1NS2A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns2A00
1YQ2A 1C82A 1RW9A 1JZ3A 2WVYA 3I3EA 1LF6A 1MMYA 1TXKA 1NS8A 2JKEA 1RWAA 2WDAA 3IAQA 1NS2A 2WCOA 3DYOA 2BRVX 1HN0A 1OJOA 1ULVA 2JKPA 1YGAA 3VD7A 1SNZA 1Z45A 1N7OA 1CB8A 1MMXA 3DECA 3I3BA 3MV11 3SEPA 1JZ5A 1K1WA 1JYWA 1HMWA 2ZXQA 1HMUA 3NJXA 1LOHA 1NKGA 3J7HA 3MV01 1UG9A 1X1HA 3NREA 1JZ4A 2BRPA 2HTAA 3DYPA 1RWFA 1NSUA 4DUVA 1JZ2A 1K1YA 2E24A 1N7RA 1JZ7A 1K1XA 2WVXB 1F1SA 1W3YA 5E1QA 3T0AA 4BZHA 2WVXA 1LXMA 1EGUA 1OJMA 1HM2A 2WW3A 1X1IA 3T0BA 3OS7A 1LXKA 1L7KA 1OJPA 1X1JA 3MUY1 1N7NA 2CISA 1RWCA 3VDBA 1RWGA 1F9GA 1OJNA 2BRWA 1NS4A 4BZFA 3K25A 1N7PA 4AQ0A 3T2PA 1JZ6A 3T2QA 1LURA 2WZSA 4TTGA 1F4HA 1DP0A 1JYNA 1JYXA 2WW1A 3I3DA 3VD4A 1I8QA 4BZGA 3IMHA 1NS7A 1NSMA 2ZQ0A 1SO0A 3DYMA 3WFAA 1HM3A 1PX3A 3T2OA 1F4AA 1JYVA 1RWHA 1JZ8A 2Q1FA 3OB8A 1NS0A 2XHNA 1NSVA 1MN0A 3VDCA 3CZJA 3VDAA 1MMUA 4RNLA 4DUWA 2WW2A 3T08A 3MUZ1 1J0NA 2WVZA 3IAPA 2XSGA 3DCDA 2HTBA 3VD9A 1NSXA 2E22A 4DUXA 1JOVA 1LF9A 3OBAA 1NSZA 1J0MA 1PX4A 2CIQA 1NSRA 3VD5A 1N7QA 3A24A 3T0DA 3Q1NA 1NSSA 2JKAA 1L7JA 2X03A 4BZEA 3ECQA 2WW0A 3E1F1 2D73A 3BGAA 2CIRA 1HN1A 1MMZA 5A1AA 3VD3A 3NJVA 3MWXA 3T09A
chains in the Genus database with same CATH superfamily
2WOHA 2RDYA 2CFKA 2CWUA 1TXKA 4MMHA 3WIRA 1V7WA 3MPHA 1W6CA 1HN0A 1ULVA 3VD7A 1PU4A 1SNZA 3DDGA 3KIIA 3DECA 3SEPA 4BTWA 1K1WA 4J5TA 1HMUA 3BS6A 3D52A 1IVWA 1D6ZA 3DYPA 5GW7A 3WIQA 1SPUA 1K1XA 3E80A 3T0AA 3W7XA 1RJOA 2CWTA 3AFLA 1OJMA 1X1IA 3OS7A 3SX1A 1LXKA 2CFWA 3BVTA 3D50A 1L7KA 1OJPA 1IU7A 3W7UA 3VDBA 1RWGA 2BRWA 1NS4A 4KFDA 3BUQA 2WO0A 3T2QA 2CFLA 1D6YA 2WZSA 1JYNA 2EAEA 1NS7A 3S4DA 2ZQ0A 2XN0A 2WOFA 2CFDA 1V7VA 2FUQA 3OB8A 1NS0A 1MN0A 3VDCA 1MMUA 4DUWA 3MUZ1 1RKYA 3X3XA 2YX9A 2XSGA 5CA3A 1NSXA 2OW7A 3QFYA 4DUXA 3CZNA 4EV2A 3QFZA 4OK4A 1SIIA 4FNVA 2XN2A 3E1F1 1TQUA 1QAFA 5A1AA 2OOVA 2E2UA 3EJPA 3NJVA 1YQ2A 3E7JA 4OJZA 1O7DD 3DX2A 2XN1A 2F7QA 1TQTA 2EACA 3X40A 1JZ3A 1LF6A 1MMYA 2F7OA 2JKEA 1RWAA 1WMOA 4K35A 1UI8A 3ACTA 3IAQA 2BRVX 1W4NA 3HIIA 1TU5A 1YGAA 3D4ZA 2C10A 1MMXA 3A0OA 1QAKA 2OW6A 2W0QA 1JZ5A 1WMNA 1W6GA 3BVVA 3NJXA 3NBJA 3NREA 1JZ4A 2HTAA 3BUIA 