1MMYA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-quinovose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmyA00
1JZ8A 1F1SA 1NS8A 3DYOA 2X03A 3T0BA 1NSXA 2D73A 3NREA 1RWHA 3VDAA 1K1WA 1RWAA 4DUVA 3DCDA 1SNZA 1NSUA 3DYPA 1L7JA 1X1IA 4DUXA 3VD5A 1MMUA 2HTAA 3T08A 3K25A 1NS0A 1NS2A 2XHNA 1OJPA 1N7RA 2ZQ0A 3OBAA 1N7NA 3T0AA 1LF6A 1HM2A 1OJOA 1JYVA 1N7OA 3E1F1 1MN0A 1NSMA 2HTBA 3NJXA 1JYNA 2WW2A 1SO0A 3MUZ1 1C82A 1OJNA 1ULVA 2WCOA 2BRVX 4RNLA 1CB8A 1X1HA 3MV11 2CIRA 1JZ3A 1LF9A 1Z45A 2WDAA 1F9GA 3CZJA 3I3EA 1JZ6A 1L7KA 3VDBA 1J0MA 1RWFA 3OS7A 3VD9A 2JKPA 4BZHA 1JYXA 1NS4A 1PX3A 4BZFA 1LOHA 1LURA 1JOVA 2WVZA 1YGAA 2CIQA 1NSVA 1F4AA 1N7PA 1JZ4A 2WVXA 1I8QA 3IAPA 1JZ5A 1RW9A 1W3YA 1HMWA 1LXMA 2WW0A 3DYMA 2JKEA 1J0NA 2BRPA 2XSGA 3DECA 1MMXA 3IMHA 3T09A 1HM3A 3VD7A 1OJMA 1RWGA 5A1AA 1DP0A 1NKGA 1F4HA 4BZEA 1UG9A 3SEPA 3T2PA 1LXKA 2WW3A 2ZXQA 3WFAA 1PX4A 3I3BA 1N7QA 3J7HA 1K1YA 3VD4A 1MMZA 3MUY1 3IAQA 3MWXA 1MMYA 1EGUA 4DUWA 2BRWA 3T0DA 3ECQA 2WVYA 3T2OA 2WW1A 1RWCA 1JZ7A 1NSRA 1JZ2A 1YQ2A 3MV01 2WVXB 4BZGA 1NSSA 2E24A 1X1JA 5E1QA 1HMUA 3VDCA 4AQ0A 1HN1A 3VD3A 1NS7A 4TTGA 3T2QA 3NJVA 1NSZA 1K1XA 1TXKA 3I3DA 1HN0A 3OB8A 3A24A 2WZSA 2CISA 1JYWA 3Q1NA 2E22A 2JKAA 3BGAA 2Q1FA
chains in the Genus database with same CATH superfamily
2F7RA 3D50A 1JZ8A 1NS8A 1PU4A 2EABA 2CWVA 3VSNA 3W7UA 1X1IA 4MMIA 1MMUA 2E2VA 1NS0A 1NS2A 1OJPA 1N7RA 1LF6A 1OJOA 3QFYA 3E1F1 1MN0A 1NSMA 3NJXA 2YX9A 2WW2A 3S4DA 3NBJA 1ULVA 2WCOA 2BRVX 3D3IA 3WIQA 3MV11 2ALWA 3S4CA 1Z45A 2CFKA 2CG0A 1JZ6A 3VDBA 1RWFA 3VD9A 2C10A 1KSIA 3X3YA 1LOHA 1YGAA 1F4AA 1N7PA 1I8QA 1LXMA 3QFZA 4FNTA 2JKEA 1EKMA 1QWNA 3DECA 1MMXA 3VD7A 3AMOB 4BZEA 1TQUA 3T0UA 3DX4A 1N7QA 1WMNA 2BT3A 2W0QA 2WOFA 3MWXA 1EGUA 2F7PA 3HIGA 3QDEA 3T0DA 3SX1A 2EAEA 1QALA 1IVVA 3TY1A 3K5TA 4FNSA 4KFEA 3BS6A 1JZ2A 3HI7A 1YQ2A 3X41A 4BTXA 2WYHA 3BVUA 1HMUA 4AQ0A 3QG0A 3VD3A 3WVFA 2CFGA 3NJVA 3BVWA 1TXKA 3KN4A 3A24A 1JYWA 2JKAA 4KTPA 3E80A 3DYOA 2X03A 1AVKA 3D52A 1QX1A 1K1WA 1SNZA 1NSUA 1SIHA 1W6CA 3DYPA 3K25A 1O7DD 2WO0A 1IU7A 1N7OA 1W4NA 1SO0A 3ACSA 3BUPA 1OJNA 1D6UA 2YFNA 1CB8A 2CIRA 1QAFA 3X3ZA 4FNVA 2WDAA 4UFCA 