1MMYA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-quinovose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmyA00
2ZXQA 1X1JA 1JYNA 1NS4A 1RWHA 1JZ8A 1OJMA 3CZJA 2JKPA 1K1XA 3ECQA 2BRVX 1LURA 1EGUA 1F1SA 1LXMA 3IMHA 2D73A 1PX4A 3VD5A 1NSMA 1OJOA 3DYMA 1LOHA 4DUXA 1RWAA 3OS7A 1RWGA 1HN0A 1RWFA 3MWXA 1SNZA 3T09A 4DUVA 2ZQ0A 2E24A 1MN0A 1F4AA 1L7KA 3VDBA 3DYOA 3VD4A 3I3EA 1NSRA 3VD3A 3VDAA 3A24A 1JZ2A 3VDCA 1OJNA 1YQ2A 1X1HA 3MUY1 1F9GA 4RNLA 1N7QA 3NJXA 5E1QA 3T0AA 1HN1A 1JZ4A 1I8QA 4AQ0A 4DUWA 1NSZA 4BZHA 1NSVA 1LF6A 3SEPA 1HMUA 1YGAA 3BGAA 1MMYA 2WVYA 1N7RA 2WW0A 2CIRA 3VD9A 3WFAA 1MMZA 2JKAA 4BZEA 1L7JA 1RWCA 1ULVA 1NKGA 4TTGA 1MMUA 3K25A 1CB8A 1RW9A 1NS7A 3T2OA 2WDAA 2CISA 1C82A 5A1AA 3I3DA 2HTBA 3T08A 1J0MA 3NREA 2X03A 3NJVA 1N7PA 1TXKA 2E22A 3T2PA 1JZ6A 1NS2A 1N7NA 1F4HA 1NSUA 1PX3A 1W3YA 1K1YA 1JZ3A 2BRPA 1HMWA 1J0NA 3OB8A 1NS0A 2WVXB 2WCOA 3J7HA 1HM2A 1NSSA 2BRWA 2WVZA 3I3BA 1JZ5A 3IAPA 3OBAA 2CIQA 2WVXA 2WW3A 2WZSA 3MUZ1 1UG9A 1LXKA 2WW1A 4BZFA 2XSGA 1K1WA 1MMXA 1JYXA 3DECA 1JZ7A 2XHNA 2JKEA 1SO0A 1N7OA 3Q1NA 1JYVA 1X1IA 3T0DA 3T0BA 1Z45A 3MV11 3T2QA 1OJPA 3E1F1 1DP0A 3MV01 3DCDA 1JOVA 2HTAA 3IAQA 3DYPA 1HM3A 2Q1FA 2WW2A 1NS8A 1LF9A 1NSXA 3VD7A 4BZGA 1JYWA
chains in the Genus database with same CATH superfamily
1X1JA 3W7UA 1OJMA 1EGUA 1LXMA 2E2TA 1D6UA 1PU4A 1NSMA 2OW6A 2CFKA 1SNZA 1LVNA 3AFLA 2ZQ0A 1W6CA 1A2VA 2XN0A 3DYOA 3I3EA 3VDAA 1TQVA 3VDCA 1YQ2A 3MUY1 1N7QA 3DX0A 1HWWA 4OJZA 2F7PA 1JZ4A 1HXKA 4AQ0A 4KFEA 1NSZA 1IQYA 2CQSA 3CZNA 3RSYA 3DX2A 3QDEA 3DX1A 3SX1A 2WW0A 2CIRA 3W7XA 3WA2X 2E2UA 1L7JA 1H54A 3D52A 1NKGA 4KTRA 3D50A 1IVXA 4FNSA 5A1AA 1C82A 3I3DA 1J0MA 1N7NA 1NSUA 1PX3A 5GW7A 1K1YA 1RJOA 2CG1A 4J5TA 1AV4A 1HM2A 2BRWA 3OBAA 3D51A 2YX9A 1K1WA 2FYVA 3X3XA 1UI8A 1V7WA 1QX1A 3BVUA 2FUQA 3T0BA 3WA3A 3T2QA 1OJPA 2ALWA 2CWTA 2EADA 3DCDA 3VSMA 1IVWA 3TY1A 3CZSA 3QFYA 4BZGA 1JYWA 1NS4A 3NBBA 2CFLA 3CZJA 3ACTA 3ECQA 2BRVX 1LURA 1IU7A 3VSNA 1F1SA 1KSIA 1EKMA 2D73A 1IVVA 2EACA 5JMDA 4FNTA 1OJOA 2F7OA 2F7QA 1N9EA 3ACSA 3OS7A 3ALAA 3WVFA 4DUVA 2E24A 3EJUA 3VDBA 3VD4A 3BLCA 3VD3A 3BS6A 3DX3A 1WMNA 1F9GA 5E1QA 3T0AA 3BUIA 