1NS2A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns2A00
3IAQA 2CIQA 4BZFA 3CZJA 1YQ2A 1EGUA 1MMZA 1RW9A 1LF6A 5A1AA 1OJOA 3A24A 3VDAA 3BGAA 3T0AA 1JZ5A 1MMYA 2WW3A 2Q1FA 1NSMA 4DUXA 1JZ2A 3MUY1 1MMUA 3MWXA 1DP0A 1NS2A 1RWAA 2WVZA 3I3EA 3T0BA 3J7HA 1MMXA 1LURA 3NREA 1JOVA 1CB8A 1NKGA 1K1YA 1JYWA 1J0MA 3OS7A 3VD5A 1SNZA 3VD9A 3T2PA 1W3YA 1LF9A 1TXKA 1K1WA 1LOHA 3K25A 3Q1NA 2WW1A 2BRVX 3DYMA 1NSUA 2HTAA 2WDAA 3DYOA 3MUZ1 5E1QA 1UG9A 1NSVA 2WVXA 2E22A 1HN1A 1NSRA 2WW0A 1JZ6A 1X1IA 3E1F1 1RWGA 2XSGA 4RNLA 1YGAA 3IMHA 1NS4A 1PX3A 1N7QA 1F4HA 2CIRA 3NJXA 4BZGA 3T2QA 1N7NA 1X1HA 1N7OA 3DYPA 1JZ8A 2WCOA 3VD3A 1NS0A 1RWHA 3VD4A 3WFAA 1SO0A 3OBAA 1LXMA 1NS8A 1OJNA 4DUVA 2E24A 1J0NA 1X1JA 1L7JA 3DCDA 1HMUA 3T09A 3MV11 1I8QA 1N7RA 1K1XA 1NSSA 3VDBA 2WZSA 3DECA 2WVXB 1L7KA 1ULVA 2X03A 2JKPA 4AQ0A 1F4AA 1HMWA 1RWCA 1Z45A 3I3BA 3T0DA 3IAPA 1RWFA 2ZXQA 3OB8A 1JYNA 1PX4A 4TTGA 3ECQA 2CISA 1MN0A 1N7PA 1NSXA 2WVYA 3I3DA 2JKEA 3VDCA 1F9GA 3T08A 1JZ7A 2JKAA 1JZ3A 1JZ4A 2HTBA 3VD7A 1OJPA 3T2OA 2WW2A 4BZHA 1HM2A 2ZQ0A 3SEPA 4DUWA 1HN0A 4BZEA 1C82A 2XHNA 1JYVA 1NSZA 1JYXA 1HM3A 3MV01 2D73A 1F1SA 2BRPA 1NS7A 1LXKA 1OJMA 2BRWA 3NJVA
chains in the Genus database with same CATH superfamily
1R34A 2CIQA 1DYUA 2FUTA 1TQSA 5JMDA 2PNCA 1JZ5A 1MMYA 2WW3A 1NSMA 1MMUA 1SIIA 1RWAA 1LURA 3NREA 1N9EA 2WYIA 1CB8A 1NKGA 3BS6A 3VSMA 1J0MA 2Y73A 1WMPA 2CWVA 1K1WA 2WW1A 2EABA 3DYMA 1D6ZA 2XN2A 2WVXA 2CFLA 2F7OA 3SX1A 1X1IA 3ACTA 3WA2X 3E7JA 2XSGA 3DX3A 2RDYA 3NJXA 2XN1A 1N7NA 1RKYA 3DYPA 1JZ8A 3W7SA 2WCOA 4K35A 3VD4A 2CWUA 3X3XA 3LOYA 4BTYA 3OBAA 1NS8A 1OJNA 4DUVA 2E24A 1W6GA 1L7JA 4MMHA 3MV11 1I8QA 2E2TA 3VDBA 1NSSA 2OW6A 2WZSA 3X3ZA 1IVXA 1US1A 1IU7A 1ULVA 4AQ0A 1HMWA 1Z45A 2EAEA 3EJSA 3BLCA 3EJPA 3OB8A 3D3IA 4K3AA 1HXKA 1PX4A 1NSXA 1RJOA 5CA3A 3T08A 2JKAA 1JZ3A 5KBPA 1OJPA 2EADA 1OACA 1HM2A 2CG0A 2OW7A 4DUWA 4FNRA 1C82A 1IQXA 2E2VA 1JYXA 1F1SA 2BRPA 2F1BA 1QWNA 2FYVA 3BVXA 2ZL8A 3D4ZA 4KTRA 4UFCA 1EGUA 1MMZA 2CG1A 3BVWA 3BUBA 3BGAA 1TQWA 1JRQA 1DP0A 3AMOB 1MMXA 3K5TA 3OS7A 1TQVA 3VD9A 1W3YA 1TXKA 1LOHA 3Q1NA 1D6UA 2BRVX 5E1QA 1NSUA 4KFFA 3EJRA 3NBJA 3ALAA 