1J0MA 2JKPA 2F1BA 1PX3A 3D4YA 4BZFA 1LURA 5JMFA 2WVZA 3DX0A 3CV5A 2FYVA 1JZ4A 2WVXA 3DYMA 3CZSA 4BTWA 1N9EA 3MI6A 3T09A 2PNCA 3DX3A 1F4HA 2CG1A 3SEPA 1LXKA 4KFFA 1PX4A 3PGBA 2OOVA 4OK2A 3J7HA 3VD4A 1V7VA 1QWUA 3MUY1 2CFDA 1IQYA 3WIRA 3DX2A 1SIIA 1NSRA 3BUDA 3MPHA 2E24A 3EJPA 2OW6A 1R33A 5E1QA 2XN2A 1HN1A 3A0OA 2D1WA 1AV4A 4K35A 4NEIA 2WGQA 3I3DA 3BUIA 2E2TA 1RJOA 3OB8A 4FNPA 2FUQA 3VSMA 2WZSA 3Q1NA 2EACA 3BGAA 2F18A 1IVUA 1F1SA 3T0BA 5CA3A 2D73A 3NREA 3VDAA 1A2VA 4DUVA 1WMOA 4OJZA 3RRSA 4DUXA 2XHNA 4EV5A 3D51A 1HXKA 3BVTA 3OBAA 2E2UA 1N7NA 3T0AA 3DDFA 3X42A 3NBBA 2CFWA 2HTBA 1JYNA 3W7XA 3LOYA 3E7JA 1C82A 3SXXA 5JMDA 2OQEA 4RNLA 1US1A 1JZ3A 1F9GA 3CZJA 1LVNA 3LVTA 3AFJA 2F7OA 3X40A 1JYXA 1NS4A 1V7WA 1V7XA 2F7QA 1NSVA 1W2ZA 2CFLA 3RSYA 1JZ5A 3IAPA 1RW9A 1HMWA 3W7SA 2BRPA 2XSGA 1IVXA 1R34A 1JRQA 1UI7A 1DP0A 2WW3A 2XN0A 3WFAA 3I3BA 2OW7A 3WA3A 2FUTA 3S4AA 3DX1A 3AFLA 4KTRA 1TU5A 3W7TA 3N9HA 4DUWA 2BRWA 1H54A 3ECQA 3T2OA 1D6ZA 1RWCA 1IQXA 3KIIA 4MMHA 1JZ7A 1PS3A 4OK4A 2WOHA 3MV01 4BZGA 3EJTA 4K3AA 2RDYA 1X1JA 3ALAA 1W7CA 3HIIA 1TQSA 3DDGA 3T2QA 1NSZA 1K1XA 1TQTA 1HTYA 1TQVA 3D4ZA 3BLBA 4FNUA 2CQSA 2CISA 3BUQA 2CWUA 2E22A 4FNRA 2WYIA 2Q1FA 1TQWA 1NSXA 1RWHA 2OOVC 1D6YA 3CZNA 1RWAA 3DCDA 4J5TA 1L7JA 3VD5A 2Y73A 1AVLA 2HTAA 3T08A 1OACA 1QAKA 2ZQ0A 1HM2A 1JYVA 1DYUA 3MUZ1 2XN1A 3S4BA 1X1HA 2YFOA 2CWTA 1W5ZA 4KFDA 1LF9A 1IVWA 2C11A 3I3EA 1L7KA 3EJRA 3OS7A 4EV2A 4BZHA 2Y74A 1JOVA 3ACTA 2CQTA 2CIQA 3AMOA 1W3YA 2WW0A 3EJUA 1J0NA 3IMHA 1HM3A 2ZL8A 1OJMA 1RWGA 5A1AA 1HWWA 1NKGA 1UG9A 3T2PA 2EADA 2ZXQA 3X3XA 3WA2X 4BTYA 1K1YA 1MMZA 1WMPA 1W6GA 3IAQA 1MMYA 3BVVA 1RKYA 2WVYA 2WW1A 2OQEC 1SPUA 2WVXB 3BVXA 1NSSA 3BUBA 5KBPA 2F1AA 3W7WA 3VDCA 3EJQA 1NS7A 4TTGA 3EJSA 1UI8A 5GW7A 4FNQA 1HN0A 3BLCA
chains in the Genus database with same CATH topology
1JZ8A 1F1SA 1NS8A 3E80A 3DYOA 2X03A 3T0BA 1NSXA 2D73A 3NREA 1RWHA 3VDAA 1K1WA 1RWAA 3VSNA 4DUVA 3DCDA 1SNZA 1NSUA 3DYPA 1L7JA 1X1IA 4J5TA 4MMIA 4OJZA 3VD5A 4DUXA 1MMUA 2HTAA 3T08A 3K25A 1NS0A 1NS2A 2XHNA 1OJPA 1N7RA 2ZQ0A 3OBAA 1N7NA 3T0AA 1LF6A 1HM2A 1OJOA 1JYVA 1N7OA 3E1F1 1MN0A 1NSMA 2HTBA 3NJXA 1JYNA 2WW2A 