1NS2A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns2A00
1K1XA 1HMWA 1N7PA 1RWFA 3Q1NA 1C82A 3OBAA 1JYVA 3T2QA 3VD4A 3VDAA 1JZ8A 1MMZA 3E1F1 2WVYA 2ZXQA 1NSSA 5E1QA 1HN1A 5A1AA 2X03A 3MUY1 3SEPA 3VDBA 1NS4A 3T2OA 4DUXA 1F9GA 1YGAA 2JKPA 3VD9A 1NSMA 3T0BA 4BZEA 3BGAA 1NS7A 1RWAA 1OJMA 1HM3A 1YQ2A 2E24A 1RW9A 2HTAA 1JYXA 1RWHA 1OJNA 1N7QA 1MN0A 3VD3A 1PX4A 3IMHA 3DCDA 1JZ4A 4BZGA 3IAQA 3NJVA 1JYWA 1OJPA 3MV11 3DYMA 1I8QA 2WW1A 3VD5A 1NS8A 3T0DA 3T2PA 3A24A 1MMXA 2XSGA 1X1JA 1RWGA 2BRVX 3T08A 1MMYA 2WVXB 1NKGA 2ZQ0A 4BZHA 3DYOA 3MV01 3CZJA 1LOHA 1MMUA 1JZ7A 2BRWA 2HTBA 3I3DA 3I3EA 2XHNA 4DUWA 1LURA 3NJXA 1F1SA 1JZ6A 1NSRA 1F4HA 3OS7A 1EGUA 1NSVA 2CISA 1N7NA 1SO0A 2JKEA 3WFAA 4RNLA 1JZ5A 1JYNA 1JZ3A 1RWCA 2WW3A 1K1YA 1LXMA 2WZSA 1JOVA 1L7KA 1J0MA 1LXKA 1X1HA 4TTGA 2WW2A 3DYPA 4BZFA 1CB8A 1N7OA 1NS0A 1NSXA 2BRPA 3VD7A 2WCOA 1K1WA 1HMUA 1UG9A 1N7RA 1J0NA 2WVZA 1NS2A 2E22A 2JKAA 4DUVA 2WW0A 3K25A 1L7JA 1OJOA 1SNZA 1LF6A 1HN0A 3J7HA 3NREA 1NSZA 3VDCA 4AQ0A 3ECQA 3I3BA 1W3YA 3MWXA 3T0AA 3DECA 2Q1FA 1LF9A 1NSUA 1PX3A 1DP0A 1HM2A 3T09A 1F4AA 2WVXA 1JZ2A 1ULVA 1X1IA 2CIQA 3OB8A 2D73A 2CIRA 2WDAA 3MUZ1 1Z45A 3IAPA 1TXKA
chains in the Genus database with same CATH superfamily
1HMWA 4MMIA 3AFJA 1V7XA 1C82A 3VDAA 1JZ8A 2CG1A 3E1F1 3D52A 2XN2A 5E1QA 1IVVA 3S4CA 3BVTA 5A1AA 3TY1A 2Y74A 2OQEC 4DUXA 3S4AA 3N9HA 2F7PA 3CZSA 3W7SA 3CZNA 4OJZA 2CG0A 3X42A 2F7QA 3SXXA 1N7QA 2WOHA 1JZ4A 3NBBA 4KFDA 3EJTA 1AVKA 3IAQA 3NJVA 1JYWA 3DYMA 3VD5A 3D4YA 3A24A 2E2UA 2XSGA 1TQSA 4NEIA 3MV01 1MMUA 4FNPA 1WMOA 3NJXA 4OK4A 3CV5A 3X3ZA 3QFZA 1W6GA 2JKEA 2EAEA 2FYVA 3WFAA 4RNLA 3VSNA 2WW3A 2F7OA 1WMNA 2F1AA 1LXMA 1JOVA 1L7KA 2EACA 3DYPA 1NS0A 4BTYA 2OW6A 1US1A 3BLBA 1NS2A 4DUVA 1OJOA 3DDGA 3J7HA 3WA3A 4AQ0A 3BS6A 2CFWA 3T0AA 1DP0A 3W7UA 1HM2A 3ACTA 1ULVA 3BUBA 1X1IA 3EJRA 4MMHA 2WDAA 2CQSA 1IVUA 5JMFA 1K1XA 1N7PA 1RWFA 3ACSA 1JYVA 2FUTA 2ZL8A 1QX1A 2WVYA 3KIIA 2WO0A 1NSSA 1V7WA 2YFNA 2ALWA 3MUY1 3D3IA 1F9GA 1YGAA 1NSMA 1NS7A 1RWAA 1OJMA 2OOVA 2E24A 2CFLA 1HWWA 1JYXA 1MN0A 3VD3A 3DCDA 2WOFA 1H54A 3EJUA 2D1WA 3X41A 2WW1A 1WMPA 1MMXA 1X1JA 3EJQA 1RWGA 3T08A 