1NS2A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with galactose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns2A00
1HMUA 1OJMA 1JZ4A 2WW3A 3MUY1 1JZ2A 3CZJA 5A1AA 3VDAA 1K1YA 1MMXA 2E22A 1NS7A 1W3YA 3DCDA 3MWXA 3T2QA 2BRVX 2Q1FA 1UG9A 1K1WA 1SNZA 1NSZA 4BZHA 2CISA 1Z45A 1HN0A 1JZ7A 1PX3A 1J0MA 1MMYA 1NSMA 1TXKA 3E1F1 4BZFA 3T0BA 2CIRA 2ZXQA 1RWHA 3OBAA 2WW2A 2WW0A 1JYVA 3DYOA 1L7JA 3T0AA 1LXKA 3VD3A 3I3EA 1MN0A 1N7NA 2WDAA 1RW9A 2WW1A 3WFAA 1NS4A 1JZ6A 1DP0A 2E24A 1NKGA 1HM3A 1RWFA 3ECQA 3SEPA 1MMUA 1NSSA 1MMZA 3MV11 1NSXA 1F1SA 1F4AA 2JKAA 3T08A 1J0NA 3DYPA 2WVXA 4DUWA 1X1JA 2XSGA 1N7PA 4BZEA 1JYXA 4AQ0A 1NSVA 1HMWA 1LOHA 3NJVA 3BGAA 1F4HA 1PX4A 1LF9A 1N7OA 2CIQA 1LURA 1NS0A 1ULVA 3DYMA 3VD7A 1JZ5A 2JKPA 1YGAA 2D73A 3Q1NA 2WCOA 2ZQ0A 1X1IA 3I3BA 2BRWA 3VD4A 1RWAA 1K1XA 1L7KA 1NS8A 1OJPA 1OJNA 3MV01 1X1HA 1JOVA 2HTBA 1JYNA 1JZ3A 3OB8A 1C82A 3K25A 4DUXA 3J7HA 4DUVA 3NJXA 1CB8A 1HM2A 1EGUA 1JZ8A 1N7RA 3NREA 3T0DA 1I8QA 1LXMA 2BRPA 2X03A 1JYWA 3VDCA 3VDBA 2WVXB 3T2OA 3OS7A 1NSUA 3VD9A 1RWGA 1NSRA 3IAPA 1N7QA 1LF6A 1HN1A 3IMHA 3I3DA 3IAQA 1NS2A 2HTAA 3VD5A 2WVZA 3DECA 2XHNA 3MUZ1 2JKEA 3T2PA 1YQ2A 1OJOA 2WZSA 3A24A 4RNLA 5E1QA 1SO0A 4TTGA 1RWCA 2WVYA 1F9GA 3T09A 4BZGA
chains in the Genus database with same CATH superfamily
1OJMA 3CZJA 3W7UA 3VDAA 1HXKA 1TQTA 3X3ZA 3D51A 2E22A 3T2QA 2F7PA 1UG9A 4FNRA 3MI6A 4KFFA 3X42A 1NSZA 1Z45A 1HN0A 3W7TA 1PX3A 5KBPA 1J0MA 1TXKA 4EV5A 2CG1A 3T0BA 1RWHA 2WW0A 3PGBA 3VD3A 1MN0A 3WIQA 1RW9A 3WFAA 1TU5A 3BUQA 2OOVA 1PU4A 1RWFA 1SIIA 2EACA 4OK4A 1IVVA 1F1SA 3BVVA 2CFGA 2WOHA 3NBBA 1RJOA 3DYPA 2WVXA 3BUBA 5JMDA 3DX3A 1N7PA 2YFOA 1HMWA 3DDGA 3VSNA 3BGAA 1F4HA 1LF9A 5CA3A 1H54A 3DYMA 1JZ5A 1V7WA 4FNTA 2F1AA 3SXXA 1K1XA 1NS8A 1RWAA 1OJPA 1X1HA 2OOVC 1D6ZA 2ZL8A 2EAEA 3K25A 1TQWA 3A0OA 3NJXA 1CB8A 2BT3A 3BUPA 1SPUA 2BRPA 2CWUA 2X03A 2F7RA 1QAFA 3NBJA 3W7WA 3D52A 1W7CA 2EADA 2JKEA 3CV5A 1OJOA 1IVWA 1W2ZA 3ALAA 2OQEA 1IVUA 4BTXA 1N9EA 2Y73A 2RDYA 1W4NA 4KTPA 5GW7A 1NS7A 3DCDA 3MWXA 2EABA 3X3XA 4BZHA 2CISA 3EJUA 2CWTA 2YX9A 1JZ7A 1NSMA 4K3AA 3E1F1 4BZFA 3N9HA 3OBAA 3LOYA 1EKMA 3DYOA 1L7JA 1TQVA 1LXKA 