2HTAA

Crystal structure of a putative mutarotase (yead) from salmonella typhimurium in orthorhombic form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
297
structure length
297
Chain Sequence
ASHMINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLWLSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFELQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGLGDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative enzyme related to aldose 1-epimerase
publication title Structure of the putative mutarotase YeaD from Salmonella typhimurium: structural comparison with galactose mutarotases.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 72
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 5.1.3.15: Glucose-6-phosphate 1-epimerase.
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 2htaA00
1J0MA 3MUY1 1SNZA 1F9GA 1JZ7A 1JYNA 3E1F1 1YGAA 1NS2A 2CIQA 1NS8A 1OJNA 1HMWA 1HM2A 3MUZ1 1LF6A 1UG9A 1K1XA 1F4HA 1RWFA 4DUVA 1X1IA 3OS7A 1W3YA 3WFAA 3I3DA 4AQ0A 3K25A 4BZEA 2WW0A 2HTBA 1RW9A 2E24A 3VD7A 1JZ5A 3DYPA 1HM3A 1RWHA 3T2QA 4BZGA 1N7NA 2X03A 3OBAA 1K1WA 1J0NA 3BGAA 2WVXB 1JYXA 3I3EA 2HTAA 2WW3A 2WVXA 2CIRA 3VD3A 1RWAA 4BZHA 3T08A 1NSMA 3Q1NA 2XSGA 2Q1FA 1DP0A 1PX4A 3DYOA 1NSUA 5A1AA 3VDAA 2WW1A 4RNLA 2JKEA 2ZQ0A 3A24A 1I8QA 1N7PA 3NREA 1OJOA 1MMYA 2BRVX 2JKPA 1MMZA 1X1JA 2WCOA 3T0AA 2WVYA 1NSZA 2D73A 3ECQA 1F1SA 4TTGA 4BZFA 1OJMA 3VD5A 1MMXA 2WZSA 3T2PA 1NS0A 3NJVA 1NSXA 3IMHA 1NSVA 1L7KA 3NJXA 1SO0A 4DUWA 1JZ8A 1NSSA 1L7JA 2WDAA 2CISA 2ZXQA 3J7HA 1C82A 1RWGA 1LOHA 2WVZA 3I3BA 2BRPA 2BRWA 3T0BA 1K1YA 1HN0A 1JZ2A 3CZJA 1CB8A 3T09A 3IAPA 5E1QA 4DUXA 2XHNA 3OB8A 1NS7A 1F4AA 1NKGA 2JKAA 3VDCA 1JOVA 1JZ6A 2E22A 1EGUA 1N7RA 1RWCA 2WW2A 1PX3A 1JYWA 1HN1A 3SEPA 1ULVA 3DYMA 1MN0A 1MMUA 3MV01 1LURA 1JZ4A 1NS4A 3T2OA 1JZ3A 1N7QA 1JYVA 1TXKA 1Z45A 1LF9A 1OJPA 3VD9A 1N7OA 3VD4A 1HMUA 3T0DA 3DECA 3MWXA 1X1HA 1LXMA 1YQ2A 1LXKA 3DCDA 1NSRA 3MV11 3IAQA 3VDBA
