1MMYA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-quinovose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmyA00
1RWCA 3I3EA 2ZQ0A 2X03A 3WFAA 1TXKA 2E22A 3DYMA 2WW3A 2Q1FA 2HTBA 1PX3A 1RWGA 2E24A 3VDCA 1JZ6A 3A24A 3T2PA 1NS2A 1JZ2A 3VD4A 1EGUA 1YGAA 3MV01 1N7QA 1N7NA 1JZ5A 1UG9A 1X1HA 4BZGA 2BRPA 1SNZA 3T0AA 1JZ3A 1JZ7A 5A1AA 2JKAA 1F4HA 1MMXA 1LF6A 3DYPA 1JZ4A 1W3YA 1N7RA 1NSXA 3IAQA 3OB8A 3T09A 1L7JA 4DUVA 2BRWA 3VD7A 1J0NA 3OS7A 1HM3A 1RW9A 2WVYA 1NSMA 1JYWA 1HN0A 4BZEA 1K1YA 1L7KA 1LURA 3E1F1 1NKGA 1NS0A 1F9GA 1DP0A 1K1WA 1OJOA 3NJVA 4BZHA 3MUY1 1I8QA 1HM2A 1LXKA 1N7PA 1N7OA 1X1IA 1JOVA 1X1JA 2ZXQA 1JYXA 3DECA 1NSZA 3IMHA 1PX4A 1C82A 1F4AA 3I3DA 1NSVA 2JKEA 3VD5A 2WW0A 1MMUA 1JYNA 1Z45A 1JZ8A 2WW1A 3T0BA 2XHNA 1YQ2A 3DCDA 1NSSA 3T08A 3T2OA 2CIQA 2WVXA 2BRVX 1NSRA 4DUXA 3VD9A 3T2QA 3Q1NA 1LOHA 1NS4A 2CIRA 1LXMA 1NS8A 3BGAA 3MUZ1 4TTGA 1NSUA 1CB8A 2WZSA 3J7HA 3VD3A 3OBAA 1MMYA 1SO0A 1HMWA 2WVXB 3ECQA 1RWAA 2JKPA 3NREA 2HTAA 3VDAA 2XSGA 1ULVA 2WCOA 1HMUA 1OJPA 1NS7A 2D73A 4AQ0A 1RWFA 4RNLA 1RWHA 3MWXA 3SEPA 3MV11 2WVZA 1K1XA 2WDAA 1LF9A 3I3BA 3VDBA 4BZFA 1J0MA 1F1SA 3K25A 1JYVA 3IAPA 3CZJA 1OJMA 3NJXA 2WW2A 2CISA 1HN1A 1OJNA 5E1QA 1MN0A 1MMZA 3T0DA 3DYOA 4DUWA
chains in the Genus database with same CATH superfamily
1WMOA 2ZQ0A 3WFAA 1W4NA 1TXKA 2E22A 1HTYA 2CFDA 2E24A 1EGUA 1N7QA 1JZ5A 1UG9A 1SNZA 3T0AA 3QG0A 3W7XA 3MPHA 1IQYA 3WIRA 4KFFA 2F7QA 5GW7A 1N7RA 1R34A 1NSXA 3IAQA 1KSIA 4FNUA 3X3XA 2WVYA 1HN0A 4BZEA 1LURA 3E1F1 3A0OA 4UFCA 1K1WA 3ACTA 3DX0A 1I8QA 2E2UA 1TQVA 3KIIA 2EABA 1JYXA 3QDEA 4MMIA 1PX4A 3S4CA 3VD5A 3CZSA 1MMUA 1DYUA 3T0BA 1YQ2A 3T0UA 1NSSA 3T08A 3T2OA 3D3IA 1LOHA 3BGAA 1QWUA 3BUPA 1NSUA 3QFZA 3VD3A 1SO0A 4FNQA 1EKMA 1AVKA 3ALAA 3NREA 3VDAA 2XSGA 1ULVA 1N9EA 1HMUA 1NS7A 1RWFA 4K35A 2BT3A 2C11A 1JYVA 3CZJA 1OJMA 3NJXA 2WW2A 2CISA 1SPUA 1HN1A 1OJNA 4FNTA 4OJZA 4NEIA 1QAFA 2YX9A 2RDYA 2WOHA 1AV4A 2CWVA 3S4BA 2HTBA 1PX3A 3T2PA 1NS2A 5JMFA 3VD4A 1YGAA 3MV01 3EJSA 2Y73A 3AFLA 5CA3A 1JZ3A 1JZ7A 5A1AA 3WVFA 1F4HA 1IQXA 1MMXA 3RSYA 1LF6A 3DYPA 1JZ4A 2CWUA 3OB8A 3T09A 2CG1A 3S4DA 3OS7A 3AFJA 2F7OA 1K1YA 3EJQA 2OW7A 