1W2ZA 1A2VA 1MMYA 2WVXB 2ZQ0A 4BZHA 3DYOA 3WA2X 3CZJA 1LOHA 2HTBA 3I3EA 4EV5A 1F1SA 3BVWA 3EJPA 1NSRA 1F4HA 3OS7A 3AMOA 2WYHA 3D4ZA 1SO0A 3BVVA 1SIIA 1JZ5A 1RWCA 2FUQA 4EV2A 4FNQA 2OQEA 1IU7A 2CWVA 2WZSA 1TU5A 1J0MA 1QWUA 1X1HA 2WW2A 4J5TA 1CB8A 3DDFA 3BVXA 1N7RA 2CQTA 2JKAA 1L7JA 3EJSA 1SNZA 3HIIA 1HN0A 3WIQA 3W7TA 1N9EA 1NSZA 3VDCA 2CFGA 3I3BA 1W3YA 3MWXA 3DECA 1PX3A 1JZ2A 1W6CA 2D73A 2CIRA 3MUZ1 1Z45A 3DX0A 4KFEA 3Q1NA 2PNCA 3QG0A 3OBAA 3T2QA 3QFYA 3VD4A 1MMZA 2X03A 3E7JA 1TQUA 3SEPA 3VDBA 3D51A 5JMDA 1NS4A 1SPUA 3BGAA 3BVUA 2WGQA 2XN1A 5CA3A 1OJNA 2YX9A 1PX4A 4BZGA 3HI7A 1TQTA 2C11A 3E80A 3T0DA 1KSIA 2EADA 4FNVA 3S4DA 3BUIA 1JRQA 3D50A 4K35A 3BLCA 5KBPA 2E2TA 1PU4A 1TQWA 3I3DA 4DUWA 4KTRA 1JZ6A 1LVNA 4K3AA 1NSVA 2CWUA 3T0UA 1N7NA 1R33A 3RRSA 4UFCA 1JZ3A 1QAKA 1K1YA 1QALA 3DX2A 1LXKA 4TTGA 1R34A 1W4NA 3BUPA 4KTPA 1N7OA 3S4BA 3VD7A 1NSXA 2BRPA 1IQYA 3A0OA 3QDEA 1IVXA 2E2VA 2WVZA 2CFKA 3HIGA 3K25A 2F1BA 2W0QA 3VSMA 1RKYA 1AVLA 1AV4A 3DX3A 1RJOA 1EKMA 1QAFA 3MPHA 1LF9A 2CIQA 2F18A 2EABA 2WYIA 1HXKA 3WVFA 3IAPA 1TXKA 2CWTA 3AMOB 3ALAA 2ZXQA 2BT3A 1HN1A 3SX1A 1DYUA 3W7XA 3T2OA 3LOYA 2JKPA 3KN4A 4FNTA 3VD9A 3T0BA 4BZEA 1UI7A 1HM3A 1YQ2A 1RW9A 1W5ZA 3PGBA 2HTAA 1RWHA 1IQXA 3BUDA 3IMHA 3WIRA 1SIHA 1OJPA 1V7VA 3MV11 1I8QA 2CFDA 1W7CA 1NS8A 1D6ZA 3T2PA 2YFOA 3DX4A 3X40A 2BRVX 1NKGA 3RSYA 1JZ7A 1OACA 2RDYA 2BRWA 3LVTA 2XHNA 1IVWA 1LURA 2C10A 4BTXA 1EGUA 3K5TA 2CISA 4FNSA 1JYNA 2OOVC 4BTWA 2F7RA 1PS3A 1O7DD 1D6UA 2Y73A 5GW7A 4FNUA 4KFFA 4BZFA 3BUQA 2WCOA 1K1WA 1HMUA 3X3XA 1UG9A 1J0NA 3AFLA 3DX1A 4FNRA 2E22A 2WW0A 3X3YA 1LF6A 4OK2A 1UI8A 3NREA 2OW7A 3ECQA 1HTYA 2Q1FA 1NSUA 2XN0A 3T09A 3W7WA 1F4AA 2WVXA 3NBJA 1D6YA 1TQVA 3OB8A 3MI6A 1QWNA
chains in the Genus database with same CATH topology
5JMFA 1K1XA 1HMWA 1N7PA 1RWFA 3Q1NA 4MMIA 1C82A 3OBAA 1JYVA 2FUTA 3T2QA 3VD4A 3VDAA 1JZ8A 1MMZA 3E1F1 2WVYA 2ZXQA 1NSSA 5E1QA 1HN1A 5A1AA 2X03A 3TY1A 3E7JA 3MUY1 3SEPA 3VDBA 5JMDA 1NS4A 3T2OA 4DUXA 1F9GA 1YGAA 2JKPA 3VD9A 1NSMA 3T0BA 4BZEA 3BGAA 1NS7A 1RWAA 1OJMA 1HM3A 1YQ2A 2E24A 4OJZA 1RW9A 2HTAA 1JYXA 1RWHA 1OJNA 1N7QA 1MN0A 3VD3A 1PX4A 3IMHA 3DCDA 