2E22A 1HN1A 3KIIA 1NSRA 1AVKA 2CFDA 2WW0A 3X3YA 1TQUA 1SPUA 3E1F1 1RWGA 4RNLA 1YGAA 4FNSA 2CQSA 1EKMA 1F4HA 3DX0A 3QFZA 4BZGA 3BUDA 1V7WA 1TQTA 1X1JA 1HMUA 2W0QA 3QG0A 3W7TA 3W7WA 4J5TA 3D4YA 3IAPA 1RWFA 2YFNA 3EJTA 4TTGA 1MN0A 1N7PA 3I3DA 3SXXA 2OOVA 1JZ4A 2HTBA 3VD7A 1HWWA 3BLBA 3HIGA 3CV5A 2ZQ0A 3WIQA 3WA3A 1R33A 3N9HA 4OK2A 1HM3A 2CWTA 3AFLA 4FNUA 1IVVA 3BUPA 4EV2A 1OJMA 3IAQA 2CQTA 2C10A 4BZFA 3CZJA 1YQ2A 3W7UA 4OK4A 1LF6A 1OJOA 1TU5A 3VDAA 3CZSA 2F7RA 3TY1A 1JZ2A 3MUY1 2OOVC 3CZNA 3S4AA 3MWXA 3I3EA 3D52A 3BVUA 1JOVA 1V7XA 1K1YA 1JYWA 3AMOA 1SNZA 3EJUA 1LF9A 3QFYA 3S4DA 2F7PA 1UI8A 2CFKA 1NSVA 2WGQA 3S4CA 1JZ6A 3BVTA 3X41A 1W5ZA 2WO0A 1WMOA 1N7QA 2CIRA 4MMIA 1W4NA 1W6CA 1NS0A 3WFAA 1SO0A 3DX2A 1AV4A 3QDEA 3EJQA 1J0NA 1IVWA 4EV5A 3DCDA 1V7VA 2OQEA 4FNQA 3T09A 2E2UA 1QAFA 1N7RA 3ACSA 2YX9A 2WVXB 4FNPA 2JKPA 1RWCA 3I3BA 2CFWA 2ZXQA 1A2VA 2CISA 2WVYA 3NBBA 2JKEA 1PU4A 4BZHA 1QALA 3SEPA 1HN0A 4BZEA 3AFJA 1IQYA 4NEIA 2XN0A 1JYVA 1NSZA 1AVLA 3MV01 1UI7A 5JMFA 2F7QA 1LXKA 3NJVA 1QX1A 3D50A 3DDGA 2F1AA 3BUQA 1RW9A 4FNTA 5A1AA 3A24A 3T0AA 3DX1A 4DUXA 1O7DD 2Q1FA 2C11A 3BUIA 3VSNA 1HTYA 1NS2A 2WVZA 2YFOA 2F18A 3J7HA 3T0BA 4KFDA 3MI6A 3WIRA 1H54A 3VD5A 3T2PA 2ALWA 3BVVA 1SIHA 1WMNA 3DDFA 3K25A 2BT3A 1W7CA 3PGBA 3MUZ1 3DYOA 2HTAA 2WDAA 1UG9A 1PS3A 3RSYA 3HIIA 4OJZA 3D51A 2FUQA 2WOFA 3KN4A 3IMHA 2Y74A 1NS4A 1PX3A 3X42A 3E80A 4BTXA 3T2QA 1X1HA 1N7OA 5GW7A 3VD3A 4KTPA 1RWHA 1W2ZA 1LXMA 3WVFA 2OQEC 3RRSA 4FNVA 1D6YA 1KSIA 3S4BA 2CFGA 1K1XA 3DECA 1L7KA 2X03A 1F4AA 3T0DA 3T0UA 3DX4A 3HI7A 1JYNA 3MPHA 3ECQA 3W7XA 2EACA 3VDCA 1F9GA 1QAKA 1JZ7A 3LVTA 4BTWA 3T2OA 2WW2A 2WYHA 3A0OA 2XHNA 2WOHA 1LVNA 2D1WA 3X40A 2D73A 1IVUA 1NS7A 1QWUA 2BRWA 4KFEA
chains in the Genus database with same CATH topology
3IAQA 2CIQA 4BZFA 3CZJA 1YQ2A 1EGUA 1MMZA 2FUTA 4OK4A 1RW9A 1LF6A 5A1AA 5JMDA 1OJOA 3A24A 3VDAA 3BGAA 3T0AA 1JZ5A 1MMYA 2WW3A 2Q1FA 1NSMA 3TY1A 4DUXA 1JZ2A 3MUY1 1MMUA 3MWXA 1DP0A 1NS2A 1RWAA 2WVZA 3I3EA 3T0BA 3VSNA 3J7HA 1MMXA 1LURA 3NREA 1JOVA 3VSMA 1CB8A 1NKGA 1K1YA 3BS6A 1JYWA 1J0MA 3OS7A 3VD5A 1SNZA 3VD9A 3T2PA 1W3YA 1LF9A 1TXKA 1K1WA 1LOHA 3K25A 3Q1NA 2WW1A 2BRVX 3DYMA 1NSUA 2HTAA 2WDAA 3DYOA 3MUZ1 5E1QA 1UG9A 1NSVA 2WVXA 2E22A 4OJZA 1HN1A 1NSRA 2WW0A 1JZ6A 2FUQA 1X1IA 3E7JA 1RWGA 2XSGA 3E1F1 4RNLA 1YGAA 3IMHA 1NS4A 1PX3A 1N7QA 1F4HA 2CIRA 3NJXA 3E80A 4BZGA 3T2QA 1N7NA 1X1HA 1N7OA 3DYPA 1JZ8A 2WCOA 4MMIA 3VD3A 1NS0A 1RWHA 3VD4A 3WFAA 1SO0A 3OBAA 1LXMA 3WVFA 1NS8A 1OJNA 4DUVA 2E24A 1J0NA 1X1JA 1L7JA 3DCDA 1HMUA 4MMHA 4FNVA 3T09A 3MV11 1I8QA 1N7RA 1K1XA 1NSSA 3VDBA 2WZSA 3DECA 2WVXB 1L7KA 1ULVA 2X03A 2JKPA 4AQ0A 1F4AA 1HMWA 1RWCA 1Z45A 3I3BA 4J5TA 3T0DA 3BLCA 3IAPA 1RWFA 2ZXQA 3OB8A 1JYNA 1PX4A 4TTGA 3ECQA 2CISA 1MN0A 1N7PA 1NSXA 2WVYA 3I3DA 2JKEA 3VDCA 1F9GA 3T08A 1JZ7A 2JKAA 1JZ3A 1JZ4A 2HTBA 3VD7A 1OJPA 3T2OA 2WW2A 4BZHA 1HM2A 2ZQ0A 3SEPA 4DUWA 1HN0A 4BZEA 3A0OA 1C82A 2XHNA 4NEIA 1JYVA 1NSZA 1JYXA 4OK2A 1HM3A 3AFLA 3MV01 5JMFA 2D73A 1F1SA 2BRPA 1NS7A 1LXKA 1OJMA 2BRWA 3NJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAQ A;  2CIQ A;  4BZF A;  3CZJ A;  1YQ2 A;  1EGU A;  1MMZ A;  1RW9 A;  1LF6 A;  5A1A A;  1OJO A;  3A24 A;  3VDA A;  3BGA A;  3T0A A;  1JZ5 A;  1MMY A;  2WW3 A;  2Q1F A;  1NSM A;  4DUX A;  1JZ2 A;  3MUY 1;  1MMU A;  3MWX A;  1DP0 A;  1NS2 A;  1RWA A;  2WVZ A;  3I3E A;  3T0B A;  3J7H A;  1MMX A;  1LUR A;  3NRE A;  1JOV A;  1CB8 A;  1NKG A;  1K1Y A;  1JYW A;  1J0M A;  3OS7 A;  3VD5 A;  1SNZ A;  3VD9 A;  3T2P A;  1W3Y A;  1LF9 A;  1TXK A;  1K1W A;  1LOH A;  3K25 A;  3Q1N A;  2WW1 A;  2BRV X;  3DYM A;  1NSU A;  2HTA A;  2WDA A;  3DYO A;  3MUZ 1;  5E1Q A;  1UG9 A;  1NSV A;  2WVX A;  2E22 A;  1HN1 A;  1NSR A;  2WW0 A;  1JZ6 A;  1X1I A;  3E1F 1;  1RWG A;  2XSG A;  4RNL A;  1YGA A;  3IMH A;  1NS4 A;  1PX3 A;  1N7Q A;  1F4H A;  2CIR A;  3NJX A;  4BZG A;  3T2Q A;  1N7N A;  1X1H A;  1N7O A;  3DYP A;  1JZ8 A;  2WCO A;  3VD3 A;  1NS0 A;  1RWH A;  3VD4 A;  3WFA A;  1SO0 A;  3OBA A;  1LXM A;  1NS8 A;  1OJN A;  4DUV A;  2E24 A;  1J0N A;  1X1J A;  1L7J A;  3DCD A;  1HMU A;  3T09 A;  3MV1 1;  1I8Q A;  1N7R A;  1K1X A;  1NSS A;  3VDB A;  2WZS A;  3DEC A;  2WVX B;  1L7K A;  1ULV A;  2X03 A;  2JKP A;  4AQ0 A;  1F4A A;  1HMW A;  1RWC A;  1Z45 A;  3I3B A;  3T0D A;  3IAP