1L7KA 1V7WA 3EJUA 3DX4A 1F9GA 2FYVA 1UI7A 2WOFA 1LXKA 4OK4A 1X1JA 3DECA 1AVLA 4K3AA 1C82A 3I3DA 1NSVA 1W7CA 1Z45A 2WW1A 1HXKA 2XHNA 1W2ZA 2Y74A 2CWTA 3N9HA 2BRVX 2FUTA 1NS4A 3NBBA 4TTGA 3MUZ1 3CZNA 3WA2X 3BS6A 3X40A 1LVNA 3D4ZA 1QWNA 3HI7A 3ECQA 1IU7A 1R33A 2WCOA 2D73A 4AQ0A 2CG0A 1RWHA 3MWXA 3BVXA 1SIHA 3WA3A 1US1A 3VDBA 4BZFA 1W5ZA 2WO0A 2OOVA 5E1QA 2ALWA 2EAEA 2OOVC 1MMZA 3LOYA 4DUWA 5KBPA 2CFGA 2E2TA 3I3EA 4MMHA 3QFYA 2X03A 1A2VA 3DYMA 3LVTA 2WW3A 2Q1FA 1RWGA 1QAKA 3VDCA 1JZ6A 3NBJA 4BZGA 3AMOA 3BVTA 2CFLA 3DX2A 1IVVA 2JKAA 1QX1A 3E7JA 2OQEA 1PS3A 2OQEC 1TQWA 1PU4A 2D1WA 1L7JA 4DUVA 1H54A 2BRWA 3VD7A 1J0NA 2CQTA 1HM3A 1W6GA 1NSMA 1D6YA 1V7VA 2W0QA 1NKGA 2XN2A 3W7SA 3DDGA 1DP0A 1OJOA 3NJVA 4KTRA 1HM2A 4FNSA 1JOVA 2ZXQA 4FNPA 2XN1A 3IMHA 2PNCA 3D51A 1F4AA 2JKEA 2F7RA 2WYHA 3EJPA 3BLCA 2XN0A 2WW0A 3D4YA 1D6ZA 1JYNA 1JZ8A 3BVWA 4J5TA 2FUQA 3D52A 1W6CA 1TU5A 3VD9A 3T2QA 3Q1NA 1CB8A 1OACA 3CV5A 2WZSA 3J7HA 3OBAA 3PGBA 2CFWA 2ZL8A 2JKPA 3BVVA 4EV5A 1RKYA 3SEPA 2WYIA 2WVZA 1K1XA 2WDAA 1LF9A 3I3BA 4BTWA 1WMNA 3K5TA 1F1SA 1TQSA 2CQSA 1D6UA 1RJOA 3IAPA 1JRQA 3EJRA 4FNRA 1RWCA 3TY1A 3D50A 5JMDA 1TQUA 3HIGA 3BUBA 3A24A 3DDFA 1JZ2A 3EJTA 3MI6A 1N7NA 3ACSA 1X1HA 2BRPA 1WMPA 1HWWA 3VSNA 1W3YA 4KTPA 1SIIA 2EACA 1RW9A 2F1BA 3DX1A 1JYWA 3W7UA 2F7PA 3X3ZA 1V7XA 3DX3A 1NS0A 2WGQA 3S4AA 4BZHA 3MUY1 4EV2A 2YFNA 1N7PA 1N7OA 1X1IA 3SX1A 1NSZA 1O7DD 4OK2A 3SXXA 4BTYA 3RRSA 1UI8A 3W7TA 3AMOB 2F18A 1IVUA 3X41A 3DCDA 1IVWA 2E2VA 2CIQA 3BLBA 2WVXA 3X3YA 1NSRA 2YFOA 4DUXA 3HIIA 2CIRA 2F1AA 4KFDA 1LXMA 1NS8A 3BUDA 1MMYA 2WVXB 1HMWA 2C10A 1QALA 1RWAA 2HTAA 1TQTA 4FNVA 3WIQA 3W7WA 3E80A 1OJPA 3VSMA 4KFEA 4RNLA 2OW6A 3MV11 4BTXA 1J0MA 2CFKA 3BUQA 3BUIA 3K25A 1IVXA 3X42A 2EADA 1MN0A 3BVUA 3KN4A 3T0DA 3DYOA
chains in the Genus database with same CATH topology
1RWCA 3I3EA 2ZQ0A 4MMHA 3TY1A 2X03A 3WFAA 1TXKA 2E22A 3DYMA 5JMDA 2WW3A 2Q1FA 2HTBA 1PX3A 1RWGA 2E24A 3VDCA 1JZ6A 3A24A 3T2PA 1NS2A 5JMFA 1JZ2A 3VD4A 1EGUA 1YGAA 3MV01 1N7QA 1N7NA 1JZ5A 1UG9A 1X1HA 4BZGA 2BRPA 1SNZA 3AFLA 3T0AA 1JZ3A 1JZ7A 5A1AA 2JKAA 3WVFA 1F4HA 3E7JA 1MMXA 1LF6A 3DYPA 3VSNA 1JZ4A 1W3YA 1N7RA 