1NS2A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns2A00
1RWGA 1YQ2A 2ZXQA 2XSGA 3T0AA 3T2PA 3BGAA 1Z45A 3T2OA 1N7OA 3NJVA 1NKGA 1OJPA 2WDAA 3NJXA 1RW9A 1N7PA 2BRWA 1J0MA 2ZQ0A 3SEPA 1SO0A 1F1SA 3IAQA 3OS7A 1EGUA 3T08A 4AQ0A 4BZGA 4DUWA 3VD3A 3VD4A 1K1WA 1TXKA 1LOHA 3DYOA 1HM3A 3K25A 4DUXA 3I3EA 3DYMA 1CB8A 5E1QA 1JZ4A 1F4HA 1W3YA 2WVXA 3Q1NA 1HM2A 1NS2A 3IMHA 3T2QA 1NS0A 2CISA 1MN0A 1X1HA 2WW1A 1HN0A 2HTBA 1JZ2A 3VDBA 4BZFA 1J0NA 1C82A 1YGAA 2XHNA 1NSZA 4TTGA 3MV11 1X1JA 3I3DA 2D73A 1JZ8A 2JKPA 1F4AA 3OB8A 3VD7A 2Q1FA 3VD9A 1JZ7A 3DECA 2WVXB 1PX4A 1L7JA 1JYXA 3I3BA 1N7QA 2WVZA 1OJOA 3T0DA 3MWXA 1K1XA 2E24A 1OJNA 3MV01 1MMYA 2CIQA 2JKEA 2WW2A 1NS7A 3A24A 2BRPA 2E22A 3T0BA 2HTAA 1LF6A 1SNZA 1HMUA 3DYPA 1JZ6A 1JZ5A 1RWFA 3E1F1 3VDAA 1X1IA 3VD5A 1JYWA 1NSVA 3WFAA 1HN1A 2WZSA 1MMZA 3ECQA 3IAPA 1LURA 1JYNA 2BRVX 1I8QA 1NSSA 1OJMA 3OBAA 1LXKA 1NSUA 2JKAA 3VDCA 1JOVA 3T09A 1LXMA 1NS8A 2WW0A 1ULVA 1MMXA 1RWAA 1MMUA 2X03A 1N7RA 4BZHA 1JYVA 1K1YA 1N7NA 1NSRA 1RWCA 3J7HA 1LF9A 1NS4A 3NREA 4RNLA 4BZEA 1RWHA 4DUVA 1F9GA 1JZ3A 1PX3A 1DP0A 2CIRA 2WW3A 1HMWA 1L7KA 1NSXA 1UG9A 3MUY1 3DCDA 2WVYA 3MUZ1 1NSMA 3CZJA 2WCOA 5A1AA
chains in the Genus database with same CATH superfamily
3BVXA 1IVXA 2F1BA 2OW6A 3BGAA 1Z45A 2WDAA 1N7PA 3BVVA 3SEPA 2ZQ0A 2FUQA 3IAQA 3DDFA 4EV2A 1LOHA 3W7UA 3K5TA 1WMPA 1QALA 4DUXA 5E1QA 2YFOA 4BTWA 3IMHA 2OOVA 3T2QA 1NS0A 1HN0A 1YGAA 1NSZA 4TTGA 3WIRA 3X3XA 2D1WA 4EV5A 3D4ZA 3I3DA 3N9HA 3BUBA 3AFLA 3W7WA 2ALWA 1SIHA 2Q1FA 3VD9A 3DX3A 1WMOA 3X42A 1OJOA 2F7QA 3S4AA 2BT3A 2EADA 3QFYA 4FNRA 3BLCA 3ACTA 2E22A 3T0BA 2HTAA 2WGQA 4KTPA 3AFJA 1JZ6A 2OQEC 2XN2A 2XN0A 1W7CA 1X1IA 2FYVA 1LVNA 3PGBA 1HN1A 1MMZA 3S4CA 2OW7A 2YFNA 1NSSA 2EACA 1OJMA 2JKAA 1IQXA 2YX9A 1HWWA 1MMXA 3DX1A 1JYVA 1N7NA 3EJTA 1RWCA 1LF9A 3X41A 4BZEA 4DUVA 3WA2X 1JZ3A 1L7KA 1NSXA 4UFCA 3NJXA 3KN4A 2F1AA 2ZXQA 2W0QA 3T2PA 5KBPA 2CFKA 3T2OA 4KFFA 1HTYA 3NJVA 1D6ZA 1IQYA 1QX1A 2BRWA 4FNQA 1V7WA 3OS7A 1TXKA 1IVVA 1JRQA 3RRSA 2ZL8A 3WIQA 4BTXA 3LVTA 2OQEA 1CB8A 1W3YA 3Q1NA 3S4DA 2F7OA 4OK4A 2WW1A 1QAKA 3VDBA 4BZFA 1J0NA 1PU4A 3VSNA 1X1JA 2PNCA 3D50A 3VD7A 