1SO0A 3MUZ1 3E7JA 1C82A 1OJNA 5JMDA 1ULVA 2WCOA 2BRVX 4RNLA 1CB8A 1X1HA 3MV11 2CIRA 1JZ3A 1LF9A 1Z45A 4FNVA 2WDAA 1F9GA 3CZJA 3I3EA 1JZ6A 1L7KA 3VDBA 1J0MA 1RWFA 3OS7A 3VD9A 2JKPA 4BZHA 1JYXA 1NS4A 1PX3A 4BZFA 1LOHA 1LURA 1JOVA 5JMFA 2WVZA 1YGAA 2CIQA 1NSVA 1F4AA 1N7PA 1JZ4A 2WVXA 1I8QA 3IAPA 1JZ5A 1RW9A 1W3YA 1HMWA 1LXMA 2WW0A 3DYMA 2JKEA 1J0NA 2BRPA 2XSGA 3DECA 1MMXA 3IMHA 3T09A 1HM3A 3VD7A 1OJMA 1RWGA 5A1AA 1DP0A 1NKGA 1F4HA 4BZEA 1UG9A 3SEPA 3T2PA 1LXKA 2WW3A 2ZXQA 3WFAA 1PX4A 3I3BA 1N7QA 4OK2A 3J7HA 1K1YA 3VD4A 2FUTA 1MMZA 3MUY1 3IAQA 3MWXA 1MMYA 3AFLA 1EGUA 4DUWA 2BRWA 3T0DA 3ECQA 2WVYA 3T2OA 2WW1A 1RWCA 4MMHA 1JZ7A 3TY1A 1NSRA 4OK4A 3BS6A 1JZ2A 1YQ2A 3MV01 2WVXB 4BZGA 1NSSA 2E24A 1X1JA 5E1QA 1HMUA 3VDCA 4AQ0A 1HN1A 3VD3A 1NS7A 3A0OA 3WVFA 4TTGA 3T2QA 3NJVA 1NSZA 1K1XA 1TXKA 4NEIA 3I3DA 1HN0A 3BLCA 3OB8A 2FUQA 3A24A 3VSMA 2WZSA 2CISA 1JYWA 3Q1NA 2E22A 2JKAA 3BGAA 2Q1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZ8 A;  1F1S A;  1NS8 A;  3DYO A;  2X03 A;  3T0B A;  1NSX A;  2D73 A;  3NRE A;  1RWH A;  3VDA A;  1K1W A;  1RWA A;  4DUV A;  3DCD A;  1SNZ A;  1NSU A;  3DYP A;  1L7J A;  1X1I A;  4DUX A;  3VD5 A;  1MMU A;  2HTA A;  3T08 A;  3K25 A;  1NS0 A;  1NS2 A;  2XHN A;  1OJP A;  1N7R A;  2ZQ0 A;  3OBA A;  1N7N A;  3T0A A;  1LF6 A;  1HM2 A;  1OJO A;  1JYV A;  1N7O A;  3E1F 1;  1MN0 A;  1NSM A;  2HTB A;  3NJX A;  1JYN A;  2WW2 A;  1SO0 A;  3MUZ 1;  1C82 A;  1OJN A;  1ULV A;  2WCO A;  2BRV X;  4RNL A;  1CB8 A;  1X1H A;  3MV1 1;  2CIR A;  1JZ3 A;  1LF9 A;  1Z45 A;  2WDA A;  1F9G A;  3CZJ A;  3I3E A;  1JZ6 A;  1L7K A;  3VDB A;  1J0M A;  1RWF A;  3OS7 A;  3VD9 A;  2JKP A;  4BZH A;  1JYX A;  1NS4 A;  1PX3 A;  4BZF A;  1LOH A;  1LUR A;  1JOV A;  2WVZ A;  1YGA A;  2CIQ A;  1NSV A;  1F4A A;  1N7P A;  1JZ4 A;  2WVX A;  1I8Q A;  3IAP A;  1JZ5 A;  1RW9 A;  1W3Y A;  1HMW A;  1LXM A;  2WW0 A;  3DYM A;  2JKE A;  1J0N A;  2BRP A;  2XSG A;  3DEC A;  1MMX A;  3IMH A;  3T09 A;  1HM3 A;  3VD7 A;  1OJM A;  1RWG A;  5A1A A;  1DP0 A;  1NKG A;  1F4H A;  4BZE A;  1UG9 A;  3SEP A;  3T2P A;  1LXK A;  2WW3 A;  2ZXQ A;  3WFA A;  1PX4 A;  3I3B A;  1N7Q A;  