1NSXA 3IAQA 3OB8A 3T09A 1L7JA 4DUVA 2BRWA 3VD7A 1J0NA 3OS7A 1HM3A 1RW9A 2WVYA 1NSMA 1JYWA 1HN0A 4BZEA 1K1YA 1L7KA 1LURA 3E1F1 1NKGA 3A0OA 1NS0A 1F9GA 1DP0A 1K1WA 1OJOA 3NJVA 4BZHA 3MUY1 1I8QA 1HM2A 1LXKA 1N7PA 4OK4A 1N7OA 1X1IA 1JOVA 1X1JA 2ZXQA 1JYXA 3DECA 4MMIA 1NSZA 3IMHA 1PX4A 1C82A 1F4AA 3I3DA 1NSVA 2JKEA 4OK2A 3VD5A 3BLCA 2WW0A 1MMUA 1JYNA 1Z45A 1JZ8A 2WW1A 3T0BA 2XHNA 1YQ2A 4J5TA 2FUQA 3DCDA 1NSSA 3T08A 3T2OA 2CIQA 2WVXA 2BRVX 1NSRA 4DUXA 3VD9A 2FUTA 3T2QA 3Q1NA 1LOHA 1NS4A 2CIRA 1LXMA 1NS8A 3BGAA 3MUZ1 4TTGA 1NSUA 1CB8A 3BS6A 2WZSA 3J7HA 3VD3A 3OBAA 1MMYA 1SO0A 1HMWA 2WVXB 3ECQA 1RWAA 2JKPA 3NREA 2HTAA 4FNVA 3VDAA 2XSGA 1ULVA 2WCOA 3E80A 1HMUA 1OJPA 1NS7A 2D73A 4AQ0A 3VSMA 1RWFA 4RNLA 1RWHA 3MWXA 3SEPA 3MV11 2WVZA 1K1XA 2WDAA 1LF9A 3I3BA 3VDBA 4BZFA 1J0MA 1F1SA 3K25A 1JYVA 3IAPA 3CZJA 1OJMA 3NJXA 2WW2A 2CISA 1HN1A 1OJNA 5E1QA 1MN0A 4OJZA 1MMZA 3T0DA 4NEIA 3DYOA 4DUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWC A;  3I3E A;  2ZQ0 A;  2X03 A;  3WFA A;  1TXK A;  2E22 A;  3DYM A;  2WW3 A;  2Q1F A;  2HTB A;  1PX3 A;  1RWG A;  2E24 A;  3VDC A;  1JZ6 A;  3A24 A;  3T2P A;  1NS2 A;  1JZ2 A;  3VD4 A;  1EGU A;  1YGA A;  3MV0 1;  1N7Q A;  1N7N A;  1JZ5 A;  1UG9 A;  1X1H A;  4BZG A;  2BRP A;  1SNZ A;  3T0A A;  1JZ3 A;  1JZ7 A;  5A1A A;  2JKA A;  1F4H A;  1MMX A;  1LF6 A;  3DYP A;  1JZ4 A;  1W3Y A;  1N7R A;  1NSX A;  3IAQ A;  3OB8 A;  3T09 A;  1L7J A;  4DUV A;  2BRW A;  3VD7 A;  1J0N A;  3OS7 A;  1HM3 A;  1RW9 A;  2WVY A;  1NSM A;  1JYW A;  1HN0 A;  4BZE A;  1K1Y A;  1L7K A;  1LUR A;  3E1F 1;  1NKG A;  1NS0 A;  1F9G A;  1DP0 A;  1K1W A;  1OJO A;  3NJV A;  4BZH A;  3MUY 1;  1I8Q A;  1HM2 A;  1LXK A;  1N7P A;  1N7O A;  1X1I A;  1JOV A;  1X1J A;  2ZXQ A;  1JYX A;  3DEC A;  1NSZ A;  3IMH A;  1PX4 A;  1C82 A;  1F4A A;  3I3D A;  1NSV A;  2JKE A;  3VD5 A;  2WW0 A;  1MMU A;  1JYN A;  1Z45 A;  1JZ8 A;  2WW1 A;  3T0B A;  2XHN A;  1YQ2 A;  3DCD A;  1NSS A;  3T08 A;  3T2O A;  2CIQ A;  2WVX A;  2BRV X;  1NSR A;  4DUX A;  3VD9 A;  3T2Q A;  3Q1N A;  1LOH A;  1NS4 A;  2CIR A;  1LXM A;  1NS8 A;  3BGA A;  3MUZ 1;  4TTG A;  1NSU A;  1CB8 A;  2WZS A;  