1RWFA 4K3AA 3VSNA 2Y74A 2OQEC 1JZ7A 2F7RA 2F18A 1F1SA 1W2ZA 3X3ZA 2YFNA 3T0BA 1QX1A 1IQYA 3DX1A 1F9GA 5JMFA 2WYIA 4OK2A 2Y73A 4AQ0A 3N9HA 3X42A 1LURA 1DP0A 5JMDA 1JYXA 3I3DA 3S4AA 1NSMA 2CQTA 2CG1A 3AMOB 1JZ8A 2Q1FA 3CZJA 3T0UA 4RNLA 2WW2A 1HXKA 2C11A 3DCDA 2HTBA 1JOVA 1LF9A 4BTXA 3DX4A 3OBAA 1NSZA 1J0MA 1QWUA 4KTRA 1PX4A 1NSRA 3VD5A 4FNPA 1WMPA 1NSSA 2JKAA 1L7JA 2D73A 2CIRA 2F7PA 1HN1A 3SXXA 1IQXA 3NBBA 1AVLA 1UI7A 3LOYA 3BLCA 1TQWA 3EJTA 3BUBA 3BUPA 4FNTA 3X3YA 3I3EA 1V7XA 3K5TA 3CZSA 1TQSA 2WDAA 3AMOA 1KSIA 1AV4A 1SIHA 2E2VA 3DYOA 3EJQA 2JKPA 3AFJA 3EJSA 1Z45A 3QDEA 1CB8A 3I3BA 1R34A 2BT3A 2OOVC 3WA2X 1HMWA 4FNUA 1LOHA 3J7HA 3MV01 1UG9A 1X1HA 3BVWA 1JZ2A 4DUVA 1K1YA 2E24A 2ZL8A 4KTPA 2CG0A 1W3YA 3LVTA 5E1QA 4FNRA 4BTYA 1LXMA 3MI6A 4EV5A 1HM2A 1DYUA 2EADA 2OQEA 3RRSA 3MUY1 1N7NA 3HIGA 2E2TA 1RWCA 4NEIA 3CV5A 4BZFA 3K25A 1JZ6A 1US1A 1IVVA 4TTGA 1F4HA 4BZGA 3DYMA 3ACSA 3WFAA 3T2OA 3HI7A 1RWHA 4FNQA 2XHNA 1NSVA 3TY1A 1HTYA 1D6UA 1J0NA 1QWNA 3IAPA 2WYHA 3WVFA 3BVXA 2CIQA 3S4BA 3ALAA 2EABA 2X03A 4KFEA 4BZEA 3ECQA 2WW0A 1N9EA 2CQSA 3DX3A 1MMZA 3KN4A 3VD3A 3MWXA 1C82A 1IVXA 2CWVA 3W7TA 2F1AA 1PS3A 3S4CA 1RW9A 2WVYA 1NS8A 1NS2A 5KBPA 2WCOA 1OJOA 4KFFA 1IVUA 3EJRA 1AVKA 1N7OA 2D1WA 3MV11 1TQVA 1JYWA 2ZXQA 3BUDA 2F1BA 1NKGA 1OACA 3BVUA 2FUTA 2BRPA 1JRQA 2CFGA 2YFOA 3WA3A 1NSUA 1N7RA 2WVXB 1QALA 3VSMA 4BZHA 2PNCA 2WVXA 1EKMA 1EGUA 2WW3A 3D4YA 3QG0A 3DDFA 1LVNA 1X1JA 2CISA 2ALWA 1OJNA 3D3IA 1N7PA 1W5ZA 3T2PA 1R33A 2WW1A 3PGBA 3VD4A 1I8QA 3IMHA 1SO0A 1HM3A 1H54A 1PX3A 3BLBA 4UFCA 1F4AA 1JYVA 1A2VA 4FNSA 3EJUA 3VDAA 3W7SA 3T08A 3X41A 3RSYA 2WVZA 1HWWA 3VD9A 2E22A 2FYVA 3D51A 3W7WA 1N7QA 3A24A 3T0DA 3Q1NA 2WGQA 3BGAA 4MMIA 3DX0A 1W7CA 3T09A
chains in the Genus database with same CATH topology
1YQ2A 3E7JA 1C82A 4OJZA 1RW9A 1JZ3A 2WVYA 3I3EA 1LF6A 1MMYA 1TXKA 1NS8A 4MMHA 2JKEA 1RWAA 2WDAA 3IAQA 1NS2A 2WCOA 3DYOA 2BRVX 1HN0A 1OJOA 1ULVA 2JKPA 1YGAA 3VD7A 1SNZA 1Z45A 1N7OA 1CB8A 1MMXA 3A0OA 3DECA 3I3BA 3MV11 3SEPA 1K1WA 1JZ5A 1JYWA 1HMWA 2ZXQA 4J5TA 1HMUA 3NJXA 1LOHA 1NKGA 3J7HA 3MV01 1UG9A 2FUTA 3BS6A 1X1HA 3NREA 1JZ4A 2BRPA 2HTAA 3DYPA 1RWFA 