3DX0A 3E80A 1US1A 1L7JA 1N7QA 2WVZA 3T0DA 1K1XA 1OJNA 3MV01 3W7TA 1A2VA 1MMYA 2CIQA 2WYIA 2BRPA 1W6CA 1LF6A 1SNZA 3T0UA 3A0OA 4MMHA 3CZSA 3VDAA 3WFAA 3HIGA 1V7VA 1UI7A 3IAPA 1EKMA 3WA3A 3OBAA 1LXKA 3VDCA 3T09A 1NS8A 2X03A 5CA3A 4BZHA 1K1YA 1NSRA 3NREA 3J7HA 2Y73A 3KIIA 3RSYA 1PX3A 3MUY1 3BLBA 2WVYA 3ALAA 3QG0A 2CG1A 4BTYA 3CZJA 1TQSA 1YQ2A 4K3AA 1RKYA 3SXXA 3T0AA 1W2ZA 1AV4A 1N7OA 1NKGA 1W4NA 2E2TA 3BVUA 1F1SA 3EJPA 4AQ0A 3VD4A 1IVUA 1K1WA 3K25A 2CWVA 2F18A 3BUIA 3D52A 2WVXA 2EABA 1NS2A 3NBBA 2CISA 5JMDA 1JZ2A 3D3IA 5GW7A 3QFZA 1C82A 3D51A 2XHNA 1W6GA 3BS6A 4FNPA 3DX2A 3BUQA 2OOVC 2D73A 1H54A 2JKPA 1F4AA 2CFDA 2CWUA 3OB8A 1JZ7A 3DECA 2WVXB 1PX4A 3AMOA 1SIIA 3CZNA 2WYHA 2WW2A 1NS7A 3A24A 1R33A 1HMUA 3HIIA 4MMIA 2RDYA 4OJZA 2WO0A 4KTRA 3X3ZA 1QWNA 3E1F1 1SPUA 3AMOB 3VD5A 1JYWA 1QAFA 2CFWA 1LURA 1JYNA 3D4YA 1NSUA 3W7SA 2CWTA 1JOVA 2F7RA 2WW0A 1ULVA 1TU5A 4KFDA 1N7RA 4NEIA 1TQUA 3VSMA 1NS4A 3DX4A 3SX1A 1F9GA 1N9EA 1R34A 4FNVA 2CFGA 3EJQA 3DDGA 1NSMA 2WCOA 5A1AA 1RWGA 5JMFA 1UI8A 2XSGA 1AVKA 1QWUA 3W7XA 1OJPA 1RW9A 2CQSA 4FNSA 2EAEA 2WOFA 4FNTA 1J0MA 1SO0A 1EGUA 1HXKA 3T08A 4BZGA 4DUWA 3VD3A 3ACSA 3TY1A 3DYOA 1HM3A 3LOYA 3E7JA 3I3EA 2CQTA 2E2UA 2E2VA 3DYMA 1JZ4A 2Y74A 1F4HA 1HM2A 1MN0A 1X1HA 2HTBA 1W5ZA 3BUPA 3EJRA 2F7PA 3BVTA 3MV11 1JZ8A 3BUDA 4J5TA 1IU7A 3HI7A 2CG0A 2C11A 1JYXA 2CFLA 3I3BA 3MWXA 3X3YA 2E24A 3X40A 4KFEA 2JKEA 3DYPA 1JZ5A 1RWFA 1AVLA 2WOHA 1TQVA 1WMNA 1IVWA 2FUTA 1D6YA 3CV5A 4K35A 1NSVA 2WZSA 2C10A 2XN1A 3EJUA 3ECQA 3NBJA 4OK2A 1OACA 1D6UA 2BRVX 1PS3A 1I8QA 1V7XA 3S4BA 1LXMA 3WVFA 1RWAA 3MI6A 1MMUA 1RJOA 4FNUA 4RNLA 1DYUA 1KSIA 1RWHA 3BVWA 3EJSA 3QDEA 1TQTA 1DP0A 2CIRA 2WW3A 1HMWA 1UG9A 3MPHA 1TQWA 3DCDA 3MUZ1 1O7DD
chains in the Genus database with same CATH topology
1RWGA 1YQ2A 5JMFA 2ZXQA 2XSGA 3T0AA 3T2PA 3BGAA 1Z45A 3T2OA 1N7OA 3NJVA 1NKGA 1OJPA 2WDAA 3NJXA 1RW9A 1N7PA 2BRWA 1J0MA 2ZQ0A 3SEPA 2FUQA 1SO0A 1F1SA 3IAQA 3OS7A 1EGUA 3T08A 4AQ0A 4BZGA 4DUWA 3VD3A 3VD4A 1K1WA 3TY1A 1TXKA 1LOHA 3DYOA 1HM3A 3K25A 4DUXA 3E7JA 3I3EA 3DYMA 1CB8A 5E1QA 1JZ4A 1F4HA 1W3YA 2WVXA 3Q1NA 1HM2A 1NS2A 3IMHA 3T2QA 4OK4A 1NS0A 2CISA 