3J7H A;  3VD3 A;  3OBA A;  1MMY A;  1SO0 A;  1HMW A;  2WVX B;  3ECQ A;  1RWA A;  2JKP A;  3NRE A;  2HTA A;  3VDA A;  2XSG A;  1ULV A;  2WCO A;  1HMU A;  1OJP A;  1NS7 A;  2D73 A;  4AQ0 A;  1RWF A;  4RNL A;  1RWH A;  3MWX A;  3SEP A;  3MV1 1;  2WVZ A;  1K1X A;  2WDA A;  1LF9 A;  3I3B A;  3VDB A;  4BZF A;  1J0M A;  1F1S A;  3K25 A;  1JYV A;  3IAP A;  3CZJ A;  1OJM A;  3NJX A;  2WW2 A;  2CIS A;  1HN1 A;  1OJN A;  5E1Q A;  1MN0 A;  1MMZ A;  3T0D A;  3DYO A;  4DUW A; 
#chains in the Genus database with same CATH topology
 1WMO A;  2ZQ0 A;  3WFA A;  1W4N A;  1TXK A;  2E22 A;  1HTY A;  2CFD A;  2E24 A;  1EGU A;  1N7Q A;  1JZ5 A;  1UG9 A;  1SNZ A;  3T0A A;  3QG0 A;  3W7X A;  3MPH A;  1IQY A;  3WIR A;  4KFF A;  2F7Q A;  5GW7 A;  1N7R A;  1R34 A;  1NSX A;  3IAQ A;  1KSI A;  4FNU A;  3X3X A;  2WVY A;  1HN0 A;  4BZE A;  1LUR A;  3E1F 1;  3A0O A;  4UFC A;  1K1W A;  3ACT A;  3DX0 A;  1I8Q A;  2E2U A;  1TQV A;  3KII A;  2EAB A;  1JYX A;  3QDE A;  4MMI A;  1PX4 A;  3S4C A;  3VD5 A;  3CZS A;  1MMU A;  1DYU A;  3T0B A;  1YQ2 A;  3T0U A;  1NSS A;  3T08 A;  3T2O A;  3D3I A;  1LOH A;  3BGA A;  1QWU A;  3BUP A;  1NSU A;  3QFZ A;  3VD3 A;  1SO0 A;  4FNQ A;  1EKM A;  1AVK A;  3ALA A;  3NRE A;  3VDA A;  2XSG A;  1ULV A;  1N9E A;  1HMU A;  1NS7 A;  1RWF A;  4K35 A;  2BT3 A;  2C11 A;  1JYV A;  3CZJ A;  1OJM A;  3NJX A;  2WW2 A;  2CIS A;  1SPU A;  1HN1 A;  1OJN A;  4FNT A;  4OJZ A;  4NEI A;  1QAF A;  2YX9 A;  2RDY A;  2WOH A;  1AV4 A;  2CWV A;  3S4B A;  2HTB A;  1PX3 A;  3T2P A;  1NS2 A;  5JMF A;  3VD4 A;  1YGA A;  3MV0 1;  3EJS A;  2Y73 A;  3AFL A;  5CA3 A;  1JZ3 A;  1JZ7 A;  5A1A A;  3WVF A;  1F4H A;  1IQX A;  1MMX A;  3RSY A;  1LF6 A;  3DYP A;  1JZ4 A;  2CWU A;  3OB8 A;  3T09 A;  2CG1 A;  3S4D A;  3OS7 A;  3AFJ A;  2F7O A;  1K1Y A;  3EJQ A;  2OW7 A;  1L7K A;  1V7W A;  3EJU A;  3DX4 A;  1F9G A;  2FYV A;  1UI7 A;  2WOF A;  1LXK A;  4OK4 A;  1X1J A;  3DEC A;  1AVL A;  4K3A A;  1C82 A;  3I3D A;  1NSV A;  1W7C A;  1Z45 A;  2WW1 A;  1HXK A;  2XHN A;  1W2Z A;  2Y74 A;  2CWT A;  3N9H A;  2BRV X;  2FUT A;  1NS4 A;  3NBB A;  4TTG A;  3MUZ 1;  3CZN A;  3WA2 X;  3BS6 A;  3X40 