chains in the Genus database with same CATH superfamily
2OW6A 1OJNA 2OQEC 1HM2A 1UG9A 3HIIA 1X1IA 3BVUA 2YX9A 3I3DA 4BZEA 2WW0A 1RW9A 2E24A 1QALA 1HM3A 1RWHA 3T2QA 3BUPA 3D52A 3W7TA 3OBAA 3T0UA 1J0NA 1W5ZA 1JYXA 2HTAA 3S4DA 2WVXA 1IQXA 3VD3A 1RWAA 3BUIA 3D4ZA 1NSMA 2ALWA 2XSGA 4FNUA 1TQUA 3BVWA 3QFYA 2CQTA 3NREA 1W4NA 1OJOA 1SIIA 2F1AA 1MMYA 2CFGA 1MMZA 2EAEA 2EABA 1X1JA 2WCOA 2OOVC 1A2VA 3S4CA 1F1SA 3AMOB 1OJMA 4MMHA 1MMXA 3X3ZA 2C10A 3EJSA 1JRQA 1IQYA 2WO0A 3T2PA 3WIQA 1D6YA 3W7XA 2WYIA 1JZ8A 3EJPA 2CWUA 2WGQA 2CISA 3J7HA 1UI7A 3HI7A 5KBPA 3I3BA 1JZ2A 3DX4A 3T09A 3QFZA 5E1QA 4FNPA 3EJRA 1OACA 1HTYA 1HXKA 2XHNA 3OB8A 1JZ6A 3VDCA 1EGUA 1D6ZA 4EV5A 3NBJA 1JYWA 1HN1A 1ULVA 3RRSA 1MMUA 3AFLA 1SPUA 2WOHA 1IU7A 1JYVA 1Z45A 1H54A 4NEIA 1OJPA 2CFKA 4MMIA 2PNCA 4FNTA 1X1HA 1LXMA 3HIGA 1NSRA 4FNQA 3VDBA 1J0MA 1SNZA 2CFDA 1YGAA 4J5TA 1O7DD 1NS8A 1LF6A 1K1XA 2XN1A 1RWFA 1WMNA 4AQ0A 3BLBA 4KFFA 3MI6A 1JZ5A 3DYPA 3LOYA 1TQVA 4BZGA 1N7NA 3CV5A 2F1BA 3D4YA 2F7QA 3LVTA 3MPHA 3BGAA 2OQEA 1AVLA 2WW3A 1N9EA 4BZHA 3T08A 3Q1NA 2FUTA 2Q1FA 1DP0A 1PX4A 3DYOA 1NSUA 3RSYA 3VDAA 2ZQ0A 3D51A 2YFNA 2XN2A 2JKPA 2C11A 2CWTA 3ACTA 3T0AA 2FYVA 2WVYA 3DDGA 2D73A 3BUBA 3ECQA 1TQTA 3BVXA 1LVNA 2XN0A 4FNSA 3AMOA 3DX1A 1NSXA 3IMHA 3D3IA 4DUWA 3NJXA 1NSSA 1L7JA 1W7CA 2D1WA 1RWGA 2Y74A 3T0BA 2E2VA 2OOVA 1K1YA 1TU5A 3CZJA 2F7RA 4DUXA 1AVKA 4KFEA 1F4AA 1NKGA 2JKAA 1JOVA 3X42A 1RWCA 2WW2A 3WIRA 4BTXA 1PX3A 3SX1A 3DYMA 1QX1A 3MV01 1JZ4A 1NS4A 3T2OA 4BTWA 3VD9A 3VD4A 3KN4A 3PGBA 3T0DA 3DECA 1SIHA 1WMOA 3BVTA 1YQ2A 1F9GA 2WYHA 4KTRA 1JYNA 3E1F1 2CIQA 3E80A 3WA2X 2CWVA 3EJUA 5GW7A 3MUZ1 1EKMA 1F4HA 4DUVA 1W3YA 3ACSA 1R33A 3K25A 3KIIA 3S4AA 2HTBA 2CG0A 3VD7A 1DYUA 4FNVA 3WVFA 1KSIA 3D50A 2X03A 1K1WA 3X40A 3W7UA 2CIRA 2W0QA 3X41A 4KTPA 3DDFA 2FUQA 5A1AA 2WW1A 2JKEA 3A24A 1I8QA 1N7PA 3AFJA 3BLCA 3BUDA 4BTYA 1US1A 2F18A 3SXXA 3EJQA 2OW7A 