2CWUA 3KN4A 3EJTA 4BZHA 2W0QA 1SIIA 3S4CA 3BUDA 3N9HA 1N7RA 3BVWA 3WFAA 2JKAA 1OACA 3BVVA 3W7TA 3D3IA 2OQEA 3DDFA 3K25A 1CB8A 1NS7A 3BLBA 3BUPA 2XN2A 3NREA 1N7PA 2E22A 4FNUA 1JZ6A 3QG0A 3AMOB 1NS0A 4FNRA 3X40A 2WCOA 1W4NA 4FNQA 1WMPA 1V7XA 1QWUA 3IAPA 4KFDA 2CIQA 2WVXA 2WW3A 4KTPA 3MUZ1 1LXKA 2WW1A 1QALA 3DDGA 1JYXA 1TQWA 3DECA 5CA3A 5KBPA 1N7OA 2CWVA 3BVTA 1JYVA 1HTYA 1W7CA 1D6ZA 3E1F1 4FNVA 4BTXA 3MI6A 1HM3A 2WW2A 1NS8A 4EV2A 3VD7A 1JYNA 2ZXQA 1RWHA 1JZ8A 2CFWA 1K1XA 2JKPA 2OOVC 3W7WA 1RKYA 3KIIA 1PX4A 3VD5A 1W5ZA 2CQTA 3DYMA 4DUXA 1RWGA 3A0OA 3MWXA 3T09A 3D4YA 2YFOA 1TQSA 1IVUA 3NBJA 2C11A 1NSRA 3A24A 4RNLA 3NJXA 1WMOA 1HN1A 2OOVA 4DUWA 2CFGA 4NEIA 1NSVA 1LF6A 4K35A 2ZL8A 2F7RA 3BGAA 2WVYA 1TQTA 4UFCA 1MMZA 1R34A 4BZEA 1RWCA 1ULVA 4K3AA 4TTGA 1TU5A 1MMUA 2OQEC 3E7JA 3T2OA 2XN1A 2CISA 1JRQA 1NS2A 1F4HA 2WYHA 3EJSA 4FNPA 3BUQA 3OB8A 4BTWA 2RDYA 2WYIA 2WO0A 2EAEA 3S4DA 2D1WA 1DYUA 3I3BA 1IQXA 1UG9A 1V7VA 3PGBA 1MMXA 3MPHA 1R33A 1JZ7A 1AVLA 1SPUA 2XHNA 2WOHA 3HI7A 3X41A 1X1IA 3K5TA 1SIHA 1TQUA 2F1BA 2Y74A 1QWNA 2Q1FA 2C10A 1O7DD 4MMHA 4KFFA 1W2ZA 3IMHA 3LVTA 3EJQA 1LOHA 1RWAA 1HN0A 1RWFA 3BUBA 3E80A 1MN0A 2OW7A 1F4AA 1L7KA 3WIQA 3SXXA 1JZ2A 3QFZA 1OJNA 3RRSA 3X42A 1X1HA 2CG0A 4EV5A 1I8QA 3EJRA 1QAKA 4OK4A 3X3YA 1AVKA 3SEPA 1HMUA 1D6YA 4OK2A 1YGAA 4MMIA 1MMYA 2BT3A 3VD9A 2F18A 3T0UA 3DX4A 1QAFA 2EABA 1RW9A 2WDAA 3D4ZA 3BVXA 2HTBA 3T08A 2X03A 3S4AA 3NJVA 1TXKA 3T2PA 1W3YA 1JZ3A 2WGQA 2BRPA 1HMWA 1J0NA 2Y73A 3S4BA 2YFNA 3AFJA 2WVXB 2PNCA 2WOFA 3J7HA 1UI7A 3AMOA 1NSSA 3X3ZA 2WVZA 1JZ5A 2WZSA 1US1A 4BZFA 1PS3A 2E2VA 2FUTA 2XSGA 3LOYA 3W7SA 3WIRA 2JKEA 1SO0A 4BTYA 3Q1NA 5JMFA 3T0DA 3HIGA 3EJPA 2CFDA 1Z45A 3MV11 3CV5A 1DP0A 3MV01 1JOVA 2HTAA 3IAQA 3DYPA 1LF9A 1NSXA 1W6GA 3HIIA 2F1AA
chains in the Genus database with same CATH topology
4MMHA 2ZXQA 1X1JA 1JYNA 1NS4A 1RWHA 1JZ8A 1OJMA 3CZJA 2JKPA 1K1XA 3ECQA 2BRVX 1LURA 1EGUA 3VSNA 1F1SA 1LXMA 3IMHA 2D73A 1PX4A 3VD5A 5JMDA 1NSMA 1OJOA 3DYMA 1LOHA 4DUXA 1RWAA 3OS7A 1RWGA 1HN0A 1RWFA 3A0OA 3MWXA 1SNZA 3T09A 3WVFA 4DUVA 3AFLA 2ZQ0A 2E24A 3E80A 1MN0A 1F4AA 1L7KA 3VDBA 3DYOA 3VD4A 3BLCA 3I3EA 1NSRA 