1MN0A 1X1HA 2WW1A 1HN0A 2HTBA 5JMDA 1JZ2A 3VDBA 4BZFA 1J0NA 1C82A 1YGAA 2XHNA 1NSZA 4TTGA 3BS6A 3VSNA 3MV11 1X1JA 3I3DA 2D73A 1JZ8A 2JKPA 3AFLA 1F4AA 3OB8A 3VD7A 4J5TA 2Q1FA 3VD9A 1JZ7A 3DECA 2WVXB 1PX4A 3E80A 1L7JA 1JYXA 3I3BA 1N7QA 2WVZA 1OJOA 3T0DA 3MWXA 1K1XA 2E24A 1OJNA 3MV01 1MMYA 2CIQA 2JKEA 2WW2A 1NS7A 3A24A 2BRPA 2E22A 3BLCA 3T0BA 2HTAA 1LF6A 1SNZA 1HMUA 3A0OA 3DYPA 4MMIA 1JZ6A 1JZ5A 1RWFA 4MMHA 4OJZA 3E1F1 3VDAA 1X1IA 2FUTA 3VD5A 1JYWA 1NSVA 3WFAA 1HN1A 2WZSA 1MMZA 3ECQA 3IAPA 1LURA 4OK2A 1JYNA 2BRVX 1I8QA 1NSSA 1OJMA 3OBAA 1LXKA 1NSUA 2JKAA 3VDCA 1JOVA 3T09A 1LXMA 1NS8A 3WVFA 2WW0A 1ULVA 1MMXA 1RWAA 1MMUA 2X03A 1N7RA 4BZHA 4NEIA 1JYVA 1K1YA 1N7NA 1NSRA 1RWCA 3J7HA 1LF9A 1NS4A 3NREA 4RNLA 3VSMA 4BZEA 1RWHA 4DUVA 1F9GA 1JZ3A 1PX3A 1DP0A 2CIRA 4FNVA 2WW3A 1HMWA 1L7KA 1NSXA 1UG9A 3MUY1 3DCDA 2WVYA 3MUZ1 1NSMA 3CZJA 2WCOA 5A1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWG A;  1YQ2 A;  2ZXQ A;  2XSG A;  3T0A A;  3T2P A;  3BGA A;  1Z45 A;  3T2O A;  1N7O A;  3NJV A;  1NKG A;  1OJP A;  2WDA A;  3NJX A;  1RW9 A;  1N7P A;  2BRW A;  1J0M A;  2ZQ0 A;  3SEP A;  1SO0 A;  1F1S A;  3IAQ A;  3OS7 A;  1EGU A;  3T08 A;  4AQ0 A;  4BZG A;  4DUW A;  3VD3 A;  3VD4 A;  1K1W A;  1TXK A;  1LOH A;  3DYO A;  1HM3 A;  3K25 A;  4DUX A;  3I3E A;  3DYM A;  1CB8 A;  5E1Q A;  1JZ4 A;  1F4H A;  1W3Y A;  2WVX A;  3Q1N A;  1HM2 A;  1NS2 A;  3IMH A;  3T2Q A;  1NS0 A;  2CIS A;  1MN0 A;  1X1H A;  2WW1 A;  1HN0 A;  2HTB A;  1JZ2 A;  3VDB A;  4BZF A;  1J0N A;  1C82 A;  1YGA A;  2XHN A;  1NSZ A;  4TTG A;  3MV1 1;  1X1J A;  3I3D A;  2D73 A;  1JZ8 A;  2JKP A;  1F4A A;  3OB8 A;  3VD7 A;  2Q1F A;  3VD9 A;  1JZ7 A;  3DEC A;  2WVX B;  1PX4 A;  1L7J A;  1JYX A;  3I3B A;  1N7Q A;  2WVZ A;  1OJO A;  3T0D A;  3MWX A;  1K1X A;  2E24 A;  1OJN A;  3MV0 1;  1MMY A;  2CIQ A;  2JKE A;  2WW2 A;  1NS7 A;  3A24 A;  2BRP A;  2E22 A;  3T0B A;  2HTA A;  1LF6 A;  1SNZ A;  1HMU A;  3DYP A;  1JZ6 A;  1JZ5 A;  1RWF A;  3E1F 1;  3VDA A;  1X1I A;  3VD5 A;  1JYW A;  1NSV A;  3WFA A;  1HN1 A;  2WZS A;  1MMZ A;  3ECQ A;  3IAP A;  1LUR A;  1JYN A;  2BRV X;  1I8Q A;  1NSS A;  1OJM