3VD5A 3X3YA 2CG1A 2CQSA 1W6CA 2ZXQA 1C82A 4FNRA 2BT3A 4K3AA 1HWWA 2BRWA 2BRPA 1HN0A 2CFLA 3WA3A 1CB8A 2F7OA 3TY1A 5JMFA 1W2ZA 2RDYA 4OK2A 1NS7A 3BUQA 2E22A 1N7RA 1QAKA 1RJOA 1QWUA 1MN0A 1IVVA 1QAFA 1JZ3A 1N7QA 4UFCA 3ALAA 5JMDA 1N7OA 2F7PA 4EV2A 2E2UA 1V7WA 1LXKA 2ZL8A 1JZ7A 3MUY1 4KFDA 3NBBA 1NS2A 1D6UA 3VSMA 1QWNA 1HMWA 2CFWA 3CZNA 3OS7A 3WFAA 2E2TA 1UI8A 3BS6A 3X3XA 4K35A 3EJTA 5CA3A 3S4BA 1IVWA 2WVXB 3I3EA 2Y73A 2EADA 3DX2A 4RNLA 3QDEA 2BRVX 2YFOA 3QG0A 1NSZA 3BVVA 1PS3A 4TTGA 4BZFA 2WZSA 1NS0A 3A0OA 3NJVA 3W7WA 1IVXA 1V7VA 1NSVA 1R34A 3VSNA 1L7KA 1SO0A 2WDAA 1LOHA 2WVZA 3N9HA 3CZSA 1WMPA 3IAPA 2WOFA 1TQWA 1W6GA 1PU4A 3W7SA 2EACA 3K5TA 4OJZA 3SEPA 1TQSA 1LURA 4OK4A 1AV4A 1TXKA 1RKYA 1LF9A 3DX0A 1V7XA 1HMUA 3MWXA 3E7JA 3DCDA 3MV11 3IAQA 1IVUA 3DX3A
chains in the Genus database with same CATH topology
1J0MA 3MUY1 1SNZA 1F9GA 1JZ7A 1JYNA 3E1F1 1YGAA 1NS2A 4J5TA 2CIQA 3E80A 1NS8A 3VSMA 1OJNA 1HMWA 1HM2A 3MUZ1 1LF6A 1UG9A 1K1XA 1F4HA 1RWFA 4DUVA 1X1IA 3OS7A 1W3YA 3WFAA 3I3DA 4AQ0A 3K25A 4BZEA 2WW0A 2HTBA 1RW9A 2E24A 3VD7A 1JZ5A 3DYPA 1HM3A 4FNVA 3WVFA 1RWHA 3BS6A 3T2QA 4BZGA 1N7NA 2X03A 3OBAA 1K1WA 1J0NA 3BGAA 2WVXB 1JYXA 3I3EA 2HTAA 2WW3A 2WVXA 2CIRA 3VD3A 1RWAA 4BZHA 3T08A 1NSMA 3Q1NA 2XSGA 2FUTA 2Q1FA 2FUQA 1DP0A 1PX4A 3DYOA 1NSUA 5A1AA 3VDAA 2WW1A 4RNLA 2JKEA 2ZQ0A 3A24A 1I8QA 1N7PA 3NREA 1OJOA 3BLCA 1MMYA 2BRVX 2JKPA 1MMZA 1X1JA 2WCOA 3T0AA 2WVYA 1NSZA 2D73A 3ECQA 1F1SA 4TTGA 4BZFA 1OJMA 4MMHA 3VD5A 1MMXA 2WZSA 3T2PA 1NS0A 3A0OA 3NJVA 1NSXA 3IMHA 1NSVA 3VSNA 1L7KA 3NJXA 1SO0A 4DUWA 1JZ8A 1NSSA 1L7JA 2WDAA 2CISA 2ZXQA 3J7HA 1C82A 1RWGA 1LOHA 2WVZA 3I3BA 2BRPA 2BRWA 3T0BA 1K1YA 1HN0A 1JZ2A 3CZJA 1CB8A 3T09A 3TY1A 5JMFA 3IAPA 5E1QA 4DUXA 2XHNA 3OB8A 4OK2A 1NS7A 1F4AA 1NKGA 2JKAA 3VDCA 1JOVA 1JZ6A 2E22A 1EGUA 1N7RA 1RWCA 2WW2A 1PX3A 1JYWA 4OJZA 1HN1A 3SEPA 1ULVA 3DYMA 1MN0A 1MMUA 3MV01 1LURA 3AFLA 1JZ4A 1NS4A 3T2OA 4OK4A 