1N7NA 2WW1A 2CFWA 3BVTA 2CFDA 1MMUA 3D4ZA 1PS3A 2OQEC 2WO0A 1NSXA 3T08A 3W7SA 1J0NA 3BVXA 2XSGA 3BVUA 1R34A 3D4YA 3ACTA 1PX4A 2E2TA 3X3YA 4J5TA 3E80A 1LURA 1QALA 4FNSA 2C10A 2D73A 3VD4A 3S4BA 1L7KA 4EV2A 1JOVA 2PNCA 1O7DD 2OW7A 1C82A 3J7HA 1UI8A 1IU7A 3BLCA 1EGUA 1A2VA 2CQTA 1OACA 3RSYA 1AVKA 1RKYA 3T0DA 1LXMA 2XN2A 1JYWA 3OS7A 3VD9A 4FNQA 1IQXA 3WIRA 4BTWA 3DX0A 3ACSA 3MUZ1 3A24A 4RNLA 3EJSA 4TTGA 3HIGA 1RWCA 2WVYA 1HMUA 1JZ4A 2ALWA 5A1AA 3AMOA 3QFYA 4MMHA 3W7XA 4OK2A 1SIHA 1K1YA 3SX1A 2CG0A 1W3YA 2Q1FA 1SNZA 1UI7A 1MMYA 2CWVA 2ZXQA 1US1A 2F7QA 2WW2A 2FYVA 1JZ6A 1NS4A 3VSMA 3EJRA 2E24A 3BUIA 1HM3A 3WVFA 3DX4A 1WMPA 3ECQA 1R33A 3EJPA 4FNPA 1MMZA 3QFZA 2JKAA 4KTRA 3QG0A 3BVWA 3HIIA 1QWUA 3BS6A 2FUTA 4BZEA 1NSVA 3TY1A 3DDFA 1W6GA 1HTYA 1N7OA 2CIQA 1NS0A 3Q1NA 4BTYA 2WCOA 1X1IA 3K5TA 3AMOB 3EJTA 3D3IA 1OJNA 3MV01 2HTBA 2WGQA 1JRQA 4DUXA 4DUVA 2WYIA 2Y74A 1N7RA 1TQSA 4NEIA 2F18A 1NSUA 1RWGA 1NSRA 1D6UA 1LVNA 1W6CA 3IAPA 1LF6A 1HN1A 3I3DA 3EJQA 3VD5A 2CQSA 2WVZA 2XHNA 2F1BA 4FNVA 3T2PA 3X41A 3QDEA 1SO0A 4UFCA 1IVXA 3MUY1 1F9GA 3T09A 3KN4A 4BZGA 1V7VA 2FUQA 2WW3A 1JZ2A 1IQYA 1W5ZA 1MMXA 3RRSA 3HI7A 2BRVX 1K1WA 1V7XA 3KIIA 1DYUA 4MMIA 4FNUA 2YFNA 2CIRA 1JYVA 3T0AA 3I3EA 2WDAA 1KSIA 1DP0A 2D1WA 1NKGA 3S4DA 3DX1A 3S4AA 3SEPA 1D6YA 1TQUA 1NSSA 3D50A 3MV11 3WA3A 1QX1A 1F4AA 3CZSA 2E2VA 1AVLA 2E2UA 4DUWA 3E7JA 1X1JA 3WA2X 1JYXA 4AQ0A 1WMNA 3DX2A 2CFKA 2XN0A 4KFDA 1LOHA 3NJVA 3S4CA 1ULVA 3VD7A 5JMFA 2OW6A 2JKPA 1YGAA 2XN1A 2ZQ0A 3T0UA 3I3BA 1WMOA 2BRWA 3AFJA 1JYNA 1JZ3A 3OB8A 4KFEA 2W0QA 3AFLA 4K35A 3MPHA 1HM2A 3CZNA 1JZ8A 3NREA 1I8QA 3BUDA 2CFLA 3VDCA 3VDBA 2WVXB 3T2OA 1HWWA 1QWNA 2C11A 1N7QA 1QAKA 2WOFA 3X40A 3IMHA 3IAQA 1NS2A 2HTAA 3DECA 1YQ2A 4OJZA 2WZSA 3BLBA 5E1QA 3LVTA 2WYHA 2F7OA 1AV4A
chains in the Genus database with same CATH topology