3VD3A 3BS6A 3VDAA 3A24A 1JZ2A 3VDCA 1OJNA 1YQ2A 1X1HA 3MUY1 1F9GA 4RNLA 1N7QA 3NJXA 5E1QA 3T0AA 4OJZA 1HN1A 1JZ4A 1I8QA 4AQ0A 4OK4A 4DUWA 1NSZA 4NEIA 4BZHA 1NSVA 1LF6A 3SEPA 1HMUA 4OK2A 1YGAA 3BGAA 4MMIA 1MMYA 2WVYA 1N7RA 2WW0A 2CIRA 3VD9A 3WFAA 1MMZA 2JKAA 4BZEA 1L7JA 1RWCA 1ULVA 1NKGA 4TTGA 1MMUA 3K25A 1CB8A 3E7JA 1RW9A 1NS7A 3T2OA 2WDAA 2CISA 1C82A 5A1AA 3I3DA 2HTBA 3T08A 1J0MA 3NREA 2X03A 3NJVA 1N7PA 1TXKA 2E22A 3T2PA 1JZ6A 1NS2A 1N7NA 1F4HA 1NSUA 1PX3A 1W3YA 1K1YA 1JZ3A 2BRPA 1HMWA 1J0NA 3OB8A 4J5TA 1NS0A 2WVXB 2WCOA 3J7HA 1HM2A 1NSSA 2BRWA 2WVZA 3I3BA 1JZ5A 3IAPA 3OBAA 2CIQA 2WVXA 2WW3A 2WZSA 3MUZ1 1UG9A 1LXKA 2WW1A 4BZFA 2FUTA 1K1WA 2XSGA 1MMXA 1JYXA 3DECA 1JZ7A 2XHNA 2JKEA 1SO0A 1N7OA 3Q1NA 5JMFA 1JYVA 1X1IA 3T0DA 3T0BA 2FUQA 1Z45A 3MV11 3T2QA 1OJPA 3E1F1 4FNVA 1DP0A 3MV01 3DCDA 1JOVA 3VSMA 2HTAA 3IAQA 3DYPA 3TY1A 1HM3A 2Q1FA 2WW2A 1NS8A 1LF9A 1NSXA 3VD7A 4BZGA 1JYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXQ A;  1X1J A;  1JYN A;  1NS4 A;  1RWH A;  1JZ8 A;  1OJM A;  3CZJ A;  2JKP A;  1K1X A;  3ECQ A;  2BRV X;  1LUR A;  1EGU A;  1F1S A;  1LXM A;  3IMH A;  2D73 A;  1PX4 A;  3VD5 A;  1NSM A;  1OJO A;  3DYM A;  1LOH A;  4DUX A;  1RWA A;  3OS7 A;  1RWG A;  1HN0 A;  1RWF A;  3MWX A;  1SNZ A;  3T09 A;  4DUV A;  2ZQ0 A;  2E24 A;  1MN0 A;  1F4A A;  1L7K A;  3VDB A;  3DYO A;  3VD4 A;  3I3E A;  1NSR A;  3VD3 A;  3VDA A;  3A24 A;  1JZ2 A;  3VDC A;  1OJN A;  1YQ2 A;  1X1H A;  3MUY 1;  1F9G A;  4RNL A;  1N7Q A;  3NJX A;  5E1Q A;  3T0A A;  1HN1 A;  1JZ4 A;  1I8Q A;  4AQ0 A;  4DUW A;  1NSZ A;  4BZH A;  1NSV A;  1LF6 A;  3SEP A;  1HMU A;  1YGA A;  3BGA A;  1MMY A;  2WVY A;  1N7R A;  2WW0 A;  2CIR A;  3VD9 A;  3WFA A;  1MMZ A;  2JKA A;  4BZE A;  1L7J A;  1RWC A;  1ULV A;  1NKG A;  4TTG A;  1MMU A;  3K25 A;  1CB8 A;  1RW9 A;  1NS7 A;  3T2O A;  2WDA A;  2CIS A;  1C82 A;  5A1A A;  3I3D A;  2HTB A;  3T08 A;  1J0M A;  3NRE A;  2X03 A;  3NJV A;  1N7P A;  1TXK A;  2E22 A;  3T2P A;  1JZ6 A;  1NS2 A;  1N7N A;  1F4H A;  1NSU A;  1PX3 A;  1W3Y A;  1K1Y A;  1JZ3 A;  2BRP A;  1HMW A;  1J0N A;  3OB8 A;  1NS0 A;  2WVX B;  2WCO A;  3J7H A;  1HM2 A;  