1JZ3A 1N7QA 1JYVA 1TXKA 1Z45A 4NEIA 1LF9A 1OJPA 3VD9A 5JMDA 1N7OA 3VD4A 4MMIA 1HMUA 3T0DA 3DECA 3MWXA 1X1HA 1LXMA 1YQ2A 1LXKA 3E7JA 3DCDA 1NSRA 3MV11 3IAQA 3VDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0M A;  3MUY 1;  1SNZ A;  1F9G A;  1JZ7 A;  1JYN A;  3E1F 1;  1YGA A;  1NS2 A;  2CIQ A;  1NS8 A;  1OJN A;  1HMW A;  1HM2 A;  3MUZ 1;  1LF6 A;  1UG9 A;  1K1X A;  1F4H A;  1RWF A;  4DUV A;  1X1I A;  3OS7 A;  1W3Y A;  3WFA A;  3I3D A;  4AQ0 A;  3K25 A;  4BZE A;  2WW0 A;  2HTB A;  1RW9 A;  2E24 A;  3VD7 A;  1JZ5 A;  3DYP A;  1HM3 A;  1RWH A;  3T2Q A;  4BZG A;  1N7N A;  2X03 A;  3OBA A;  1K1W A;  1J0N A;  3BGA A;  2WVX B;  1JYX A;  3I3E A;  2HTA A;  2WW3 A;  2WVX A;  2CIR A;  3VD3 A;  1RWA A;  4BZH A;  3T08 A;  1NSM A;  3Q1N A;  2XSG A;  2Q1F A;  1DP0 A;  1PX4 A;  3DYO A;  1NSU A;  5A1A A;  3VDA A;  2WW1 A;  4RNL A;  2JKE A;  2ZQ0 A;  3A24 A;  1I8Q A;  1N7P A;  3NRE A;  1OJO A;  1MMY A;  2BRV X;  2JKP A;  1MMZ A;  1X1J A;  2WCO A;  3T0A A;  2WVY A;  1NSZ A;  2D73 A;  3ECQ A;  1F1S A;  4TTG A;  4BZF A;  1OJM A;  3VD5 A;  1MMX A;  2WZS A;  3T2P A;  1NS0 A;  3NJV A;  1NSX A;  3IMH A;  1NSV A;  1L7K A;  3NJX A;  1SO0 A;  4DUW A;  1JZ8 A;  1NSS A;  1L7J A;  2WDA A;  2CIS A;  2ZXQ A;  3J7H A;  1C82 A;  1RWG A;  1LOH A;  2WVZ A;  3I3B A;  2BRP A;  2BRW A;  3T0B A;  1K1Y A;  1HN0 A;  1JZ2 A;  3CZJ A;  1CB8 A;  3T09 A;  3IAP A;  5E1Q A;  4DUX A;  2XHN A;  3OB8 A;  1NS7 A;  1F4A A;  1NKG A;  2JKA A;  3VDC A;  1JOV A;  1JZ6 A;  2E22 A;  1EGU A;  1N7R A;  1RWC A;  2WW2 A;  1PX3 A;  1JYW A;  1HN1 A;  3SEP A;  1ULV A;  3DYM A;  1MN0 A;  1MMU A;  3MV0 1;  1LUR A;  1JZ4 A;  1NS4 A;  3T2O A;  1JZ3 A;  1N7Q A;  1JYV A;  1TXK A;  1Z45 A;  1LF9 A;  1OJP A;  3VD9 A;  1N7O A;  3VD4 A;  1HMU A;  3T0D A;  3DEC A;  3MWX A;  1X1H A;  1LXM A;  1YQ2 A;  1LXK A;  3DCD A;  1NSR A;  3MV1 1;  3IAQ A;  3VDB A; 
#chains in the Genus database with same CATH topology