1NSUA 4DUVA 1JZ2A 1K1YA 2E24A 1N7RA 3VSNA 1JZ7A 1K1XA 3E80A 2WVXB 1F1SA 1W3YA 5E1QA 3T0AA 3VSMA 4BZHA 2WVXA 1LXMA 3AFLA 1EGUA 1OJMA 1HM2A 2WW3A 1X1IA 3T0BA 3OS7A 1LXKA 1L7KA 1OJPA 1X1JA 3MUY1 1N7NA 2CISA 1RWCA 3VDBA 4NEIA 1RWGA 1F9GA 1OJNA 5JMFA 4OK2A 2BRWA 1NS4A 4BZFA 3K25A 1N7PA 4AQ0A 3T2PA 1JZ6A 3T2QA 1LURA 2WZSA 4TTGA 1F4HA 1DP0A 1JYNA 5JMDA 1JYXA 2WW1A 3I3DA 3VD4A 1I8QA 4BZGA 3IMHA 1NS7A 1NSMA 2ZQ0A 1SO0A 3DYMA 3WFAA 1HM3A 1PX3A 3T2OA 1F4AA 1JYVA 2FUQA 1RWHA 1JZ8A 2Q1FA 3OB8A 1NS0A 2XHNA 1NSVA 1MN0A 3TY1A 3VDCA 3CZJA 3VDAA 1MMUA 4RNLA 4DUWA 2WW2A 3T08A 3MUZ1 1J0NA 2WVZA 3IAPA 2XSGA 3DCDA 2HTBA 3VD9A 1NSXA 2E22A 4DUXA 1JOVA 1LF9A 3WVFA 3OBAA 1NSZA 1J0MA 4OK4A 1PX4A 4FNVA 2CIQA 1NSRA 3VD5A 1N7QA 3A24A 3T0DA 3Q1NA 1NSSA 2JKAA 1L7JA 2X03A 4BZEA 3ECQA 2WW0A 3E1F1 2D73A 3BGAA 2CIRA 1HN1A 1MMZA 5A1AA 4MMIA 3VD3A 3NJVA 3MWXA 3BLCA 3T09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ2 A;  1C82 A;  1RW9 A;  1JZ3 A;  2WVY A;  3I3E A;  1LF6 A;  1MMY A;  1TXK A;  1NS8 A;  2JKE A;  1RWA A;  2WDA A;  3IAQ A;  1NS2 A;  2WCO A;  3DYO A;  2BRV X;  1HN0 A;  1OJO A;  1ULV A;  2JKP A;  1YGA A;  3VD7 A;  1SNZ A;  1Z45 A;  1N7O A;  1CB8 A;  1MMX A;  3DEC A;  3I3B A;  3MV1 1;  3SEP A;  1JZ5 A;  1K1W A;  1JYW A;  1HMW A;  2ZXQ A;  1HMU A;  3NJX A;  1LOH A;  1NKG A;  3J7H A;  3MV0 1;  1UG9 A;  1X1H A;  3NRE A;  1JZ4 A;  2BRP A;  2HTA A;  3DYP A;  1RWF A;  1NSU A;  4DUV A;  1JZ2 A;  1K1Y A;  2E24 A;  1N7R A;  1JZ7 A;  1K1X A;  2WVX B;  1F1S A;  1W3Y A;  5E1Q A;  3T0A A;  4BZH A;  2WVX A;  1LXM A;  1EGU A;  1OJM A;  1HM2 A;  2WW3 A;  1X1I A;  3T0B A;  3OS7 A;  1LXK A;  1L7K A;  1OJP A;  1X1J A;  3MUY 1;  1N7N A;  2CIS A;  1RWC A;  3VDB A;  1RWG A;  1F9G A;  1OJN A;  2BRW A;  1NS4 A;  4BZF A;  3K25 A;  1N7P A;  4AQ0 A;  3T2P A;  1JZ6 A;  3T2Q A;  1LUR A;  2WZS A;  4TTG A;  1F4H A;  1DP0 A;  1JYN A;  1JYX A;  2WW1 A;  3I3D A;  3VD4 A;  1I8Q A;  4BZG A;  3IMH A;  1NS7 A;  1NSM A;  2ZQ0 A;  1SO0 A;  3DYM A;  3WFA A;  1HM3 A;  1PX3 A;  3T2O A;  1F4A A;  1JYV A;  1RWH A;  1JZ8 A;  2Q1F A;  3OB8 A;  1NS0 A;  2XHN A;  1NSV A;  1MN0 A;  3VDC A;  3CZJ A;  3VDA A;  1MMU A;  4RNL A;  4DUW A;  2WW2 A;  3T08 A;  3MUZ 1;  1J0N A;  2WVZ A;  3IAP A;  2XSG A;  3DCD A;  2HTB A;  3VD9 A;  1NSX A;  2E22 A;  4DUX A;  1JOV A;  1LF9 A;  3OBA A;  1NSZ A;  1J0M A;  1PX4 A;  2CIQ A;  1NSR A;  3VD5 A;  1N7Q A;  3A24 A;  3T0D A;  3Q1N A;  1NSS A;  2JKA A;  1L7J A;  2X03 A;  4BZE A;  3ECQ A;  2WW0 A;  3E1F 1;  2D73 A;  3BGA A;  2CIR A;  1HN1 A;  1MMZ A;  5A1A A;  3VD3 A;  3NJV A;  3MWX A;  3T09 A; 
#chains in the Genus database with same CATH topology
 2WOH A;  2RDY A;  2CFK A;  2CWU A;  1TXK A;  4MMH A;  3WIR A;  1V7W A;  3MPH A;  1W6C A;  1HN0 A;  1ULV A;  3VD7 A;  1PU4 A;  1SNZ A;  3DDG A;  3KII A;  3DEC A;  3SEP A;  4BTW A;  1K1W A;  4J5T A;  1HMU A;  3BS6 A;  3D52 A;  1IVW A;  1D6Z A;  3DYP A;  5GW7 A;  3WIQ A;  1SPU A;  1K1X A;  3E80 A;  3T0A A;  3W7X A;  1RJO A;  2CWT A;  3AFL A;  1OJM A;  1X1I A;  3OS7 A;  3SX1 A;  1LXK A;  2CFW A;  3BVT A;  3D50 A;  1L7K A;  1OJP A;  1IU7 A;  3W7U A;  3VDB A;  1RWG A;  2BRW A;  1NS4 A;  4KFD A;  3BUQ A;  2WO0 A;  3T2Q A;  2CFL A;  1D6Y A;  2WZS A;  1JYN A;  2EAE A;  1NS7 A;  3S4D A;  2ZQ0 A;  2XN0 A;  2WOF A;  2CFD A;  1V7V A;  2FUQ A;  3OB8 A;  1NS0 A;  1MN0 A;  3VDC A;  1MMU A;  4DUW A;  3MUZ 1;  1RKY A;  3X3X A;  2YX9 A;  2XSG A;  5CA3 A;  1NSX A;  2OW7 A;  3QFY A;  4DUX A;  3CZN A;  4EV2 A;  3QFZ A;  4OK4 A;  1SII A;  4FNV A;  2XN2 A;  3E1F 1;  1TQU A;  1QAF A;  5A1A A;  2OOV A;  2E2U A;  3EJP A;  3NJV A;  1YQ2 A;  3E7J A;  4OJZ A;  1O7D D;  3DX2 A;  2XN1 A;  2F7Q A;  1TQT A;  2EAC A;  3X40 A;  1JZ3 A;  1LF6 A;  1MMY A;  2F7O A;  2JKE A;  1RWA A;  1WMO A;  4K35 A;  1UI8 A;  3ACT A;  3IAQ A;  2BRV X;  1W4N A;  3HII A;  1TU5 A;  1YGA A;  3D4Z A;  2C10 A;  1MMX A;  3A0O A;  1QAK A;  2OW6 A;  2W0Q A;  1JZ5 A;  1WMN A;  1W6G A;  3BVV A;  3NJX A;  3NBJ A;  3NRE A;  1JZ4 A;  2HTA A;  3BUI A;  1RWF A;  4K3A A;  3VSN A;  2Y74 A;  2OQE C;  1JZ7 A;  2F7R A;  2F18 A;  1F1S A;  1W2Z A;  3X3Z A;  2YFN A;  3T0B A;  1QX1 A;  1IQY A;  3DX1 A;  1F9G A;  5JMF A;  2WYI A;  4OK2 A;  2Y73 A;  4AQ0 A;  3N9H A;  3X42 A;  1LUR A;  1DP0 A;  5JMD A;  1JYX A;  3I3D A;  3S4A