1NSS A;  2BRW A;  2WVZ A;  3I3B A;  1JZ5 A;  3IAP A;  3OBA A;  2CIQ A;  2WVX A;  2WW3 A;  2WZS A;  3MUZ 1;  1UG9 A;  1LXK A;  2WW1 A;  4BZF A;  2XSG A;  1K1W A;  1MMX A;  1JYX A;  3DEC A;  1JZ7 A;  2XHN A;  2JKE A;  1SO0 A;  1N7O A;  3Q1N A;  1JYV A;  1X1I A;  3T0D A;  3T0B A;  1Z45 A;  3MV1 1;  3T2Q A;  1OJP A;  3E1F 1;  1DP0 A;  3MV0 1;  3DCD A;  1JOV A;  2HTA A;  3IAQ A;  3DYP A;  1HM3 A;  2Q1F A;  2WW2 A;  1NS8 A;  1LF9 A;  1NSX A;  3VD7 A;  4BZG A;  1JYW A; 
#chains in the Genus database with same CATH topology
 1X1J A;  3W7U A;  1OJM A;  1EGU A;  1LXM A;  2E2T A;  1D6U A;  1PU4 A;  1NSM A;  2OW6 A;  2CFK A;  1SNZ A;  1LVN A;  3AFL A;  2ZQ0 A;  1W6C A;  1A2V A;  2XN0 A;  3DYO A;  3I3E A;  3VDA A;  1TQV A;  3VDC A;  1YQ2 A;  3MUY 1;  1N7Q A;  3DX0 A;  1HWW A;  4OJZ A;  2F7P A;  1JZ4 A;  1HXK A;  4AQ0 A;  4KFE A;  1NSZ A;  1IQY A;  2CQS A;  3CZN A;  3RSY A;  3DX2 A;  3QDE A;  3DX1 A;  3SX1 A;  2WW0 A;  2CIR A;  3W7X A;  3WA2 X;  2E2U A;  1L7J A;  1H54 A;  3D52 A;  1NKG A;  4KTR A;  3D50 A;  1IVX A;  4FNS A;  5A1A A;  1C82 A;  3I3D A;  1J0M A;  1N7N A;  1NSU A;  1PX3 A;  5GW7 A;  1K1Y A;  1RJO A;  2CG1 A;  4J5T A;  1AV4 A;  1HM2 A;  2BRW A;  3OBA A;  3D51 A;  2YX9 A;  1K1W A;  2FYV A;  3X3X A;  1UI8 A;  1V7W A;  1QX1 A;  3BVU A;  2FUQ A;  3T0B A;  3WA3 A;  3T2Q A;  1OJP A;  2ALW A;  2CWT A;  2EAD A;  3DCD A;  3VSM A;  1IVW A;  3TY1 A;  3CZS A;  3QFY A;  4BZG A;  1JYW A;  1NS4 A;  3NBB A;  2CFL A;  3CZJ A;  3ACT A;  3ECQ A;  2BRV X;  1LUR A;  1IU7 A;  3VSN A;  1F1S A;  1KSI A;  1EKM A;  2D73 A;  1IVV A;  2EAC A;  5JMD A;  4FNT A;  1OJO A;  2F7O A;  2F7Q A;  1N9E A;  3ACS A;  3OS7 A;  3ALA A;  3WVF A;  4DUV A;  2E24 A;  3EJU A;  3VDB A;  3VD4 A;  3BLC A;  3VD3 A;  3BS6 A;  3DX3 A;  1WMN A;  1F9G A;  5E1Q A;  3T0A A;  3BUI A;  2CWU A;  3KN4 A;  3EJT A;  4BZH A;  2W0Q A;  1SII A;  3S4C A;  3BUD A;  3N9H A;  1N7R A;  3BVW A;  3WFA A;  2JKA A;  1OAC A;  3BVV A;  3W7T A;  3D3I A;  2OQE A;  3DDF A;  3K25 A;  1CB8 A;  1NS7 A;  3BLB A;  3BUP A;  2XN2 A;  3NRE A;  1N7P A;  2E22 A;  4FNU A;  1JZ6 A;  3QG0 A;  3AMO B;  1NS0 A;  4FNR A;  3X40 A;  2WCO