 2OW6 A;  1OJN A;  2OQE C;  1HM2 A;  1UG9 A;  3HII A;  1X1I A;  3BVU A;  2YX9 A;  3I3D A;  4BZE A;  2WW0 A;  1RW9 A;  2E24 A;  1QAL A;  1HM3 A;  1RWH A;  3T2Q A;  3BUP A;  3D52 A;  3W7T A;  3OBA A;  3T0U A;  1J0N A;  1W5Z A;  1JYX A;  2HTA A;  3S4D A;  2WVX A;  1IQX A;  3VD3 A;  1RWA A;  3BUI A;  3D4Z A;  1NSM A;  2ALW A;  2XSG A;  4FNU A;  1TQU A;  3BVW A;  3QFY A;  2CQT A;  3NRE A;  1W4N A;  1OJO A;  1SII A;  2F1A A;  1MMY A;  2CFG A;  1MMZ A;  2EAE A;  2EAB A;  1X1J A;  2WCO A;  2OOV C;  1A2V A;  3S4C A;  1F1S A;  3AMO B;  1OJM A;  4MMH A;  1MMX A;  3X3Z A;  2C10 A;  3EJS A;  1JRQ A;  1IQY A;  2WO0 A;  3T2P A;  3WIQ A;  1D6Y A;  3W7X A;  2WYI A;  1JZ8 A;  3EJP A;  2CWU A;  2WGQ A;  2CIS A;  3J7H A;  1UI7 A;  3HI7 A;  5KBP A;  3I3B A;  1JZ2 A;  3DX4 A;  3T09 A;  3QFZ A;  5E1Q A;  4FNP A;  3EJR A;  1OAC A;  1HTY A;  1HXK A;  2XHN A;  3OB8 A;  1JZ6 A;  3VDC A;  1EGU A;  1D6Z A;  4EV5 A;  3NBJ A;  1JYW A;  1HN1 A;  1ULV A;  3RRS A;  1MMU A;  3AFL A;  1SPU A;  2WOH A;  1IU7 A;  1JYV A;  1Z45 A;  1H54 A;  4NEI A;  1OJP A;  2CFK A;  4MMI A;  2PNC A;  4FNT A;  1X1H A;  1LXM A;  3HIG A;  1NSR A;  4FNQ A;  3VDB A;  1J0M A;  1SNZ A;  2CFD A;  1YGA A;  4J5T A;  1O7D D;  1NS8 A;  1LF6 A;  1K1X A;  2XN1 A;  1RWF A;  1WMN A;  4AQ0 A;  3BLB A;  4KFF A;  3MI6 A;  1JZ5 A;  3DYP A;  3LOY A;  1TQV A;  4BZG A;  1N7N A;  3CV5 A;  2F1B A;  3D4Y A;  2F7Q A;  3LVT A;  3MPH A;  3BGA A;  2OQE A;  1AVL A;  2WW3 A;  1N9E A;  4BZH A;  3T08 A;  3Q1N A;  2FUT A;  2Q1F A;  1DP0 A;  1PX4 A;  3DYO A;  1NSU A;  3RSY A;  3VDA A;  2ZQ0 A;  3D51 A;  2YFN A;  2XN2 A;  2JKP A;  2C11 A;  2CWT A;  3ACT A;  3T0A A;  2FYV A;  2WVY A;  3DDG A;  2D73 A;  3BUB A;  3ECQ A;  1TQT A;  3BVX A;  1LVN A;  2XN0 A;  4FNS A;  3AMO A;  3DX1 A;  1NSX A;  3IMH A;  3D3I A;  4DUW A;  3NJX A;  1NSS A;  1L7J A;  1W7C A;  2D1W A;  1RWG A;  2Y74 A;  3T0B A;  2E2V A;  2OOV A;  1K1Y