1JZ4A 4BZGA 3IAQA 3NJVA 1JYWA 1OJPA 3MV11 3DYMA 1I8QA 2WW1A 3VD5A 3E80A 1NS8A 3T0DA 3T2PA 3A24A 1MMXA 2XSGA 1X1JA 4FNVA 1RWGA 2BRVX 3T08A 4NEIA 1MMYA 2WVXB 1NKGA 2ZQ0A 3BLCA 3DYOA 3MV01 4BZHA 3CZJA 1LOHA 1MMUA 1JZ7A 2BRWA 2HTBA 3I3DA 3I3EA 2XHNA 4DUWA 1LURA 3NJXA 1F1SA 1JZ6A 1NSRA 4OK4A 1F4HA 3OS7A 1EGUA 1NSVA 2CISA 1N7NA 1SO0A 2JKEA 3WFAA 4RNLA 1JZ5A 1JYNA 1JZ3A 1RWCA 3VSNA 2WW3A 1K1YA 2FUQA 1LXMA 2WZSA 1JOVA 1L7KA 1J0MA 1LXKA 1X1HA 4TTGA 2WW2A 3DYPA 4J5TA 4BZFA 1CB8A 1N7OA 1NS0A 1NSXA 2BRPA 3VD7A 3A0OA 2WCOA 1K1WA 1HMUA 1UG9A 1N7RA 1J0NA 2WVZA 3AFLA 1NS2A 2E22A 2JKAA 4DUVA 2WW0A 3K25A 1L7JA 3VSMA 1OJOA 1SNZA 1LF6A 4OK2A 1HN0A 3J7HA 3NREA 1NSZA 3VDCA 4AQ0A 3ECQA 3I3BA 3BS6A 1W3YA 3MWXA 3T0AA 3DECA 2Q1FA 1LF9A 1NSUA 1PX3A 1DP0A 1HM2A 3T09A 1F4AA 2WVXA 1JZ2A 1ULVA 1X1IA 2CIQA 4MMHA 3OB8A 2D73A 2CIRA 2WDAA 3WVFA 3MUZ1 1Z45A 3IAPA 1TXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1X A;  1HMW A;  1N7P A;  1RWF A;  3Q1N A;  1C82 A;  3OBA A;  1JYV A;  3T2Q A;  3VD4 A;  3VDA A;  1JZ8 A;  1MMZ A;  3E1F 1;  2WVY A;  2ZXQ A;  1NSS A;  5E1Q A;  1HN1 A;  5A1A A;  2X03 A;  3MUY 1;  3SEP A;  3VDB A;  1NS4 A;  3T2O A;  4DUX A;  1F9G A;  1YGA A;  2JKP A;  3VD9 A;  1NSM A;  3T0B A;  4BZE A;  3BGA A;  1NS7 A;  1RWA A;  1OJM A;  1HM3 A;  1YQ2 A;  2E24 A;  1RW9 A;  2HTA A;  1JYX A;  1RWH A;  1OJN A;  1N7Q A;  1MN0 A;  3VD3 A;  1PX4 A;  3IMH A;  3DCD A;  1JZ4 A;  4BZG A;  3IAQ A;  3NJV A;  1JYW A;  1OJP A;  3MV1 1;  3DYM A;  1I8Q A;  2WW1 A;  3VD5 A;  1NS8 A;  3T0D A;  3T2P A;  3A24 A;  1MMX A;  2XSG A;  1X1J A;  1RWG A;  2BRV X;  3T08 A;  1MMY A;  2WVX B;  1NKG A;  2ZQ0 A;  4BZH A;  3DYO A;  3MV0 1;  3CZJ A;  1LOH A;  1MMU A;  1JZ7 A;  2BRW A;  2HTB A;  3I3D A;  3I3E A;  2XHN A;  4DUW A;  1LUR A;  3NJX A;  1F1S A;  1JZ6 A;  1NSR A;  1F4H A;  3OS7 A;  1EGU A;  1NSV A;  2CIS A;  1N7N A;  1SO0 A;  2JKE A;  3WFA A;  4RNL A;  1JZ5 A;  1JYN A;  1JZ3 A;  1RWC A;  2WW3 A;  1K1Y A;  1LXM A;  2WZS A;  1JOV A;  1L7K A;  1J0M A;  1LXK A;  1X1H A;  4TTG A;  2WW2 A;  3DYP A;  4BZF A;  1CB8 A;  1N7O A;  1NS0 A;  1NSX A;  2BRP A;  3VD7 A;  2WCO A;  1K1W