A;  1LVN A;  3D4Z A;  1QWN A;  3HI7 A;  3ECQ A;  1IU7 A;  1R33 A;  2WCO A;  2D73 A;  4AQ0 A;  2CG0 A;  1RWH A;  3MWX A;  3BVX A;  1SIH A;  3WA3 A;  1US1 A;  3VDB A;  4BZF A;  1W5Z A;  2WO0 A;  2OOV A;  5E1Q A;  2ALW A;  2EAE A;  2OOV C;  1MMZ A;  3LOY A;  4DUW A;  5KBP A;  2CFG A;  2E2T A;  3I3E A;  4MMH A;  3QFY A;  2X03 A;  1A2V A;  3DYM A;  3LVT A;  2WW3 A;  2Q1F A;  1RWG A;  1QAK A;  3VDC A;  1JZ6 A;  3NBJ A;  4BZG A;  3AMO A;  3BVT A;  2CFL A;  3DX2 A;  1IVV A;  2JKA A;  1QX1 A;  3E7J A;  2OQE A;  1PS3 A;  2OQE C;  1TQW A;  1PU4 A;  2D1W A;  1L7J A;  4DUV A;  1H54 A;  2BRW A;  3VD7 A;  1J0N A;  2CQT A;  1HM3 A;  1W6G A;  1NSM A;  1D6Y A;  1V7V A;  2W0Q A;  1NKG A;  2XN2 A;  3W7S A;  3DDG A;  1DP0 A;  1OJO A;  3NJV A;  4KTR A;  1HM2 A;  4FNS A;  1JOV A;  2ZXQ A;  4FNP A;  2XN1 A;  3IMH A;  2PNC A;  3D51 A;  1F4A A;  2JKE A;  2F7R A;  2WYH A;  3EJP A;  3BLC A;  2XN0 A;  2WW0 A;  3D4Y A;  1D6Z A;  1JYN A;  1JZ8 A;  3BVW A;  4J5T A;  2FUQ A;  3D52 A;  1W6C A;  1TU5 A;  3VD9 A;  3T2Q A;  3Q1N A;  1CB8 A;  1OAC A;  3CV5 A;  2WZS A;  3J7H A;  3OBA A;  3PGB A;  2CFW A;  2ZL8 A;  2JKP A;  3BVV A;  4EV5 A;  1RKY A;  3SEP A;  2WYI A;  2WVZ A;  1K1X A;  2WDA A;  1LF9 A;  3I3B A;  4BTW A;  1WMN A;  3K5T A;  1F1S A;  1TQS A;  2CQS A;  1D6U A;  1RJO A;  3IAP A;  1JRQ A;  3EJR A;  4FNR A;  1RWC A;  3TY1 A;  3D50 A;  5JMD A;  1TQU A;  3HIG A;  3BUB A;  3A24 A;  3DDF A;  1JZ2 A;  3EJT A;  3MI6 A;  1N7N A;  3ACS A;  1X1H A;  2BRP A;  1WMP A;  1HWW A;  3VSN A;  1W3Y A;  4KTP A;  1SII A;  2EAC A;  1RW9 A;  2F1B A;  3DX1 A;  1JYW A;  3W7U A;  2F7P A;  3X3Z A;  1V7X A;  3DX3 A;  1NS0 A;  2WGQ A;  3S4A A;  4BZH A;  3MUY 1;  4EV2 A;  2YFN A;  1N7P A;  1N7O A;  1X1I A;  3SX1 A;  1NSZ A;  1O7D D;  4OK2 A;  3SXX A;  4BTY A;  3RRS A;  1UI8 A;  3W7T A;  3AMO B;  2F18 A;  1IVU A;  3X41 A;  3DCD A;  1IVW A;  2E2V A;  2CIQ A;  3BLB A;  2WVX A;  3X3Y A;  1NSR A;  2YFO A;  4DUX A;  3HII A;  2CIR A;  2F1A A;  4KFD A;  1LXM A;  1NS8 A;  3BUD A;  1MMY A;  2WVX B;  1HMW A;  2C10 A;  1QAL A;  1RWA A;  2HTA A;  1TQT A;  4FNV A;  3WIQ A;  3W7W A;  3E80 A;  1OJP A;  3VSM A;  4KFE A;  4RNL A;  2OW6 A;  3MV1 1;  4BTX A;  1J0M A;  2CFK A;  3BUQ A;  3BUI A;  3K25 A;  1IVX A;  3X42 A;  2EAD A;  1MN0 A;  3BVU A;  3KN4 A;  3T0D A;  3DYO A; 