A;  3OBA A;  1LXK A;  1NSU A;  2JKA A;  3VDC A;  1JOV A;  3T09 A;  1LXM A;  1NS8 A;  2WW0 A;  1ULV A;  1MMX A;  1RWA A;  1MMU A;  2X03 A;  1N7R A;  4BZH A;  1JYV A;  1K1Y A;  1N7N A;  1NSR A;  1RWC A;  3J7H A;  1LF9 A;  1NS4 A;  3NRE A;  4RNL A;  4BZE A;  1RWH A;  4DUV A;  1F9G A;  1JZ3 A;  1PX3 A;  1DP0 A;  2CIR A;  2WW3 A;  1HMW A;  1L7K A;  1NSX A;  1UG9 A;  3MUY 1;  3DCD A;  2WVY A;  3MUZ 1;  1NSM A;  3CZJ A;  2WCO A;  5A1A A; 
#chains in the Genus database with same CATH topology
 3BVX A;  1IVX A;  2F1B A;  2OW6 A;  3BGA A;  1Z45 A;  2WDA A;  1N7P A;  3BVV A;  3SEP A;  2ZQ0 A;  2FUQ A;  3IAQ A;  3DDF A;  4EV2 A;  1LOH A;  3W7U A;  3K5T A;  1WMP A;  1QAL A;  4DUX A;  5E1Q A;  2YFO A;  4BTW A;  3IMH A;  2OOV A;  3T2Q A;  1NS0 A;  1HN0 A;  1YGA A;  1NSZ A;  4TTG A;  3WIR A;  3X3X A;  2D1W A;  4EV5 A;  3D4Z A;  3I3D A;  3N9H A;  3BUB A;  3AFL A;  3W7W A;  2ALW A;  1SIH A;  2Q1F A;  3VD9 A;  3DX3 A;  1WMO A;  3X42 A;  1OJO A;  2F7Q A;  3S4A A;  2BT3 A;  2EAD A;  3QFY A;  4FNR A;  3BLC A;  3ACT A;  2E22 A;  3T0B A;  2HTA A;  2WGQ A;  4KTP A;  3AFJ A;  1JZ6 A;  2OQE C;  2XN2 A;  2XN0 A;  1W7C A;  1X1I A;  2FYV A;  1LVN A;  3PGB A;  1HN1 A;  1MMZ A;  3S4C A;  2OW7 A;  2YFN A;  1NSS A;  2EAC A;  1OJM A;  2JKA A;  1IQX A;  2YX9 A;  1HWW A;  1MMX A;  3DX1 A;  1JYV A;  1N7N A;  3EJT A;  1RWC A;  1LF9 A;  3X41 A;  4BZE A;  4DUV A;  3WA2 X;  1JZ3 A;  1L7K A;  1NSX A;  4UFC A;  3NJX A;  3KN4 A;  2F1A A;  2ZXQ A;  2W0Q A;  3T2P A;  5KBP A;  2CFK A;  3T2O A;  4KFF A;  1HTY A;  3NJV A;  1D6Z A;  1IQY A;  1QX1 A;  2BRW A;  4FNQ A;  1V7W A;  3OS7 A;  1TXK A;  1IVV A;  1JRQ A;  3RRS A;  2ZL8 A;  3WIQ A;  4BTX A;  3LVT A;  2OQE A;  1CB8 A;  1W3Y A;  3Q1N A;  3S4D A;  2F7O A;  4OK4 A;  2WW1 A;  1QAK A;  3VDB A;  4BZF A;  1J0N A;  1PU4 A;  3VSN A;  1X1J A;  2PNC A;  3D50 A;  3VD7 A;  3DX0 A;  3E80 A;  1US1 A;  1L7J A;  1N7Q A;  2WVZ A;  3T0D A;  1K1X A;  1OJN A;  3MV0 1;  3W7T A;  1A2V A;  1MMY A;  2CIQ A;  2WYI A;  2BRP A;  1W6C A;  1LF6 A;  1SNZ A;  3T0U A;  3A0O A;  4MMH A;  3CZS A;  3VDA A;  3WFA A;  3HIG A;  1V7V A;  1UI7 A;  3IAP A;  1EKM