1HMUA 1OJMA 1JZ4A 2FUQA 2WW3A 3MUY1 1JZ2A 3CZJA 5A1AA 4MMHA 4OK2A 3VDAA 1K1YA 1MMXA 2E22A 1NS7A 1W3YA 3DCDA 3MWXA 3T2QA 2BRVX 2Q1FA 1UG9A 1K1WA 1SNZA 1NSZA 4BZHA 2CISA 1Z45A 1HN0A 4MMIA 1JZ7A 1PX3A 1J0MA 1MMYA 1NSMA 1TXKA 3E1F1 4BZFA 3T0BA 2CIRA 2ZXQA 1RWHA 3OBAA 2WW2A 2WW0A 1JYVA 3DYOA 1L7JA 3T0AA 1LXKA 3VD3A 3I3EA 1MN0A 1N7NA 2WDAA 1RW9A 2WW1A 3WFAA 1NS4A 1JZ6A 3VSMA 1DP0A 2E24A 1NKGA 1HM3A 3WVFA 1RWFA 3ECQA 3SEPA 1MMUA 4OK4A 1NSSA 1MMZA 3MV11 1NSXA 1F1SA 1F4AA 2JKAA 3T08A 1J0NA 3DYPA 2WVXA 4DUWA 3E7JA 3BS6A 5JMDA 1X1JA 2XSGA 2FUTA 1N7PA 4BZEA 1JYXA 4AQ0A 1NSVA 3TY1A 1HMWA 3VSNA 1LOHA 3NJVA 3BGAA 1F4HA 1PX4A 1LF9A 4J5TA 1N7OA 3E80A 2CIQA 1LURA 1NS0A 1ULVA 3DYMA 3VD7A 5JMFA 1JZ5A 2JKPA 1YGAA 2D73A 3Q1NA 2WCOA 2ZQ0A 1X1IA 3I3BA 2BRWA 3VD4A 1RWAA 1K1XA 1L7KA 1NS8A 1OJPA 1OJNA 3MV01 1X1HA 1JOVA 2HTBA 1JYNA 1JZ3A 3OB8A 1C82A 3K25A 4DUXA 3J7HA 3AFLA 3A0OA 4DUVA 3NJXA 1CB8A 1HM2A 1EGUA 3BLCA 1JZ8A 1N7RA 3NREA 4NEIA 1I8QA 1LXMA 3T0DA 2BRPA 2X03A 1JYWA 3VDCA 3VDBA 2WVXB 3T2OA 3OS7A 1NSUA 3VD9A 1RWGA 1NSRA 3IAPA 1N7QA 1LF6A 1HN1A 3IMHA 3I3DA 3IAQA 1NS2A 2HTAA 3VD5A 2WVZA 3DECA 2XHNA 3MUZ1 4FNVA 2JKEA 3T2PA 1YQ2A 1OJOA 2WZSA 3A24A 4OJZA 4RNLA 5E1QA 1SO0A 4TTGA 1RWCA 2WVYA 1F9GA 3T09A 4BZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMU A;  1OJM A;  1JZ4 A;  2WW3 A;  3MUY 1;  1JZ2 A;  3CZJ A;  5A1A A;  3VDA A;  1K1Y A;  1MMX A;  2E22 A;  1NS7 A;  1W3Y A;  3DCD A;  3MWX A;  3T2Q A;  2BRV X;  2Q1F A;  1UG9 A;  1K1W A;  1SNZ A;  1NSZ A;  4BZH A;  2CIS A;  1Z45 A;  1HN0 A;  1JZ7 A;  1PX3 A;  1J0M A;  1MMY A;  1NSM A;  1TXK A;  3E1F 1;  4BZF A;  3T0B A;  2CIR A;  2ZXQ A;  1RWH A;  3OBA A;  2WW2 A;  2WW0 A;  1JYV A;  3DYO A;  1L7J A;  3T0A A;  1LXK A;  3VD3 A;  3I3E A;  1MN0 A;  1N7N A;  2WDA A;  1RW9 A;  2WW1 A;  3WFA A;  1NS4 A;  1JZ6 A;  1DP0 A;  2E24 A;  1NKG A;  1HM3 A;  1RWF A;  3ECQ A;  3SEP A;  1MMU A;  1NSS A;  1MMZ A;  3MV1 1;  1NSX A;  1F1S A;  1F4A A;  2JKA A;  3T08 A;  1J0N A;  3DYP A;  2WVX A;  4DUW A;  1X1J A;  2XSG A;  1N7P A;  4BZE A;  1JYX A;  4AQ0 A;  1NSV A;  1HMW A;  1LOH A;  3NJV A;  3BGA A;  1F4H A;  1PX4 A;  1LF9 A;  1N7O A;  2CIQ A;  1LUR A;  1NS0 A;  1ULV A;  3DYM A;  3VD7 A;  1JZ5 A;  2JKP A;  1YGA A;  2D73 A;  3Q1N A;  2WCO A;  2ZQ0 A;  1X1I A;  3I3B A;  2BRW A;  3VD4 A;  1RWA A;  1K1X A;  1L7K A;  1NS8 A;  1OJP A;  1OJN A;  3MV0 1;  1X1H A;  1JOV A;  2HTB A;  1JYN A;  1JZ3 A;  3OB8 A;  1C82 A;  3K25 A;  4DUX A;  3J7H A;  