMU A;  3AMO A;  1RW9 A;  1SIH A;  4KFD A;  2E2T A;  1LF6 A;  3IAQ A;  4BTX A;  1JZ7 A;  1NSM A;  1US1 A;  3MWX A;  3OBA A;  1IQX A;  3WFA A;  1W3Y A;  1LVN A;  3BLB A;  3ECQ A;  2YFO A;  3DEC A;  3NRE A;  2F7P A;  1N7R A;  1SNZ A;  1W2Z A;  1TQV A;  2ZL8 A;  3QDE A;  3DYO A;  2WW3 A;  1OJN A;  1MN0 A;  1QAL A;  1NSX A;  3TY1 A;  1N9E A;  1IU7 A;  5JMF A;  1HN1 A;  3D51 A;  1EGU A;  3D52 A;  1HWW A;  3VD4 A;  3BUI A;  1WMP A;  3VD9 A;  1X1J A;  3DX3 A;  2FYV A;  2C10 A;  3I3E A;  4DUX A;  1HN0 A;  4RNL A;  3EJR A;  5JMD A;  1F4A A;  1N7P A;  1W7C A;  3T0U A;  2PNC A;  2CQS A;  4EV5 A;  3A0O A;  1HM3 A;  3SXX A;  3CV5 A;  1AVK A;  3AFJ A;  3BVX A;  3Q1N A;  1D6Z A;  1PU4 A;  2CFD A;  2WOF A;  3E80 A;  1F4H A;  4BTW A;  3VSN A;  1W4N A;  1D6U A;  1AV4 A;  4BZG A;  2ALW A;  4OK2 A;  2C11 A;  3X3Z A;  3BVV A;  1YQ2 A;  3X41 A;  3DCD A;  1JZ2 A;  1IQY A;  3NJV A;  5KBP A;  1HM2 A;  3VD7 A;  3EJQ A;  2W0Q A;  2OOV C;  3EJS A;  3E7J A;  4UFC A;  2WVZ A;  1TQT A;  3K25 A;  2BRP A;  2Y74 A;  1LXK A;  1RKY A;  3E1F 1;  1LXM A;  1LF9 A;  2BRV X;  1OJM A;  3KII A;  3VSM A;  1LUR A;  3S4A A;  2ZXQ A;  3WIQ A;  4BTY A;  1NS0 A;  2YX9 A;  1UI8 A;  1QAK A;  3T0B A;  3RRS A;  3D50 A;  3T08 A;  1WMO A;  2JKP A;  2WYH A;  1NS2 A;  3QFY A;  4EV2 A;  1K1X A;  3D4Y A;  2E2U A;  1UG9 A;  3S4B A;  2FUQ A;  1RWA A;  3DX2 A;  1WMN A;  2D1W A;  5A1A A;  3K5T A;  2CG0 A;  1KSI A;  3VD3 A;  1L7J A;  1NSR A;  1JZ4 A;  4MMI A;  2CQT A;  3OS7 A;  4KFE A;  3T2O A;  5E1Q A;  1F9G A;  1JZ8 A;  3NJX A;  1HTY A;  5GW7 A;  3X3Y A;  3BVW A;  3EJP A;  3BGA A;  2WVY A;  2CFK A;  1L7K A;  1QAF A;  1NS7 A;  3T09 A;  3DDG A;  1PX3 A;  3J7H A;  3I3B A;  3DX1 A;  3AFL A;  3IMH A;  2BT3 A;  1MMX A;  2OQE C;  1QWN A;  2OQE A;  1D6Y A;  3MUY 1;  2EAB A;  2EAD A;  3QFZ A;  3I3D A;  4FNQ A;  1V7W A;  2CWU A;  3ACS A;  1K1W A;  1W6G A;  2HTB A;  3EJU A;  2CIQ A;  3QG0 A;  2F7Q A;  1W5Z A;  1W6C A;  2CFG A;  2EAC A;  2WDA A;  3BUD A;  3HI7 A;  1N7O A;  1V7X A;  3X42 A;  1X1I A;  2WW1 A;  4KTP A;  3HII A;  3OB8 A;  2OW7 A;  2JKE A;  3LVT A;  3ALA A;  1DYU A;  1TXK A;  2Y73 A;  2CWV A;  2WO0 A;  1A2V A;  2WCO A;  1IVW A;  2XN1 A;  2FUT A;  3HIG A;  2WW0 A;  1NSZ A;  2CIR A;  3AMO B;  2F1A A;  1JZ3 A;  2E2V A;  2E24 A;  2XN0 A;  1JYX A;  1NSS A;  3W7U A;  3BVU A;  1HMW A;  3NBB A;  1F1S A;  3DYP A;  2WZS A;  1QX1 A;  1SPU A;  3DX0 A;  3VDC A;  3DYM A;  4OK4 A;  3SX1 A;  1IVX A;  3T0A A;  2WVX A;  4FNU A;  3D3I A;  1N7Q A;  1PX4 A;  1JOV A;  1NS8 A;  1J0N A;  1AVL A;  1NSU A;  4J5T A;  2CFL A;  4DUV A;  1JYV A;  2CWT A;  2XHN A;  3KN4 A;  3MI6 A;  1O7D D;  2CIS A;  4BZF A;  2JKA A;  1R33 A;  1X1H A;  1MMY A;  3DDF A;  3MUZ 1;  4BZE A;  4NEI A;  4K35 A;  