A;  3WA3 A;  3OBA A;  1LXK A;  3VDC A;  3T09 A;  1NS8 A;  2X03 A;  5CA3 A;  4BZH A;  1K1Y A;  1NSR A;  3NRE A;  3J7H A;  2Y73 A;  3KII A;  3RSY A;  1PX3 A;  3MUY 1;  3BLB A;  2WVY A;  3ALA A;  3QG0 A;  2CG1 A;  4BTY A;  3CZJ A;  1TQS A;  1YQ2 A;  4K3A A;  1RKY A;  3SXX A;  3T0A A;  1W2Z A;  1AV4 A;  1N7O A;  1NKG A;  1W4N A;  2E2T A;  3BVU A;  1F1S A;  3EJP A;  4AQ0 A;  3VD4 A;  1IVU A;  1K1W A;  3K25 A;  2CWV A;  2F18 A;  3BUI A;  3D52 A;  2WVX A;  2EAB A;  1NS2 A;  3NBB A;  2CIS A;  5JMD A;  1JZ2 A;  3D3I A;  5GW7 A;  3QFZ A;  1C82 A;  3D51 A;  2XHN A;  1W6G A;  3BS6 A;  4FNP A;  3DX2 A;  3BUQ A;  2OOV C;  2D73 A;  1H54 A;  2JKP A;  1F4A A;  2CFD A;  2CWU A;  3OB8 A;  1JZ7 A;  3DEC A;  2WVX B;  1PX4 A;  3AMO A;  1SII A;  3CZN A;  2WYH A;  2WW2 A;  1NS7 A;  3A24 A;  1R33 A;  1HMU A;  3HII A;  4MMI A;  2RDY A;  4OJZ A;  2WO0 A;  4KTR A;  3X3Z A;  1QWN A;  3E1F 1;  1SPU A;  3AMO B;  3VD5 A;  1JYW A;  1QAF A;  2CFW A;  1LUR A;  1JYN A;  3D4Y A;  1NSU A;  3W7S A;  2CWT A;  1JOV A;  2F7R A;  2WW0 A;  1ULV A;  1TU5 A;  4KFD A;  1N7R A;  4NEI A;  1TQU A;  3VSM A;  1NS4 A;  3DX4 A;  3SX1 A;  1F9G A;  1N9E A;  1R34 A;  4FNV A;  2CFG A;  3EJQ A;  3DDG A;  1NSM A;  2WCO A;  5A1A A;  1RWG A;  5JMF A;  1UI8 A;  2XSG A;  1AVK A;  1QWU A;  3W7X A;  1OJP A;  1RW9 A;  2CQS A;  4FNS A;  2EAE A;  2WOF A;  4FNT A;  1J0M A;  1SO0 A;  1EGU A;  1HXK A;  3T08 A;  4BZG A;  4DUW A;  3VD3 A;  3ACS A;  3TY1 A;  3DYO A;  1HM3 A;  3LOY A;  3E7J A;  3I3E A;  2CQT A;  2E2U A;  2E2V A;  3DYM A;  1JZ4 A;  2Y74 A;  1F4H A;  1HM2 A;  1MN0 A;  1X1H A;  2HTB A;  1W5Z A;  3BUP A;  3EJR A;  2F7P A;  3BVT A;  3MV1 1;  1JZ8 A;  3BUD A;  4J5T A;  1IU7 A;  3HI7 A;  2CG0 A;  2C11 A;  1JYX A;  2CFL A;  3I3B A;  3MWX A;  3X3Y A;  2E24 A;  3X40 A;  4KFE A;  2JKE A;  3DYP A;  1JZ5 A;  1RWF A;  1AVL A;  2WOH A;  1TQV A;  1WMN A;  1IVW A;  2FUT A;  1D6Y A;  3CV5 A;  4K35 A;  1NSV A;  2WZS A;  2C10 A;  2XN1 A;  3EJU A;  3ECQ A;  3NBJ A;  4OK2 A;  1OAC A;  1D6U A;  2BRV X;  1PS3 A;  1I8Q A;  1V7X A;  3S4B A;  1LXM A;  3WVF A;  1RWA A;  3MI6 A;  1MMU A;  1RJO A;  4FNU A;  4RNL A;  1DYU A;  1KSI A;  1RWH A;  3BVW A;  3EJS A;  3QDE A;  1TQT A;  1DP0 A;  2CIR A;  2WW3 A;  1HMW A;  1UG9 A;  3MPH A;  1TQW A;  3DCD A;  3MUZ 1;  1O7D D; 