4DUV A;  3NJX A;  1CB8 A;  1HM2 A;  1EGU A;  1JZ8 A;  1N7R A;  3NRE A;  3T0D A;  1I8Q A;  1LXM A;  2BRP A;  2X03 A;  1JYW A;  3VDC A;  3VDB A;  2WVX B;  3T2O A;  3OS7 A;  1NSU A;  3VD9 A;  1RWG A;  1NSR A;  3IAP A;  1N7Q A;  1LF6 A;  1HN1 A;  3IMH A;  3I3D A;  3IAQ A;  1NS2 A;  2HTA A;  3VD5 A;  2WVZ A;  3DEC A;  2XHN A;  3MUZ 1;  2JKE A;  3T2P A;  1YQ2 A;  1OJO A;  2WZS A;  3A24 A;  4RNL A;  5E1Q A;  1SO0 A;  4TTG A;  1RWC A;  2WVY A;  1F9G A;  3T09 A;  4BZG A; 
#chains in the Genus database with same CATH topology
 1OJM A;  3CZJ A;  3W7U A;  3VDA A;  1HXK A;  1TQT A;  3X3Z A;  3D51 A;  2E22 A;  3T2Q A;  2F7P A;  1UG9 A;  4FNR A;  3MI6 A;  4KFF A;  3X42 A;  1NSZ A;  1Z45 A;  1HN0 A;  3W7T A;  1PX3 A;  5KBP A;  1J0M A;  1TXK A;  4EV5 A;  2CG1 A;  3T0B A;  1RWH A;  2WW0 A;  3PGB A;  3VD3 A;  1MN0 A;  3WIQ A;  1RW9 A;  3WFA A;  1TU5 A;  3BUQ A;  2OOV A;  1PU4 A;  1RWF A;  1SII A;  2EAC A;  4OK4 A;  1IVV A;  1F1S A;  3BVV A;  2CFG A;  2WOH A;  3NBB A;  1RJO A;  3DYP A;  2WVX A;  3BUB A;  5JMD A;  3DX3 A;  1N7P A;  2YFO A;  1HMW A;  3DDG A;  3VSN A;  3BGA A;  1F4H A;  1LF9 A;  5CA3 A;  1H54 A;  3DYM A;  1JZ5 A;  1V7W A;  4FNT A;  2F1A A;  3SXX A;  1K1X A;  1NS8 A;  1RWA A;  1OJP A;  1X1H A;  2OOV C;  1D6Z A;  2ZL8 A;  2EAE A;  3K25 A;  1TQW A;  3A0O A;  3NJX A;  1CB8 A;  2BT3 A;  3BUP A;  1SPU A;  2BRP A;  2CWU A;  2X03 A;  2F7R A;  1QAF A;  3NBJ A;  3W7W A;  3D52 A;  1W7C A;  2EAD A;  2JKE A;  3CV5 A;  1OJO A;  1IVW A;  1W2Z A;  3ALA A;  2OQE A;  1IVU A;  4BTX A;  1N9E A;  2Y73 A;  2RDY A;  1W4N A;  4KTP A;  5GW7 A;  1NS7 A;  3DCD A;  3MWX A;  2EAB A;  3X3X A;  4BZH A;  2CIS A;  3EJU A;  2CWT A;  2YX9 A;  1JZ7 A;  1NSM A;  4K3A A;  3E1F 1;  4BZF A;  3N9H A;  3OBA A;  3LOY A;  1EKM A;  3DYO A;  1L7J A;  1TQV A;  1LXK A;  1N7N A;  2WW1 A;  2CFW A;  3BVT A;  2CFD A;  1MMU A;  3D4Z A;  1PS3 A;  2OQE C;  2WO0 A;  1NSX A;  3T08 A;  3W7S A;  1J0N A;  3BVX A;  2XSG A;  3BVU A;  1R34 A;  3D4Y A;  3ACT A;  1PX4 A;  2E2T A;  3X3Y A;  4J5T A;  3E80 A;  1LUR A;  1QAL A;  4FNS A;  2C10 A;  2D73 A;  3VD4 A;  3S4B A;  1L7K A;  4EV2 A;  1JOV A;  2PNC A;  