A;  1NSM A;  2CQT A;  2CG1 A;  3AMO B;  1JZ8 A;  2Q1F A;  3CZJ A;  3T0U A;  4RNL A;  2WW2 A;  1HXK A;  2C11 A;  3DCD A;  2HTB A;  1JOV A;  1LF9 A;  4BTX A;  3DX4 A;  3OBA A;  1NSZ A;  1J0M A;  1QWU A;  4KTR A;  1PX4 A;  1NSR A;  3VD5 A;  4FNP A;  1WMP A;  1NSS A;  2JKA A;  1L7J A;  2D73 A;  2CIR A;  2F7P A;  1HN1 A;  3SXX A;  1IQX A;  3NBB A;  1AVL A;  1UI7 A;  3LOY A;  3BLC A;  1TQW A;  3EJT A;  3BUB A;  3BUP A;  4FNT A;  3X3Y A;  3I3E A;  1V7X A;  3K5T A;  3CZS A;  1TQS A;  2WDA A;  3AMO A;  1KSI A;  1AV4 A;  1SIH A;  2E2V A;  3DYO A;  3EJQ A;  2JKP A;  3AFJ A;  3EJS A;  1Z45 A;  3QDE A;  1CB8 A;  3I3B A;  1R34 A;  2BT3 A;  2OOV C;  3WA2 X;  1HMW A;  4FNU A;  1LOH A;  3J7H A;  3MV0 1;  1UG9 A;  1X1H A;  3BVW A;  1JZ2 A;  4DUV A;  1K1Y A;  2E24 A;  2ZL8 A;  4KTP A;  2CG0 A;  1W3Y A;  3LVT A;  5E1Q A;  4FNR A;  4BTY A;  1LXM A;  3MI6 A;  4EV5 A;  1HM2 A;  1DYU A;  2EAD A;  2OQE A;  3RRS A;  3MUY 1;  1N7N A;  3HIG A;  2E2T A;  1RWC A;  4NEI A;  3CV5 A;  4BZF A;  3K25 A;  1JZ6 A;  1US1 A;  1IVV A;  4TTG A;  1F4H A;  4BZG A;  3DYM A;  3ACS A;  3WFA A;  3T2O A;  3HI7 A;  1RWH A;  4FNQ A;  2XHN A;  1NSV A;  3TY1 A;  1HTY A;  1D6U A;  1J0N A;  1QWN A;  3IAP A;  2WYH A;  3WVF A;  3BVX A;  2CIQ A;  3S4B A;  3ALA A;  2EAB A;  2X03 A;  4KFE A;  4BZE A;  3ECQ A;  2WW0 A;  1N9E A;  2CQS A;  3DX3 A;  1MMZ A;  3KN4 A;  3VD3 A;  3MWX A;  1C82 A;  1IVX A;  2CWV A;  3W7T A;  2F1A A;  1PS3 A;  3S4C A;  1RW9 A;  2WVY A;  1NS8 A;  1NS2 A;  5KBP A;  2WCO A;  1OJO A;  4KFF A;  1IVU A;  3EJR A;  1AVK A;  1N7O A;  2D1W A;  3MV1 1;  1TQV A;  1JYW A;  2ZXQ A;  3BUD A;  2F1B A;  1NKG A;  1OAC A;  3BVU A;  2FUT A;  2BRP A;  1JRQ A;  2CFG A;  2YFO A;  3WA3 A;  1NSU A;  1N7R A;  2WVX B;  1QAL A;  3VSM A;  4BZH A;  2PNC A;  2WVX A;  1EKM A;  1EGU A;  2WW3 A;  3D4Y A;  3QG0 A;  3DDF A;  1LVN A;  1X1J A;  2CIS A;  2ALW A;  1OJN A;  3D3I A;  1N7P A;  1W5Z A;  3T2P A;  1R33 A;  2WW1 A;  3PGB A;  3VD4 A;  1I8Q A;  3IMH A;  1SO0 A;  1HM3 A;  1H54 A;  1PX3 A;  3BLB A;  4UFC A;  1F4A A;  1JYV A;  1A2V A;  4FNS A;  3EJU A;  3VDA A;  3W7S A;  3T08 A;  3X41 A;  3RSY A;  2WVZ A;  1HWW A;  3VD9 A;  2E22 A;  2FYV A;  3D51 A;  3W7W A;  1N7Q A;  3A24 A;  3T0D A;  3Q1N A;  2WGQ A;  3BGA A;  4MMI A;  3DX0 A;  1W7C A;  3T09 A; 