A;  1W4N A;  4FNQ A;  1WMP A;  1V7X A;  1QWU A;  3IAP A;  4KFD A;  2CIQ A;  2WVX A;  2WW3 A;  4KTP A;  3MUZ 1;  1LXK A;  2WW1 A;  1QAL A;  3DDG A;  1JYX A;  1TQW A;  3DEC A;  5CA3 A;  5KBP A;  1N7O A;  2CWV A;  3BVT A;  1JYV A;  1HTY A;  1W7C A;  1D6Z A;  3E1F 1;  4FNV A;  4BTX A;  3MI6 A;  1HM3 A;  2WW2 A;  1NS8 A;  4EV2 A;  3VD7 A;  1JYN A;  2ZXQ A;  1RWH A;  1JZ8 A;  2CFW A;  1K1X A;  2JKP A;  2OOV C;  3W7W A;  1RKY A;  3KII A;  1PX4 A;  3VD5 A;  1W5Z A;  2CQT A;  3DYM A;  4DUX A;  1RWG A;  3A0O A;  3MWX A;  3T09 A;  3D4Y A;  2YFO A;  1TQS A;  1IVU A;  3NBJ A;  2C11 A;  1NSR A;  3A24 A;  4RNL A;  3NJX A;  1WMO A;  1HN1 A;  2OOV A;  4DUW A;  2CFG A;  4NEI A;  1NSV A;  1LF6 A;  4K35 A;  2ZL8 A;  2F7R A;  3BGA A;  2WVY A;  1TQT A;  4UFC A;  1MMZ A;  1R34 A;  4BZE A;  1RWC A;  1ULV A;  4K3A A;  4TTG A;  1TU5 A;  1MMU A;  2OQE C;  3E7J A;  3T2O A;  2XN1 A;  2CIS A;  1JRQ A;  1NS2 A;  1F4H A;  2WYH A;  3EJS A;  4FNP A;  3BUQ A;  3OB8 A;  4BTW A;  2RDY A;  2WYI A;  2WO0 A;  2EAE A;  3S4D A;  2D1W A;  1DYU A;  3I3B A;  1IQX A;  1UG9 A;  1V7V A;  3PGB A;  1MMX A;  3MPH A;  1R33 A;  1JZ7 A;  1AVL A;  1SPU A;  2XHN A;  2WOH A;  3HI7 A;  3X41 A;  1X1I A;  3K5T A;  1SIH A;  1TQU A;  2F1B A;  2Y74 A;  1QWN A;  2Q1F A;  2C10 A;  1O7D D;  4MMH A;  4KFF A;  1W2Z A;  3IMH A;  3LVT A;  3EJQ A;  1LOH A;  1RWA A;  1HN0 A;  1RWF A;  3BUB A;  3E80 A;  1MN0 A;  2OW7 A;  1F4A A;  1L7K A;  3WIQ A;  3SXX A;  1JZ2 A;  3QFZ A;  1OJN A;  3RRS A;  3X42 A;  1X1H A;  2CG0 A;  4EV5 A;  1I8Q A;  3EJR A;  1QAK A;  4OK4 A;  3X3Y A;  1AVK A;  3SEP A;  1HMU A;  1D6Y A;  4OK2 A;  1YGA A;  4MMI A;  1MMY A;  2BT3 A;  3VD9 A;  2F18 A;  3T0U A;  3DX4 A;  1QAF A;  2EAB A;  1RW9 A;  2WDA A;  3D4Z A;  3BVX A;  2HTB A;  3T08 A;  2X03 A;  3S4A A;  3NJV A;  1TXK A;  3T2P A;  1W3Y A;  1JZ3 A;  2WGQ A;  2BRP A;  1HMW A;  1J0N A;  2Y73 A;  3S4B A;  2YFN A;  3AFJ A;  2WVX B;  2PNC A;  2WOF A;  3J7H A;  1UI7 A;  3AMO A;  1NSS A;  3X3Z A;  2WVZ A;  1JZ5 A;  2WZS A;  1US1 A;  4BZF A;  1PS3 A;  2E2V A;  2FUT A;  2XSG A;  3LOY A;  3W7S A;  3WIR A;  2JKE A;  1SO0 A;  4BTY A;  3Q1N A;  5JMF A;  3T0D A;  3HIG A;  3EJP A;  2CFD A;  1Z45 A;  3MV1 1;  3CV5 A;  1DP0 A;  3MV0 1;  1JOV A;  2HTA A;  3IAQ A;  3DYP A;  1LF9 A;  1NSX A;  1W6G A;  3HII A;  2F1A A; 