A;  1HMU A;  1UG9 A;  1N7R A;  1J0N A;  2WVZ A;  1NS2 A;  2E22 A;  2JKA A;  4DUV A;  2WW0 A;  3K25 A;  1L7J A;  1OJO A;  1SNZ A;  1LF6 A;  1HN0 A;  3J7H A;  3NRE A;  1NSZ A;  3VDC A;  4AQ0 A;  3ECQ A;  3I3B A;  1W3Y A;  3MWX A;  3T0A A;  3DEC A;  2Q1F A;  1LF9 A;  1NSU A;  1PX3 A;  1DP0 A;  1HM2 A;  3T09 A;  1F4A A;  2WVX A;  1JZ2 A;  1ULV A;  1X1I A;  2CIQ A;  3OB8 A;  2D73 A;  2CIR A;  2WDA A;  3MUZ 1;  1Z45 A;  3IAP A;  1TXK A; 
#chains in the Genus database with same CATH topology
 1HMW A;  4MMI A;  3AFJ A;  1V7X A;  1C82 A;  3VDA A;  1JZ8 A;  2CG1 A;  3E1F 1;  3D52 A;  2XN2 A;  5E1Q A;  1IVV A;  3S4C A;  3BVT A;  5A1A A;  3TY1 A;  2Y74 A;  2OQE C;  4DUX A;  3S4A A;  3N9H A;  2F7P A;  3CZS A;  3W7S A;  3CZN A;  4OJZ A;  2CG0 A;  3X42 A;  2F7Q A;  3SXX A;  1N7Q A;  2WOH A;  1JZ4 A;  3NBB A;  4KFD A;  3EJT A;  1AVK A;  3IAQ A;  3NJV A;  1JYW A;  3DYM A;  3VD5 A;  3D4Y A;  3A24 A;  2E2U A;  2XSG A;  1TQS A;  4NEI A;  3MV0 1;  1MMU A;  4FNP A;  1WMO A;  3NJX A;  4OK4 A;  3CV5 A;  3X3Z A;  3QFZ A;  1W6G A;  2JKE A;  2EAE A;  2FYV A;  3WFA A;  4RNL A;  3VSN A;  2WW3 A;  2F7O A;  1WMN A;  2F1A A;  1LXM A;  1JOV A;  1L7K A;  2EAC A;  3DYP A;  1NS0 A;  4BTY A;  2OW6 A;  1US1 A;  3BLB A;  1NS2 A;  4DUV A;  1OJO A;  3DDG A;  3J7H A;  3WA3 A;  4AQ0 A;  3BS6 A;  2CFW A;  3T0A A;  1DP0 A;  3W7U A;  1HM2 A;  3ACT A;  1ULV A;  3BUB A;  1X1I A;  3EJR A;  4MMH A;  2WDA A;  2CQS A;  1IVU A;  5JMF A;  1K1X A;  1N7P A;  1RWF A;  3ACS A;  1JYV A;  2FUT A;  2ZL8 A;  1QX1 A;  2WVY A;  3KII A;  2WO0 A;  1NSS A;  1V7W A;  2YFN A;  2ALW A;  3MUY 1;  3D3I A;  1F9G A;  1YGA A;  1NSM A;  1NS7 A;  1RWA A;  1OJM A;  2OOV A;  2E24 A;  2CFL A;  1HWW A;  1JYX A;  1MN0 A;  3VD3 A;  3DCD A;  2WOF A;  1H54 A;  3EJU A;  2D1W A;  3X41 A;  2WW1 A;  1WMP A;  1MMX A;  1X1J A;  3EJQ A;  1RWG A;  3T08 A;  1W2Z A;  1A2V A;  1MMY A;  2WVX B;  2ZQ0 A;  4BZH A;  3DYO A;  3WA2 X;  3CZJ A;  1LOH A;  2HTB A;  3I3E A;  4EV5 A;  1F1S A;  3BVW A;  3EJP A;  1NSR A;  1F4H A;  3OS7 A;  3AMO A;  2WYH A;  3D4Z A;  1SO0 A;  3BVV A;  1SII A;  1JZ5 A;  1RWC A;  2FUQ A;  4EV2 A;  4FNQ A;  2OQE A;  1IU7 A;  2CWV A;  2WZS A;  1TU5 A;  1J0M A;  1QWU A;  1X1H A;  2WW2 A;  4J5T A;  1CB8 A;  3DDF A;  3BVX A;  1N7R A;  2CQT A;  2JKA A;  1L7J A;  3EJS A;  1SNZ A;  3HII A;  1HN0 A;  3WIQ A;  3W7T A;  1N9E A;  1NSZ A;  3VDC A;  2CFG A;  3I3B A;  1W3Y A;  3MWX A;  3DEC A;  1PX3 A;  1JZ2 A;  1W6C A;  2D73 A;  2CIR A;  3MUZ 1;  1Z45 A;  3DX0 A;  4KFE A;  3Q1N A;  2PNC A;  3QG0 A;  3OBA A;  3T2Q A;  3QFY A;  3VD4 A;  1MMZ A;  2X03 A;  3E7J A;  1TQU A;  3SEP A;  3VDB A;  3D51 A;  5JMD A;  1NS4 A;  1SPU A;  3BGA A;  3BVU A;  2WGQ A;  2XN1 A;  5CA3 A;  1OJN A;  2YX9 A;  1PX4 A;  4BZG A;  3HI7 A;  1TQT A;  2C11 A;  3E80 A;  3T0D A;  1KSI A;  2EAD A;  4FNV A;  3S4D A;  3BUI A;  1JRQ A;  3D50 A;  4K35 A;  3BLC A;  5KBP A;  2E2T A;  1PU4 A;  1TQW A;  3I3D A;  4DUW A;  4KTR A;  1JZ6 A;  1LVN A;  4K3A A;  1NSV A;  2CWU A;  3T0U A;  1N7N A;  1R33 A;  3RRS A;  4UFC A;  1JZ3 A;  1QAK A;  1K1Y A;  1QAL A;  3DX2 A;  1LXK A;  4TTG A;  1R34 A;  1W4N A;  3BUP A;  4KTP A;  1N7O A;  3S4B A;  3VD7 A;  1NSX A;  2BRP A;  1IQY A;  3A0O A;  3QDE A;  1IVX A;  2E2V A;  2WVZ A;  2CFK A;  3HIG A;  3K25 A;  2F1B A;  2W0Q A;  3VSM A;  1RKY A;  1AVL A;  1AV4 A;  3DX3 A;  1RJO A;  1EKM A;  1QAF A;  3MPH A;  1LF9 A;  2CIQ A;  2F18 A;  2EAB A;  2WYI A;  1HXK A;  3WVF A;  3IAP A;  1TXK A;  2CWT A;  3AMO B;  3ALA A;  2ZXQ A;  2BT3 A;  1HN1 A;  3SX1 A;  1DYU A;  3W7X A;  3T2O A;  3LOY A;  2JKP A;  3KN4 A;  4FNT A;  3VD9 A;  3T0B A;  4BZE A;  1UI7 A;  1HM3 A;  1YQ2 A;  1RW9 A;  1W5Z A;  3PGB A;  2HTA A;  1RWH A;  1IQX A;  3BUD A;  3IMH A;  3WIR A;  1SIH A;  1OJP A;  1V7V A;  3MV1 1;  1I8Q A;  2CFD A;  1W7C A;  1NS8 A;  1D6Z A;  3T2P A;  2YFO A;  3DX4 A;  3X40 A;  2BRV X;  1NKG A;  3RSY A;  1JZ7 A;  1OAC A;  2RDY A;  2BRW A;  3LVT A;  2XHN A;  1IVW A;  1LUR A;  2C10 A;  4BTX A;  1EGU A;  3K5T A;  2CIS A;  4FNS A;  1JYN A;  2OOV C;  4BTW A;  2F7R A;  1PS3 A;  1O7D D;  1D6U A;  2Y73 A;  5GW7 A;  4FNU A;  4KFF A;  4BZF A;  3BUQ A;  2WCO A;  1K1W A;  1HMU A;  3X3X A;  1UG9 A;  1J0N A;  3AFL A;  3DX1 A;  4FNR A;  2E22 A;  2WW0 A;  3X3Y A;  1LF6 A;  4OK2 A;  1UI8 A;  3NRE A;  2OW7 A;  3ECQ A;  1HTY A;  2Q1F A;  1NSU A;  2XN0 A;  3T09 A;  3W7W A;  1F4A A;  2WVX A;  3NBJ A;  1D6Y A;  1TQV A;  3OB8 A;  3MI6 A;  1QWN A; 