#chains in the Genus database with same CATH homology
 1RWC A;  3I3E A;  2ZQ0 A;  4MMH A;  3TY1 A;  2X03 A;  3WFA A;  1TXK A;  2E22 A;  3DYM A;  5JMD A;  2WW3 A;  2Q1F A;  2HTB A;  1PX3 A;  1RWG A;  2E24 A;  3VDC A;  1JZ6 A;  3A24 A;  3T2P A;  1NS2 A;  5JMF A;  1JZ2 A;  3VD4 A;  1EGU A;  1YGA A;  3MV0 1;  1N7Q A;  1N7N A;  1JZ5 A;  1UG9 A;  1X1H A;  4BZG A;  2BRP A;  1SNZ A;  3AFL A;  3T0A A;  1JZ3 A;  1JZ7 A;  5A1A A;  2JKA A;  3WVF A;  1F4H A;  3E7J A;  1MMX A;  1LF6 A;  3DYP A;  3VSN A;  1JZ4 A;  1W3Y A;  1N7R A;  1NSX A;  3IAQ A;  3OB8 A;  3T09 A;  1L7J A;  4DUV A;  2BRW A;  3VD7 A;  1J0N A;  3OS7 A;  1HM3 A;  1RW9 A;  2WVY A;  1NSM A;  1JYW A;  1HN0 A;  4BZE A;  1K1Y A;  1L7K A;  1LUR A;  3E1F 1;  1NKG A;  3A0O A;  1NS0 A;  1F9G A;  1DP0 A;  1K1W A;  1OJO A;  3NJV A;  4BZH A;  3MUY 1;  1I8Q A;  1HM2 A;  1LXK A;  1N7P A;  4OK4 A;  1N7O A;  1X1I A;  1JOV A;  1X1J A;  2ZXQ A;  1JYX A;  3DEC A;  4MMI A;  1NSZ A;  3IMH A;  1PX4 A;  1C82 A;  1F4A A;  3I3D A;  1NSV A;  2JKE A;  4OK2 A;  3VD5 A;  3BLC A;  2WW0 A;  1MMU A;  1JYN A;  1Z45 A;  1JZ8 A;  2WW1 A;  3T0B A;  2XHN A;  1YQ2 A;  4J5T A;  2FUQ A;  3DCD A;  1NSS A;  3T08 A;  3T2O A;  2CIQ A;  2WVX A;  2BRV X;  1NSR A;  4DUX A;  3VD9 A;  2FUT A;  3T2Q A;  3Q1N A;  1LOH A;  1NS4 A;  2CIR A;  1LXM A;  1NS8 A;  3BGA A;  3MUZ 1;  4TTG A;  1NSU A;  1CB8 A;  3BS6 A;  2WZS A;  3J7H A;  3VD3 A;  3OBA A;  1MMY A;  1SO0 A;  1HMW A;  2WVX B;  3ECQ A;  1RWA A;  2JKP A;  3NRE A;  2HTA A;  4FNV A;  3VDA A;  2XSG A;  1ULV A;  2WCO A;  3E80 A;  1HMU A;  1OJP A;  1NS7 A;  2D73 A;  4AQ0 A;  3VSM A;  1RWF A;  4RNL A;  1RWH A;  3MWX A;  3SEP A;  3MV1 1;  2WVZ A;  1K1X A;  2WDA A;  1LF9 A;  3I3B A;  3VDB A;  4BZF A;  1J0M A;  1F1S A;  3K25 A;  1JYV A;  3IAP A;  3CZJ A;  1OJM A;  3NJX A;  2WW2 A;  2CIS A;  1HN1 A;  1OJN A;  5E1Q A;  1MN0 A;  4OJZ A;  1MMZ A;  3T0D A;  4NEI A;  3DYO A;  4DUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...