1O7D D;  2OW7 A;  1C82 A;  3J7H A;  1UI8 A;  1IU7 A;  3BLC A;  1EGU A;  1A2V A;  2CQT A;  1OAC A;  3RSY A;  1AVK A;  1RKY A;  3T0D A;  1LXM A;  2XN2 A;  1JYW A;  3OS7 A;  3VD9 A;  4FNQ A;  1IQX A;  3WIR A;  4BTW A;  3DX0 A;  3ACS A;  3MUZ 1;  3A24 A;  4RNL A;  3EJS A;  4TTG A;  3HIG A;  1RWC A;  2WVY A;  1HMU A;  1JZ4 A;  2ALW A;  5A1A A;  3AMO A;  3QFY A;  4MMH A;  3W7X A;  4OK2 A;  1SIH A;  1K1Y A;  3SX1 A;  2CG0 A;  1W3Y A;  2Q1F A;  1SNZ A;  1UI7 A;  1MMY A;  2CWV A;  2ZXQ A;  1US1 A;  2F7Q A;  2WW2 A;  2FYV A;  1JZ6 A;  1NS4 A;  3VSM A;  3EJR A;  2E24 A;  3BUI A;  1HM3 A;  3WVF A;  3DX4 A;  1WMP A;  3ECQ A;  1R33 A;  3EJP A;  4FNP A;  1MMZ A;  3QFZ A;  2JKA A;  4KTR A;  3QG0 A;  3BVW A;  3HII A;  1QWU A;  3BS6 A;  2FUT A;  4BZE A;  1NSV A;  3TY1 A;  3DDF A;  1W6G A;  1HTY A;  1N7O A;  2CIQ A;  1NS0 A;  3Q1N A;  4BTY A;  2WCO A;  1X1I A;  3K5T A;  3AMO B;  3EJT A;  3D3I A;  1OJN A;  3MV0 1;  2HTB A;  2WGQ A;  1JRQ A;  4DUX A;  4DUV A;  2WYI A;  2Y74 A;  1N7R A;  1TQS A;  4NEI A;  2F18 A;  1NSU A;  1RWG A;  1NSR A;  1D6U A;  1LVN A;  1W6C A;  3IAP A;  1LF6 A;  1HN1 A;  3I3D A;  3EJQ A;  3VD5 A;  2CQS A;  2WVZ A;  2XHN A;  2F1B A;  4FNV A;  3T2P A;  3X41 A;  3QDE A;  1SO0 A;  4UFC A;  1IVX A;  3MUY 1;  1F9G A;  3T09 A;  3KN4 A;  4BZG A;  1V7V A;  2FUQ A;  2WW3 A;  1JZ2 A;  1IQY A;  1W5Z A;  1MMX A;  3RRS A;  3HI7 A;  2BRV X;  1K1W A;  1V7X A;  3KII A;  1DYU A;  4MMI A;  4FNU A;  2YFN A;  2CIR A;  1JYV A;  3T0A A;  3I3E A;  2WDA A;  1KSI A;  1DP0 A;  2D1W A;  1NKG A;  3S4D A;  3DX1 A;  3S4A A;  3SEP A;  1D6Y A;  1TQU A;  1NSS A;  3D50 A;  3MV1 1;  3WA3 A;  1QX1 A;  1F4A A;  3CZS A;  2E2V A;  1AVL A;  2E2U A;  4DUW A;  3E7J A;  1X1J A;  3WA2 X;  1JYX A;  4AQ0 A;  1WMN A;  3DX2 A;  2CFK A;  2XN0 A;  4KFD A;  1LOH A;  3NJV A;  3S4C A;  1ULV A;  3VD7 A;  5JMF A;  2OW6 A;  2JKP A;  1YGA A;  2XN1 A;  2ZQ0 A;  3T0U A;  3I3B A;  1WMO A;  2BRW A;  3AFJ A;  1JYN A;  1JZ3 A;  3OB8 A;  4KFE A;  2W0Q A;  3AFL A;  4K35 A;  3MPH A;  1HM2 A;  3CZN A;  1JZ8 A;  3NRE A;  1I8Q A;  3BUD A;  2CFL A;  3VDC A;  3VDB A;  2WVX B;  3T2O A;  1HWW A;  1QWN A;  2C11 A;  1N7Q A;  1QAK A;  2WOF A;  3X40 A;  3IMH A;  3IAQ A;  1NS2 A;  2HTA A;  3DEC A;  1YQ2 A;  4OJZ A;  2WZS A;  3BLB A;  5E1Q A;  3LVT A;  2WYH A;  2F7O A;  1AV4 A; 