A;  1TU5 A;  3CZJ A;  2F7R A;  4DUX A;  1AVK A;  4KFE A;  1F4A A;  1NKG A;  2JKA A;  1JOV A;  3X42 A;  1RWC A;  2WW2 A;  3WIR A;  4BTX A;  1PX3 A;  3SX1 A;  3DYM A;  1QX1 A;  3MV0 1;  1JZ4 A;  1NS4 A;  3T2O A;  4BTW A;  3VD9 A;  3VD4 A;  3KN4 A;  3PGB A;  3T0D A;  3DEC A;  1SIH A;  1WMO A;  3BVT A;  1YQ2 A;  1F9G A;  2WYH A;  4KTR A;  1JYN A;  3E1F 1;  2CIQ A;  3E80 A;  3WA2 X;  2CWV A;  3EJU A;  5GW7 A;  3MUZ 1;  1EKM A;  1F4H A;  4DUV A;  1W3Y A;  3ACS A;  1R33 A;  3K25 A;  3KII A;  3S4A A;  2HTB A;  2CG0 A;  3VD7 A;  1DYU A;  4FNV A;  3WVF A;  1KSI A;  3D50 A;  2X03 A;  1K1W A;  3X40 A;  3W7U A;  2CIR A;  2W0Q A;  3X41 A;  4KTP A;  3DDF A;  2FUQ A;  5A1A A;  2WW1 A;  2JKE A;  3A24 A;  1I8Q A;  1N7P A;  3AFJ A;  3BLC A;  3BUD A;  4BTY A;  1US1 A;  2F18 A;  3SXX A;  3EJQ A;  2OW7 A;  3VD5 A;  3X3Y A;  2CG1 A;  2CQS A;  1W6C A;  2ZXQ A;  1C82 A;  4FNR A;  2BT3 A;  4K3A A;  1HWW A;  2BRW A;  2BRP A;  1HN0 A;  2CFL A;  3WA3 A;  1CB8 A;  2F7O A;  3TY1 A;  5JMF A;  1W2Z A;  2RDY A;  4OK2 A;  1NS7 A;  3BUQ A;  2E22 A;  1N7R A;  1QAK A;  1RJO A;  1QWU A;  1MN0 A;  1IVV A;  1QAF A;  1JZ3 A;  1N7Q A;  4UFC A;  3ALA A;  5JMD A;  1N7O A;  2F7P A;  4EV2 A;  2E2U A;  1V7W A;  1LXK A;  2ZL8 A;  1JZ7 A;  3MUY 1;  4KFD A;  3NBB A;  1NS2 A;  1D6U A;  3VSM A;  1QWN A;  1HMW A;  2CFW A;  3CZN A;  3OS7 A;  3WFA A;  2E2T A;  1UI8 A;  3BS6 A;  3X3X A;  4K35 A;  3EJT A;  5CA3 A;  3S4B A;  1IVW A;  2WVX B;  3I3E A;  2Y73 A;  2EAD A;  3DX2 A;  4RNL A;  3QDE A;  2BRV X;  2YFO A;  3QG0 A;  1NSZ A;  3BVV A;  1PS3 A;  4TTG A;  4BZF A;  2WZS A;  1NS0 A;  3A0O A;  3NJV A;  3W7W A;  1IVX A;  1V7V A;  1NSV A;  1R34 A;  3VSN A;  1L7K A;  1SO0 A;  2WDA A;  1LOH A;  2WVZ A;  3N9H A;  3CZS A;  1WMP A;  3IAP A;  2WOF A;  1TQW A;  1W6G A;  1PU4 A;  3W7S A;  2EAC A;  3K5T A;  4OJZ A;  3SEP A;  1TQS A;  1LUR A;  4OK4 A;  1AV4 A;  1TXK A;  1RKY A;  1LF9 A;  3DX0 A;  1V7X A;  1HMU A;  3MWX A;  3E7J A;  3DCD A;  3MV1 1;  3IAQ A;  1IVU A;  3DX3 A; 