A;  1RWF A;  2ZXQ A;  3OB8 A;  1JYN A;  1PX4 A;  4TTG A;  3ECQ A;  2CIS A;  1MN0 A;  1N7P A;  1NSX A;  2WVY A;  3I3D A;  2JKE A;  3VDC A;  1F9G A;  3T08 A;  1JZ7 A;  2JKA A;  1JZ3 A;  1JZ4 A;  2HTB A;  3VD7 A;  1OJP A;  3T2O A;  2WW2 A;  4BZH A;  1HM2 A;  2ZQ0 A;  3SEP A;  4DUW A;  1HN0 A;  4BZE A;  1C82 A;  2XHN A;  1JYV A;  1NSZ A;  1JYX A;  1HM3 A;  3MV0 1;  2D73 A;  1F1S A;  2BRP A;  1NS7 A;  1LXK A;  1OJM A;  2BRW A;  3NJV A; 
#chains in the Genus database with same CATH topology
 1R34 A;  2CIQ A;  1DYU A;  2FUT A;  1TQS A;  5JMD A;  2PNC A;  1JZ5 A;  1MMY A;  2WW3 A;  1NSM A;  1MMU A;  1SII A;  1RWA A;  1LUR A;  3NRE A;  1N9E A;  2WYI A;  1CB8 A;  1NKG A;  3BS6 A;  3VSM A;  1J0M A;  2Y73 A;  1WMP A;  2CWV A;  1K1W A;  2WW1 A;  2EAB A;  3DYM A;  1D6Z A;  2XN2 A;  2WVX A;  2CFL A;  2F7O A;  3SX1 A;  1X1I A;  3ACT A;  3WA2 X;  3E7J A;  2XSG A;  3DX3 A;  2RDY A;  3NJX A;  2XN1 A;  1N7N A;  1RKY A;  3DYP A;  1JZ8 A;  3W7S A;  2WCO A;  4K35 A;  3VD4 A;  2CWU A;  3X3X A;  3LOY A;  4BTY A;  3OBA A;  1NS8 A;  1OJN A;  4DUV A;  2E24 A;  1W6G A;  1L7J A;  4MMH A;  3MV1 1;  1I8Q A;  2E2T A;  3VDB A;  1NSS A;  2OW6 A;  2WZS A;  3X3Z A;  1IVX A;  1US1 A;  1IU7 A;  1ULV A;  4AQ0 A;  1HMW A;  1Z45 A;  2EAE A;  3EJS A;  3BLC A;  3EJP A;  3OB8 A;  3D3I A;  4K3A A;  1HXK A;  1PX4 A;  1NSX A;  1RJO A;  5CA3 A;  3T08 A;  2JKA A;  1JZ3 A;  5KBP A;  1OJP A;  2EAD A;  1OAC A;  1HM2 A;  2CG0 A;  2OW7 A;  4DUW A;  4FNR A;  1C82 A;  1IQX A;  2E2V A;  1JYX A;  1F1S A;  2BRP A;  2F1B A;  1QWN A;  2FYV A;  3BVX A;  2ZL8 A;  3D4Z A;  4KTR A;  4UFC A;  1EGU A;  1MMZ A;  2CG1 A;  3BVW A;  3BUB A;  3BGA A;  1TQW A;  1JRQ A;  1DP0 A;  3AMO B;  1MMX A;  3K5T A;  3OS7 A;  1TQV A;  3VD9 A;  1W3Y A;  1TXK A;  1LOH A;  3Q1N A;  1D6U A;  2BRV X;  5E1Q A;  1NSU A;  4KFF A;  3EJR A;  3NBJ A;  3ALA A;  2E22 A;  1HN1 A;  3KII A;  1NSR A;  1AVK A;  2CFD A;  2WW0 A;  3X3Y A;  1TQU A;  1SPU A;  3E1F 1;  1RWG A;  4RNL A;  1YGA A;  4FNS A;  2CQS A;  1EKM A;  1F4H A;  3DX0 A;  3QFZ A;  4BZG A;  3BUD A;  1V7W A;  1TQT A;  1X1J A;  1HMU A;  2W0Q A;  3QG0 A;  3W7T A;  3W7W A;  4J5T A;  3D4Y A;  3IAP A;  1RWF A;  2YFN A;  3EJT A;  4TTG A;  1MN0 A;  1N7P A;  3I3D A;  3SXX A;  2OOV A;  1JZ4 A;  2HTB A;  3VD7 A;  1HWW A;  3BLB A;  3HIG A;  3CV5 A;  2ZQ0 A;  3WIQ A;  3WA3 A;  1R33 A;  3N9H A;  4OK2 A;  1HM3 A;  2CWT A;  3AFL A;  4FNU A;  1IVV A;  3BUP A;  4EV2 A;  1OJM A;  3IAQ A;  2CQT A;  2C10 A;  4BZF A;  3CZJ A;  1YQ2 A;  3W7U A;  4OK4 A;  1LF6 A;  1OJO A;  1TU5 A;  3VDA A;  3CZS A;  2F7R A;  3TY1 A;  1JZ2 A;  3MUY 1;  2OOV C;  3CZN A;  3S4A A;  3MWX A;  3I3E A;  3D52 A;  3BVU A;  1JOV A;  1V7X A;  1K1Y A;  1JYW A;  3AMO A;  1SNZ A;  3EJU A;  1LF9 A;  3QFY A;  3S4D A;  2F7P A;  1UI8 A;  2CFK A;  1NSV A;  2WGQ A;  3S4C A;  1JZ6 A;  3BVT A;  3X41 A;  1W5Z A;  2WO0 A;  1WMO A;  1N7Q A;  2CIR A;  4MMI A;  1W4N A;  1W6C A;  1NS0 A;  3WFA A;  1SO0 A;  3DX2 A;  1AV4 A;  3QDE A;  3EJQ A;  1J0N A;  1IVW A;  4EV5 A;  3DCD A;  1V7V A;  2OQE A;  4FNQ A;  3T09 A;  2E2U A;  1QAF A;  1N7R A;  3ACS A;  2YX9 A;  2WVX B;  4FNP A;  2JKP A;  1RWC A;  3I3B A;  2CFW A;  2ZXQ A;  1A2V A;  2CIS A;  2WVY A;  3NBB A;  2JKE A;  1PU4 A;  4BZH A;  1QAL A;  3SEP A;  1HN0 A;  4BZE A;  3AFJ A;  1IQY A;  4NEI A;  2XN0 A;  1JYV A;  1NSZ A;  1AVL A;  3MV0 1;  1UI7 A;  5JMF A;  2F7Q A;  1LXK A;  3NJV A;  1QX1 A;  3D50 A;  3DDG A;  2F1A A;  3BUQ A;  1RW9 A;  4FNT A;  5A1A A;  3A24 A;  3T0A A;  3DX1 A;  4DUX A;  1O7D D;  2Q1F A;  2C11 A;  3BUI A;  3VSN A;  1HTY A;  1NS2 A;  2WVZ A;  2YFO A;  2F18 A;  3J7H A;  3T0B A;  4KFD A;  3MI6 A;  3WIR A;  1H54 A;  3VD5 A;  3T2P A;  2ALW A;  3BVV A;  1SIH A;  1WMN A;  3DDF A;  3K25 A;  2BT3 A;  1W7C A;  3PGB A;  3MUZ 1;  3DYO A;  2HTA A;  2WDA A;  1UG9 A;  1PS3 A;  3RSY A;  3HII A;  4OJZ A;  3D51 A;  2FUQ A;  2WOF A;  3KN4 A;  3IMH A;  2Y74 A;  1NS4 A;  1PX3 A;  3X42 A;  3E80 A;  4BTX A;  3T2Q A;  1X1H A;  1N7O A;  5GW7 A;  3VD3 A;  4KTP A;  1RWH A;  1W2Z A;  1LXM A;  3WVF A;  2OQE C;  3RRS A;  4FNV A;  1D6Y A;  1KSI A;  3S4B A;  2CFG A;  1K1X A;  3DEC A;  1L7K A;  2X03 A;  1F4A A;  3T0D A;  3T0U A;  3DX4 A;  3HI7 A;  1JYN A;  3MPH A;  3ECQ A;  3W7X A;  2EAC A;  3VDC A;  1F9G A;  1QAK A;  1JZ7 A;  3LVT A;  4BTW A;  3T2O A;  2WW2 A;  2WYH A;  3A0O A;  2XHN A;  2WOH A;  1LVN A;  2D1W A;  3X40 A;  2D73 A;  1IVU A;  1NS7 A;  1QWU A;  2BRW A;  4KFE A; 