3J7H A;  1K1Y A;  3VD4 A;  1MMZ A;  3MUY 1;  3IAQ A;  3MWX A;  1MMY A;  1EGU A;  4DUW A;  2BRW A;  3T0D A;  3ECQ A;  2WVY A;  3T2O A;  2WW1 A;  1RWC A;  1JZ7 A;  1NSR A;  1JZ2 A;  1YQ2 A;  3MV0 1;  2WVX B;  4BZG A;  1NSS A;  2E24 A;  1X1J A;  5E1Q A;  1HMU A;  3VDC A;  4AQ0 A;  1HN1 A;  3VD3 A;  1NS7 A;  4TTG A;  3T2Q A;  3NJV A;  1NSZ A;  1K1X A;  1TXK A;  3I3D A;  1HN0 A;  3OB8 A;  3A24 A;  2WZS A;  2CIS A;  1JYW A;  3Q1N A;  2E22 A;  2JKA A;  3BGA A;  2Q1F A; 
#chains in the Genus database with same CATH topology
 2F7R A;  3D50 A;  1JZ8 A;  1NS8 A;  1PU4 A;  2EAB A;  2CWV A;  3VSN A;  3W7U A;  1X1I A;  4MMI A;  1MMU A;  2E2V A;  1NS0 A;  1NS2 A;  1OJP A;  1N7R A;  1LF6 A;  1OJO A;  3QFY A;  3E1F 1;  1MN0 A;  1NSM A;  3NJX A;  2YX9 A;  2WW2 A;  3S4D A;  3NBJ A;  1ULV A;  2WCO A;  2BRV X;  3D3I A;  3WIQ A;  3MV1 1;  2ALW A;  3S4C A;  1Z45 A;  2CFK A;  2CG0 A;  1JZ6 A;  3VDB A;  1RWF A;  3VD9 A;  2C10 A;  1KSI A;  3X3Y A;  1LOH A;  1YGA A;  1F4A A;  1N7P A;  1I8Q A;  1LXM A;  3QFZ A;  4FNT A;  2JKE A;  1EKM A;  1QWN A;  3DEC A;  1MMX A;  3VD7 A;  3AMO B;  4BZE A;  1TQU A;  3T0U A;  3DX4 A;  1N7Q A;  1WMN A;  2BT3 A;  2W0Q A;  2WOF A;  3MWX A;  1EGU A;  2F7P A;  3HIG A;  3QDE A;  3T0D A;  3SX1 A;  2EAE A;  1QAL A;  1IVV A;  3TY1 A;  3K5T A;  4FNS A;  4KFE A;  3BS6 A;  1JZ2 A;  3HI7 A;  1YQ2 A;  3X41 A;  4BTX A;  2WYH A;  3BVU A;  1HMU A;  4AQ0 A;  3QG0 A;  3VD3 A;  3WVF A;  2CFG A;  3NJV A;  3BVW A;  1TXK A;  3KN4 A;  3A24 A;  1JYW A;  2JKA A;  4KTP A;  3E80 A;  3DYO A;  2X03 A;  1AVK A;  3D52 A;  1QX1 A;  1K1W A;  1SNZ A;  1NSU A;  1SIH A;  1W6C A;  3DYP A;  3K25 A;  1O7D D;  2WO0 A;  1IU7 A;  1N7O A;  1W4N A;  1SO0 A;  3ACS A;  3BUP A;  1OJN A;  1D6U A;  2YFN A;  1CB8 A;  2CIR A;  1QAF A;  3X3Z A;  4FNV A;  2WDA A;  4UFC A;  1J0M A;  2JKP A;  2F1B A;  1PX3 A;  3D4Y A;  4BZF A;  1LUR A;  5JMF A;  2WVZ A;  3DX0 A;  3CV5 A;  2FYV A;  1JZ4 A;  2WVX A;  3DYM A;  3CZS A;  4BTW A;  1N9E A;  3MI6 A;  3T09 A;  2PNC A;  3DX3 A;  1F4H A;  2CG1 A;  3SEP A;  1LXK A;  4KFF A;  1PX4 A;  3PGB A;  2OOV A;  4OK2 A;  3J7H A;  3VD4 A;  1V7V A;  1QWU A;  3MUY 