4AQ0 A;  4OJZ A;  1JZ6 A;  2ZQ0 A;  1TU5 A;  1QWU A;  2WGQ A;  1RWG A;  2HTA A;  2WYI A;  2CFW A;  1NSV A;  3BUB A;  2Q1F A;  2WW2 A;  2OW6 A;  1SII A;  2RDY A;  3D4Z A;  4TTG A;  1JYW A;  2X03 A;  3CZS A;  1IVU A;  3W7T A;  3S4C A;  4DUW A;  3RSY A;  1MMZ A;  2F7R A;  2BRW A;  3MV1 1;  1UI7 A;  2F7O A;  3X3X A;  2F18 A;  4MMH A;  4BZH A;  2D73 A;  2XN2 A;  1ULV A;  1CB8 A;  3WA3 A;  1LOH A;  3BUP A;  3CZN A;  3BVT A;  3WVF A;  1JZ5 A;  1N7N A;  3IAP A;  3CZJ A;  3MV0 1;  1RWF A;  3N9H A;  1K1Y A;  1PS3 A;  1JYN A;  2CG1 A;  3W7S A;  5CA3 A;  4KFF A;  3WA2 X;  3NBJ A;  1C82 A;  1OJO A;  3VDA A;  1TQU A;  3T2P A;  2WOH A;  3S4D A;  3WIR A;  1J0M A;  1SO0 A;  2WVX B;  3BS6 A;  3T0D A;  4FNR A;  1V7V A;  3A24 A;  3PGB A;  1TQW A; 
#chains in the Genus database with same CATH homology
 2WVY A;  3VD5 A;  1NSU A;  4J5T A;  4DUV A;  1JYV A;  3A0O A;  1L7K A;  2XHN A;  1HM3 A;  1NS7 A;  3T09 A;  2XSG A;  3Q1N A;  2CIS A;  3BLC A;  4BZF A;  1HMU A;  3VDB A;  1PX3 A;  1Z45 A;  2JKA A;  1X1H A;  3E80 A;  3J7H A;  1F4H A;  1MMY A;  3I3B A;  3MUZ 1;  3VSN A;  3AFL A;  4BZG A;  3IMH A;  4BZE A;  4NEI A;  1MMX A;  4AQ0 A;  4OJZ A;  1JZ6 A;  4OK2 A;  2ZQ0 A;  1OJP A;  3MUY 1;  1I8Q A;  1RWH A;  1NKG A;  1RWG A;  1YQ2 A;  2HTA A;  3DCD A;  1YGA A;  1JZ2 A;  3I3D A;  3NJV A;  1HM2 A;  3VD7 A;  1NSV A;  3E7J A;  1NS4 A;  1K1W A;  4FNV A;  2Q1F A;  2HTB A;  2WW2 A;  2WVZ A;  1DP0 A;  2CIQ A;  3SEP A;  3K25 A;  2BRP A;  1RWC A;  2E22 A;  1LXK A;  3T2Q A;  4TTG A;  1JYW A;  2WDA A;  1LXM A;  3E1F 1;  2X03 A;  1LF9 A;  1N7O A;  2BRV X;  1OJM A;  1MMU A;  1RW9 A;  4DUW A;  1X1I A;  2WW1 A;  1LF6 A;  3VSM A;  1LUR A;  3IAQ A;  1MMZ A;  3MV1 1;  2BRW A;  2ZXQ A;  1NSM A;  1JZ7 A;  4MMH A;  4BZH A;  3OB8 A;  3MWX A;  3OBA A;  3WFA A;  1NS0 A;  1W3Y A;  3ECQ A;  2JKE A;  2D73 A;  3DEC A;  3T0B A;  3T08 A;  1ULV A;  2JKP A;  3NRE A;  1NS2 A;  1N7R A;  1TXK A;  1CB8 A;  1SNZ A;  1LOH A;  1K1X A;  3WVF A;  3DYO A;  1UG9 A;  2WCO A;  1JZ5 A;  1N7N A;  2FUT A;  2WW3 A;  2FUQ A;  1OJN A;  1RWA A;  3CZJ A;  3IAP A;  3MV0 1;  1MN0 A;  1RWF A;  2WW0 A;  1NSX A;  1NSZ A;  3TY1 A;  2CIR A;  1K1Y A;  5JMF A;  1HN1 A;  5A1A A;  1EGU A;  1JZ3 A;  2E24 A;  3VD4 A;  1JYX A;  3VD3 A;  1NSS A;  1L7J A;  1NSR A;  1JZ4 A;  1JYN A;  1HMW A;  4MMI A;  1F1S A;  3DYP A;  3VD9 A;  1X1J A;  2WZS A;  3OS7 A;  3T2O A;  1C82 A;  1F9G A;  1OJO A;  3I3E A;  5E1Q A;  3VDC A;  4DUX A;  3DYM A;  3VDA A;  1JZ8 A;  1HN0 A;  4OK4 A;  4RNL A;  3T2P A;  5JMD A;  3T0A A;  2WVX A;  3NJX A;  1F4A A;  1N7P A;  1N7Q A;  1J0M A;  1PX4 A;  1SO0 A;  2WVX B;  1JOV A;  3BS6 A;  3T0D A;  1NS8 A;  3A24 A;  1J0N A;  3BGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...