#chains in the Genus database with same CATH homology
 3IAQ A;  2CIQ A;  4BZF A;  3CZJ A;  1YQ2 A;  1EGU A;  1MMZ A;  2FUT A;  4OK4 A;  1RW9 A;  1LF6 A;  5A1A A;  5JMD A;  1OJO A;  3A24 A;  3VDA A;  3BGA A;  3T0A A;  1JZ5 A;  1MMY A;  2WW3 A;  2Q1F A;  1NSM A;  3TY1 A;  4DUX A;  1JZ2 A;  3MUY 1;  1MMU A;  3MWX A;  1DP0 A;  1NS2 A;  1RWA A;  2WVZ A;  3I3E A;  3T0B A;  3VSN A;  3J7H A;  1MMX A;  1LUR A;  3NRE A;  1JOV A;  3VSM A;  1CB8 A;  1NKG A;  1K1Y A;  3BS6 A;  1JYW A;  1J0M A;  3OS7 A;  3VD5 A;  1SNZ A;  3VD9 A;  3T2P A;  1W3Y A;  1LF9 A;  1TXK A;  1K1W A;  1LOH A;  3K25 A;  3Q1N A;  2WW1 A;  2BRV X;  3DYM A;  1NSU A;  2HTA A;  2WDA A;  3DYO A;  3MUZ 1;  5E1Q A;  1UG9 A;  1NSV A;  2WVX A;  2E22 A;  4OJZ A;  1HN1 A;  1NSR A;  2WW0 A;  1JZ6 A;  2FUQ A;  1X1I A;  3E7J A;  1RWG A;  2XSG A;  3E1F 1;  4RNL A;  1YGA A;  3IMH A;  1NS4 A;  1PX3 A;  1N7Q A;  1F4H A;  2CIR A;  3NJX A;  3E80 A;  4BZG A;  3T2Q A;  1N7N A;  1X1H A;  1N7O A;  3DYP A;  1JZ8 A;  2WCO A;  4MMI A;  3VD3 A;  1NS0 A;  1RWH A;  3VD4 A;  3WFA A;  1SO0 A;  3OBA A;  1LXM A;  3WVF A;  1NS8 A;  1OJN A;  4DUV A;  2E24 A;  1J0N A;  1X1J A;  1L7J A;  3DCD A;  1HMU A;  4MMH A;  4FNV A;  3T09 A;  3MV1 1;  1I8Q A;  1N7R A;  1K1X A;  1NSS A;  3VDB A;  2WZS A;  3DEC A;  2WVX B;  1L7K A;  1ULV A;  2X03 A;  2JKP A;  4AQ0 A;  1F4A A;  1HMW A;  1RWC A;  1Z45 A;  3I3B A;  4J5T A;  3T0D A;  3BLC A;  3IAP A;  1RWF A;  2ZXQ A;  3OB8 A;  1JYN A;  1PX4 A;  4TTG A;  3ECQ A;  2CIS A;  1MN0 A;  1N7P A;  1NSX A;  2WVY A;  3I3D A;  2JKE A;  3VDC A;  1F9G A;  3T08 A;  1JZ7 A;  2JKA A;  1JZ3 A;  1JZ4 A;  2HTB A;  3VD7 A;  1OJP A;  3T2O A;  2WW2 A;  4BZH A;  1HM2 A;  2ZQ0 A;  3SEP A;  4DUW A;  1HN0 A;  4BZE A;  3A0O A;  1C82 A;  2XHN A;  4NEI A;  1JYV A;  1NSZ A;  1JYX A;  4OK2 A;  1HM3 A;  3AFL A;  3MV0 1;  5JMF A;  2D73 A;  1F1S A;  2BRP A;  1NS7 A;  1LXK A;  1OJM A;  2BRW A;  3NJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...