1;  2CFD A;  1IQY A;  3WIR A;  3DX2 A;  1SII A;  1NSR A;  3BUD A;  3MPH A;  2E24 A;  3EJP A;  2OW6 A;  1R33 A;  5E1Q A;  2XN2 A;  1HN1 A;  3A0O A;  2D1W A;  1AV4 A;  4K35 A;  4NEI A;  2WGQ A;  3I3D A;  3BUI A;  2E2T A;  1RJO A;  3OB8 A;  4FNP A;  2FUQ A;  3VSM A;  2WZS A;  3Q1N A;  2EAC A;  3BGA A;  2F18 A;  1IVU A;  1F1S A;  3T0B A;  5CA3 A;  2D73 A;  3NRE A;  3VDA A;  1A2V A;  4DUV A;  1WMO A;  4OJZ A;  3RRS A;  4DUX A;  2XHN A;  4EV5 A;  3D51 A;  1HXK A;  3BVT A;  3OBA A;  2E2U A;  1N7N A;  3T0A A;  3DDF A;  3X42 A;  3NBB A;  2CFW A;  2HTB A;  1JYN A;  3W7X A;  3LOY A;  3E7J A;  1C82 A;  3SXX A;  5JMD A;  2OQE A;  4RNL A;  1US1 A;  1JZ3 A;  1F9G A;  3CZJ A;  1LVN A;  3LVT A;  3AFJ A;  2F7O A;  3X40 A;  1JYX A;  1NS4 A;  1V7W A;  1V7X A;  2F7Q A;  1NSV A;  1W2Z A;  2CFL A;  3RSY A;  1JZ5 A;  3IAP A;  1RW9 A;  1HMW A;  3W7S A;  2BRP A;  2XSG A;  1IVX A;  1R34 A;  1JRQ A;  1UI7 A;  1DP0 A;  2WW3 A;  2XN0 A;  3WFA A;  3I3B A;  2OW7 A;  3WA3 A;  2FUT A;  3S4A A;  3DX1 A;  3AFL A;  4KTR A;  1TU5 A;  3W7T A;  3N9H A;  4DUW A;  2BRW A;  1H54 A;  3ECQ A;  3T2O A;  1D6Z A;  1RWC A;  1IQX A;  3KII A;  4MMH A;  1JZ7 A;  1PS3 A;  4OK4 A;  2WOH A;  3MV0 1;  4BZG A;  3EJT A;  4K3A A;  2RDY A;  1X1J A;  3ALA A;  1W7C A;  3HII A;  1TQS A;  3DDG A;  3T2Q A;  1NSZ A;  1K1X A;  1TQT A;  1HTY A;  1TQV A;  3D4Z A;  3BLB A;  4FNU A;  2CQS A;  2CIS A;  3BUQ A;  2CWU A;  2E22 A;  4FNR A;  2WYI A;  2Q1F A;  1TQW A;  1NSX A;  1RWH A;  2OOV C;  1D6Y A;  3CZN A;  1RWA A;  3DCD A;  4J5T A;  1L7J A;  3VD5 A;  2Y73 A;  1AVL A;  2HTA A;  3T08 A;  1OAC A;  1QAK A;  2ZQ0 A;  1HM2 A;  1JYV A;  1DYU A;  3MUZ 1;  2XN1 A;  3S4B A;  1X1H A;  2YFO A;  2CWT A;  1W5Z A;  4KFD A;  1LF9 A;  1IVW A;  2C11 A;  3I3E A;  1L7K A;  3EJR A;  3OS7 A;  4EV2 A;  4BZH A;  2Y74 A;  1JOV A;  3ACT A;  2CQT A;  2CIQ A;  3AMO A;  1W3Y A;  2WW0 A;  3EJU A;  1J0N A;  3IMH A;  1HM3 A;  2ZL8 A;  1OJM A;  1RWG A;  5A1A A;  1HWW A;  1NKG A;  1UG9 A;  3T2P A;  2EAD A;  2ZXQ A;  3X3X A;  3WA2 X;  4BTY A;  1K1Y A;  1MMZ A;  1WMP A;  1W6G A;  3IAQ A;  1MMY A;  3BVV A;  1RKY A;  2WVY A;  2WW1 A;  2OQE C;  1SPU A;  2WVX B;  3BVX A;  1NSS A;  3BUB A;  5KBP A;  2F1A A;  3W7W A;  3VDC A;  3EJQ A;  1NS7 A;  4TTG A;  3EJS A;  1UI8 A;  5GW7 A;  4FNQ A;  1HN0 A;  3BLC A; 