#chains in the Genus database with same CATH homology
 1YQ2 A;  3E7J A;  1C82 A;  4OJZ A;  1RW9 A;  1JZ3 A;  2WVY A;  3I3E A;  1LF6 A;  1MMY A;  1TXK A;  1NS8 A;  4MMH A;  2JKE A;  1RWA A;  2WDA A;  3IAQ A;  1NS2 A;  2WCO A;  3DYO A;  2BRV X;  1HN0 A;  1OJO A;  1ULV A;  2JKP A;  1YGA A;  3VD7 A;  1SNZ A;  1Z45 A;  1N7O A;  1CB8 A;  1MMX A;  3A0O A;  3DEC A;  3I3B A;  3MV1 1;  3SEP A;  1K1W A;  1JZ5 A;  1JYW A;  1HMW A;  2ZXQ A;  4J5T A;  1HMU A;  3NJX A;  1LOH A;  1NKG A;  3J7H A;  3MV0 1;  1UG9 A;  2FUT A;  3BS6 A;  1X1H A;  3NRE A;  1JZ4 A;  2BRP A;  2HTA A;  3DYP A;  1RWF A;  1NSU A;  4DUV A;  1JZ2 A;  1K1Y A;  2E24 A;  1N7R A;  3VSN A;  1JZ7 A;  1K1X A;  3E80 A;  2WVX B;  1F1S A;  1W3Y A;  5E1Q A;  3T0A A;  3VSM A;  4BZH A;  2WVX A;  1LXM A;  3AFL A;  1EGU A;  1OJM A;  1HM2 A;  2WW3 A;  1X1I A;  3T0B A;  3OS7 A;  1LXK A;  1L7K A;  1OJP A;  1X1J A;  3MUY 1;  1N7N A;  2CIS A;  1RWC A;  3VDB A;  4NEI A;  1RWG A;  1F9G A;  1OJN A;  5JMF A;  4OK2 A;  2BRW A;  1NS4 A;  4BZF A;  3K25 A;  1N7P A;  4AQ0 A;  3T2P A;  1JZ6 A;  3T2Q A;  1LUR A;  2WZS A;  4TTG A;  1F4H A;  1DP0 A;  1JYN A;  5JMD A;  1JYX A;  2WW1 A;  3I3D A;  3VD4 A;  1I8Q A;  4BZG A;  3IMH A;  1NS7 A;  1NSM A;  2ZQ0 A;  1SO0 A;  3DYM A;  3WFA A;  1HM3 A;  1PX3 A;  3T2O A;  1F4A A;  1JYV A;  2FUQ A;  1RWH A;  1JZ8 A;  2Q1F A;  3OB8 A;  1NS0 A;  2XHN A;  1NSV A;  1MN0 A;  3TY1 A;  3VDC A;  3CZJ A;  3VDA A;  1MMU A;  4RNL A;  4DUW A;  2WW2 A;  3T08 A;  3MUZ 1;  1J0N A;  2WVZ A;  3IAP A;  2XSG A;  3DCD A;  2HTB A;  3VD9 A;  1NSX A;  2E22 A;  4DUX A;  1JOV A;  1LF9 A;  3WVF A;  3OBA A;  1NSZ A;  1J0M A;  4OK4 A;  1PX4 A;  4FNV A;  2CIQ A;  1NSR A;  3VD5 A;  1N7Q A;  3A24 A;  3T0D A;  3Q1N A;  1NSS A;  2JKA A;  1L7J A;  2X03 A;  4BZE A;  3ECQ A;  2WW0 A;  3E1F 1;  2D73 A;  3BGA A;  2CIR A;  1HN1 A;  1MMZ A;  5A1A A;  4MMI A;  3VD3 A;  3NJV A;  3MWX A;  3BLC A;  3T09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...