#chains in the Genus database with same CATH homology
 1RWG A;  1YQ2 A;  5JMF A;  2ZXQ A;  2XSG A;  3T0A A;  3T2P A;  3BGA A;  1Z45 A;  3T2O A;  1N7O A;  3NJV A;  1NKG A;  1OJP A;  2WDA A;  3NJX A;  1RW9 A;  1N7P A;  2BRW A;  1J0M A;  2ZQ0 A;  3SEP A;  2FUQ A;  1SO0 A;  1F1S A;  3IAQ A;  3OS7 A;  1EGU A;  3T08 A;  4AQ0 A;  4BZG A;  4DUW A;  3VD3 A;  3VD4 A;  1K1W A;  3TY1 A;  1TXK A;  1LOH A;  3DYO A;  1HM3 A;  3K25 A;  4DUX A;  3E7J A;  3I3E A;  3DYM A;  1CB8 A;  5E1Q A;  1JZ4 A;  1F4H A;  1W3Y A;  2WVX A;  3Q1N A;  1HM2 A;  1NS2 A;  3IMH A;  3T2Q A;  4OK4 A;  1NS0 A;  2CIS A;  1MN0 A;  1X1H A;  2WW1 A;  1HN0 A;  2HTB A;  5JMD A;  1JZ2 A;  3VDB A;  4BZF A;  1J0N A;  1C82 A;  1YGA A;  2XHN A;  1NSZ A;  4TTG A;  3BS6 A;  3VSN A;  3MV1 1;  1X1J A;  3I3D A;  2D73 A;  1JZ8 A;  2JKP A;  3AFL A;  1F4A A;  3OB8 A;  3VD7 A;  4J5T A;  2Q1F A;  3VD9 A;  1JZ7 A;  3DEC A;  2WVX B;  1PX4 A;  3E80 A;  1L7J A;  1JYX A;  3I3B A;  1N7Q A;  2WVZ A;  1OJO A;  3T0D A;  3MWX A;  1K1X A;  2E24 A;  1OJN A;  3MV0 1;  1MMY A;  2CIQ A;  2JKE A;  2WW2 A;  1NS7 A;  3A24 A;  2BRP A;  2E22 A;  3BLC A;  3T0B A;  2HTA A;  1LF6 A;  1SNZ A;  1HMU A;  3A0O A;  3DYP A;  4MMI A;  1JZ6 A;  1JZ5 A;  1RWF A;  4MMH A;  4OJZ A;  3E1F 1;  3VDA A;  1X1I A;  2FUT A;  3VD5 A;  1JYW A;  1NSV A;  3WFA A;  1HN1 A;  2WZS A;  1MMZ A;  3ECQ A;  3IAP A;  1LUR A;  4OK2 A;  1JYN A;  2BRV X;  1I8Q A;  1NSS A;  1OJM A;  3OBA A;  1LXK A;  1NSU A;  2JKA A;  3VDC A;  1JOV A;  3T09 A;  1LXM A;  1NS8 A;  3WVF A;  2WW0 A;  1ULV A;  1MMX A;  1RWA A;  1MMU A;  2X03 A;  1N7R A;  4BZH A;  4NEI A;  1JYV A;  1K1Y A;  1N7N A;  1NSR A;  1RWC A;  3J7H A;  1LF9 A;  1NS4 A;  3NRE A;  4RNL A;  3VSM A;  4BZE A;  1RWH A;  4DUV A;  1F9G A;  1JZ3 A;  1PX3 A;  1DP0 A;  2CIR A;  4FNV A;  2WW3 A;  1HMW A;  1L7K A;  1NSX A;  1UG9 A;  3MUY 1;  3DCD A;  2WVY A;  3MUZ 1;  1NSM A;  3CZJ A;  2WCO A;  5A1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...