#chains in the Genus database with same CATH homology
 1JZ8 A;  1F1S A;  1NS8 A;  3E80 A;  3DYO A;  2X03 A;  3T0B A;  1NSX A;  2D73 A;  3NRE A;  1RWH A;  3VDA A;  1K1W A;  1RWA A;  3VSN A;  4DUV A;  3DCD A;  1SNZ A;  1NSU A;  3DYP A;  1L7J A;  1X1I A;  4J5T A;  4MMI A;  4OJZ A;  3VD5 A;  4DUX A;  1MMU A;  2HTA A;  3T08 A;  3K25 A;  1NS0 A;  1NS2 A;  2XHN A;  1OJP A;  1N7R A;  2ZQ0 A;  3OBA A;  1N7N A;  3T0A A;  1LF6 A;  1HM2 A;  1OJO A;  1JYV A;  1N7O A;  3E1F 1;  1MN0 A;  1NSM A;  2HTB A;  3NJX A;  1JYN A;  2WW2 A;  1SO0 A;  3MUZ 1;  3E7J A;  1C82 A;  1OJN A;  5JMD A;  1ULV A;  2WCO A;  2BRV X;  4RNL A;  1CB8 A;  1X1H A;  3MV1 1;  2CIR A;  1JZ3 A;  1LF9 A;  1Z45 A;  4FNV A;  2WDA A;  1F9G A;  3CZJ A;  3I3E A;  1JZ6 A;  1L7K A;  3VDB A;  1J0M A;  1RWF A;  3OS7 A;  3VD9 A;  2JKP A;  4BZH A;  1JYX A;  1NS4 A;  1PX3 A;  4BZF A;  1LOH A;  1LUR A;  1JOV A;  5JMF A;  2WVZ A;  1YGA A;  2CIQ A;  1NSV A;  1F4A A;  1N7P A;  1JZ4 A;  2WVX A;  1I8Q A;  3IAP A;  1JZ5 A;  1RW9 A;  1W3Y A;  1HMW A;  1LXM A;  2WW0 A;  3DYM A;  2JKE A;  1J0N A;  2BRP A;  2XSG A;  3DEC A;  1MMX A;  3IMH A;  3T09 A;  1HM3 A;  3VD7 A;  1OJM A;  1RWG A;  5A1A A;  1DP0 A;  1NKG A;  1F4H A;  4BZE A;  1UG9 A;  3SEP A;  3T2P A;  1LXK A;  2WW3 A;  2ZXQ A;  3WFA A;  1PX4 A;  3I3B A;  1N7Q A;  4OK2 A;  3J7H A;  1K1Y A;  3VD4 A;  2FUT A;  1MMZ A;  3MUY 1;  3IAQ A;  3MWX A;  1MMY A;  3AFL A;  1EGU A;  4DUW A;  2BRW A;  3T0D A;  3ECQ A;  2WVY A;  3T2O A;  2WW1 A;  1RWC A;  4MMH A;  1JZ7 A;  3TY1 A;  1NSR A;  4OK4 A;  3BS6 A;  1JZ2 A;  1YQ2 A;  3MV0 1;  2WVX B;  4BZG A;  1NSS A;  2E24 A;  1X1J A;  5E1Q A;  1HMU A;  3VDC A;  4AQ0 A;  1HN1 A;  3VD3 A;  1NS7 A;  3A0O A;  3WVF A;  4TTG A;  3T2Q A;  3NJV A;  1NSZ A;  1K1X A;  1TXK A;  4NEI A;  3I3D A;  1HN0 A;  3BLC A;  3OB8 A;  2FUQ A;  3A24 A;  3VSM A;  2WZS A;  2CIS A;  1JYW A;  3Q1N A;  2E22 A;  2JKA A;  3BGA A;  2Q1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...