#chains in the Genus database with same CATH homology
 4MMH A;  2ZXQ A;  1X1J A;  1JYN A;  1NS4 A;  1RWH A;  1JZ8 A;  1OJM A;  3CZJ A;  2JKP A;  1K1X A;  3ECQ A;  2BRV X;  1LUR A;  1EGU A;  3VSN A;  1F1S A;  1LXM A;  3IMH A;  2D73 A;  1PX4 A;  3VD5 A;  5JMD A;  1NSM A;  1OJO A;  3DYM A;  1LOH A;  4DUX A;  1RWA A;  3OS7 A;  1RWG A;  1HN0 A;  1RWF A;  3A0O A;  3MWX A;  1SNZ A;  3T09 A;  3WVF A;  4DUV A;  3AFL A;  2ZQ0 A;  2E24 A;  3E80 A;  1MN0 A;  1F4A A;  1L7K A;  3VDB A;  3DYO A;  3VD4 A;  3BLC A;  3I3E A;  1NSR A;  3VD3 A;  3BS6 A;  3VDA A;  3A24 A;  1JZ2 A;  3VDC A;  1OJN A;  1YQ2 A;  1X1H A;  3MUY 1;  1F9G A;  4RNL A;  1N7Q A;  3NJX A;  5E1Q A;  3T0A A;  4OJZ A;  1HN1 A;  1JZ4 A;  1I8Q A;  4AQ0 A;  4OK4 A;  4DUW A;  1NSZ A;  4NEI A;  4BZH A;  1NSV A;  1LF6 A;  3SEP A;  1HMU A;  4OK2 A;  1YGA A;  3BGA A;  4MMI A;  1MMY A;  2WVY A;  1N7R A;  2WW0 A;  2CIR A;  3VD9 A;  3WFA A;  1MMZ A;  2JKA A;  4BZE A;  1L7J A;  1RWC A;  1ULV A;  1NKG A;  4TTG A;  1MMU A;  3K25 A;  1CB8 A;  3E7J A;  1RW9 A;  1NS7 A;  3T2O A;  2WDA A;  2CIS A;  1C82 A;  5A1A A;  3I3D A;  2HTB A;  3T08 A;  1J0M A;  3NRE A;  2X03 A;  3NJV A;  1N7P A;  1TXK A;  2E22 A;  3T2P A;  1JZ6 A;  1NS2 A;  1N7N A;  1F4H A;  1NSU A;  1PX3 A;  1W3Y A;  1K1Y A;  1JZ3 A;  2BRP A;  1HMW A;  1J0N A;  3OB8 A;  4J5T A;  1NS0 A;  2WVX B;  2WCO A;  3J7H A;  1HM2 A;  1NSS A;  2BRW A;  2WVZ A;  3I3B A;  1JZ5 A;  3IAP A;  3OBA A;  2CIQ A;  2WVX A;  2WW3 A;  2WZS A;  3MUZ 1;  1UG9 A;  1LXK A;  2WW1 A;  4BZF A;  2FUT A;  1K1W A;  2XSG A;  1MMX A;  1JYX A;  3DEC A;  1JZ7 A;  2XHN A;  2JKE A;  1SO0 A;  1N7O A;  3Q1N A;  5JMF A;  1JYV A;  1X1I A;  3T0D A;  3T0B A;  2FUQ A;  1Z45 A;  3MV1 1;  3T2Q A;  1OJP A;  3E1F 1;  4FNV A;  1DP0 A;  3MV0 1;  3DCD A;  1JOV A;  3VSM A;  2HTA A;  3IAQ A;  3DYP A;  3TY1 A;  1HM3 A;  2Q1F A;  2WW2 A;  1NS8 A;  1LF9 A;  1NSX A;  3VD7 A;  4BZG A;  1JYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...