#chains in the Genus database with same CATH homology
 5JMF A;  1K1X A;  1HMW A;  1N7P A;  1RWF A;  3Q1N A;  4MMI A;  1C82 A;  3OBA A;  1JYV A;  2FUT A;  3T2Q A;  3VD4 A;  3VDA A;  1JZ8 A;  1MMZ A;  3E1F 1;  2WVY A;  2ZXQ A;  1NSS A;  5E1Q A;  1HN1 A;  5A1A A;  2X03 A;  3TY1 A;  3E7J A;  3MUY 1;  3SEP A;  3VDB A;  5JMD A;  1NS4 A;  3T2O A;  4DUX A;  1F9G A;  1YGA A;  2JKP A;  3VD9 A;  1NSM A;  3T0B A;  4BZE A;  3BGA A;  1NS7 A;  1RWA A;  1OJM A;  1HM3 A;  1YQ2 A;  2E24 A;  4OJZ A;  1RW9 A;  2HTA A;  1JYX A;  1RWH A;  1OJN A;  1N7Q A;  1MN0 A;  3VD3 A;  1PX4 A;  3IMH A;  3DCD A;  1JZ4 A;  4BZG A;  3IAQ A;  3NJV A;  1JYW A;  1OJP A;  3MV1 1;  3DYM A;  1I8Q A;  2WW1 A;  3VD5 A;  3E80 A;  1NS8 A;  3T0D A;  3T2P A;  3A24 A;  1MMX A;  2XSG A;  1X1J A;  4FNV A;  1RWG A;  2BRV X;  3T08 A;  4NEI A;  1MMY A;  2WVX B;  1NKG A;  2ZQ0 A;  3BLC A;  3DYO A;  3MV0 1;  4BZH A;  3CZJ A;  1LOH A;  1MMU A;  1JZ7 A;  2BRW A;  2HTB A;  3I3D A;  3I3E A;  2XHN A;  4DUW A;  1LUR A;  3NJX A;  1F1S A;  1JZ6 A;  1NSR A;  4OK4 A;  1F4H A;  3OS7 A;  1EGU A;  1NSV A;  2CIS A;  1N7N A;  1SO0 A;  2JKE A;  3WFA A;  4RNL A;  1JZ5 A;  1JYN A;  1JZ3 A;  1RWC A;  3VSN A;  2WW3 A;  1K1Y A;  2FUQ A;  1LXM A;  2WZS A;  1JOV A;  1L7K A;  1J0M A;  1LXK A;  1X1H A;  4TTG A;  2WW2 A;  3DYP A;  4J5T A;  4BZF A;  1CB8 A;  1N7O A;  1NS0 A;  1NSX A;  2BRP A;  3VD7 A;  3A0O A;  2WCO A;  1K1W A;  1HMU A;  1UG9 A;  1N7R A;  1J0N A;  2WVZ A;  3AFL A;  1NS2 A;  2E22 A;  2JKA A;  4DUV A;  2WW0 A;  3K25 A;  1L7J A;  3VSM A;  1OJO A;  1SNZ A;  1LF6 A;  4OK2 A;  1HN0 A;  3J7H A;  3NRE A;  1NSZ A;  3VDC A;  4AQ0 A;  3ECQ A;  3I3B A;  3BS6 A;  1W3Y A;  3MWX A;  3T0A A;  3DEC A;  2Q1F A;  1LF9 A;  1NSU A;  1PX3 A;  1DP0 A;  1HM2 A;  3T09 A;  1F4A A;  2WVX A;  1JZ2 A;  1ULV A;  1X1I A;  2CIQ A;  4MMH A;  3OB8 A;  2D73 A;  2CIR A;  2WDA A;  3WVF A;  3MUZ 1;  1Z45 A;  3IAP A;  1TXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...