#chains in the Genus database with same CATH homology
 1HMU A;  1OJM A;  1JZ4 A;  2FUQ A;  2WW3 A;  3MUY 1;  1JZ2 A;  3CZJ A;  5A1A A;  4MMH A;  4OK2 A;  3VDA A;  1K1Y A;  1MMX A;  2E22 A;  1NS7 A;  1W3Y A;  3DCD A;  3MWX A;  3T2Q A;  2BRV X;  2Q1F A;  1UG9 A;  1K1W A;  1SNZ A;  1NSZ A;  4BZH A;  2CIS A;  1Z45 A;  1HN0 A;  4MMI A;  1JZ7 A;  1PX3 A;  1J0M A;  1MMY A;  1NSM A;  1TXK A;  3E1F 1;  4BZF A;  3T0B A;  2CIR A;  2ZXQ A;  1RWH A;  3OBA A;  2WW2 A;  2WW0 A;  1JYV A;  3DYO A;  1L7J A;  3T0A A;  1LXK A;  3VD3 A;  3I3E A;  1MN0 A;  1N7N A;  2WDA A;  1RW9 A;  2WW1 A;  3WFA A;  1NS4 A;  1JZ6 A;  3VSM A;  1DP0 A;  2E24 A;  1NKG A;  1HM3 A;  3WVF A;  1RWF A;  3ECQ A;  3SEP A;  1MMU A;  4OK4 A;  1NSS A;  1MMZ A;  3MV1 1;  1NSX A;  1F1S A;  1F4A A;  2JKA A;  3T08 A;  1J0N A;  3DYP A;  2WVX A;  4DUW A;  3E7J A;  3BS6 A;  5JMD A;  1X1J A;  2XSG A;  2FUT A;  1N7P A;  4BZE A;  1JYX A;  4AQ0 A;  1NSV A;  3TY1 A;  1HMW A;  3VSN A;  1LOH A;  3NJV A;  3BGA A;  1F4H A;  1PX4 A;  1LF9 A;  4J5T A;  1N7O A;  3E80 A;  2CIQ A;  1LUR A;  1NS0 A;  1ULV A;  3DYM A;  3VD7 A;  5JMF A;  1JZ5 A;  2JKP A;  1YGA A;  2D73 A;  3Q1N A;  2WCO A;  2ZQ0 A;  1X1I A;  3I3B A;  2BRW A;  3VD4 A;  1RWA A;  1K1X A;  1L7K A;  1NS8 A;  1OJP A;  1OJN A;  3MV0 1;  1X1H A;  1JOV A;  2HTB A;  1JYN A;  1JZ3 A;  3OB8 A;  1C82 A;  3K25 A;  4DUX A;  3J7H A;  3AFL A;  3A0O A;  4DUV A;  3NJX A;  1CB8 A;  1HM2 A;  1EGU A;  3BLC A;  1JZ8 A;  1N7R A;  3NRE A;  4NEI A;  1I8Q A;  1LXM A;  3T0D A;  2BRP A;  2X03 A;  1JYW A;  3VDC A;  3VDB A;  2WVX B;  3T2O A;  3OS7 A;  1NSU A;  3VD9 A;  1RWG A;  1NSR A;  3IAP A;  1N7Q A;  1LF6 A;  1HN1 A;  3IMH A;  3I3D A;  3IAQ A;  1NS2 A;  2HTA A;  3VD5 A;  2WVZ A;  3DEC A;  2XHN A;  3MUZ 1;  4FNV A;  2JKE A;  3T2P A;  1YQ2 A;  1OJO A;  2WZS A;  3A24 A;  4OJZ A;  4RNL A;  5E1Q A;  1SO0 A;  4TTG A;  1RWC A;  2WVY A;  1F9G A;  3T09 A;  4BZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...