#chains in the Genus database with same CATH homology
 1J0M A;  3MUY 1;  1SNZ A;  1F9G A;  1JZ7 A;  1JYN A;  3E1F 1;  1YGA A;  1NS2 A;  4J5T A;  2CIQ A;  3E80 A;  1NS8 A;  3VSM A;  1OJN A;  1HMW A;  1HM2 A;  3MUZ 1;  1LF6 A;  1UG9 A;  1K1X A;  1F4H A;  1RWF A;  4DUV A;  1X1I A;  3OS7 A;  1W3Y A;  3WFA A;  3I3D A;  4AQ0 A;  3K25 A;  4BZE A;  2WW0 A;  2HTB A;  1RW9 A;  2E24 A;  3VD7 A;  1JZ5 A;  3DYP A;  1HM3 A;  4FNV A;  3WVF A;  1RWH A;  3BS6 A;  3T2Q A;  4BZG A;  1N7N A;  2X03 A;  3OBA A;  1K1W A;  1J0N A;  3BGA A;  2WVX B;  1JYX A;  3I3E A;  2HTA A;  2WW3 A;  2WVX A;  2CIR A;  3VD3 A;  1RWA A;  4BZH A;  3T08 A;  1NSM A;  3Q1N A;  2XSG A;  2FUT A;  2Q1F A;  2FUQ A;  1DP0 A;  1PX4 A;  3DYO A;  1NSU A;  5A1A A;  3VDA A;  2WW1 A;  4RNL A;  2JKE A;  2ZQ0 A;  3A24 A;  1I8Q A;  1N7P A;  3NRE A;  1OJO A;  3BLC A;  1MMY A;  2BRV X;  2JKP A;  1MMZ A;  1X1J A;  2WCO A;  3T0A A;  2WVY A;  1NSZ A;  2D73 A;  3ECQ A;  1F1S A;  4TTG A;  4BZF A;  1OJM A;  4MMH A;  3VD5 A;  1MMX A;  2WZS A;  3T2P A;  1NS0 A;  3A0O A;  3NJV A;  1NSX A;  3IMH A;  1NSV A;  3VSN A;  1L7K A;  3NJX A;  1SO0 A;  4DUW A;  1JZ8 A;  1NSS A;  1L7J A;  2WDA A;  2CIS A;  2ZXQ A;  3J7H A;  1C82 A;  1RWG A;  1LOH A;  2WVZ A;  3I3B A;  2BRP A;  2BRW A;  3T0B A;  1K1Y A;  1HN0 A;  1JZ2 A;  3CZJ A;  1CB8 A;  3T09 A;  3TY1 A;  5JMF A;  3IAP A;  5E1Q A;  4DUX A;  2XHN A;  3OB8 A;  4OK2 A;  1NS7 A;  1F4A A;  1NKG A;  2JKA A;  3VDC A;  1JOV A;  1JZ6 A;  2E22 A;  1EGU A;  1N7R A;  1RWC A;  2WW2 A;  1PX3 A;  1JYW A;  4OJZ A;  1HN1 A;  3SEP A;  1ULV A;  3DYM A;  1MN0 A;  1MMU A;  3MV0 1;  1LUR A;  3AFL A;  1JZ4 A;  1NS4 A;  3T2O A;  4OK4 A;  1JZ3 A;  1N7Q A;  1JYV A;  1TXK A;  1Z45 A;  4NEI A;  1LF9 A;  1OJP A;  3VD9 A;  5JMD A;  1N7O A;  3VD4 A;  4MMI A;  1HMU A;  3T0D A;  3DEC A;  3MWX A;  1X1H A;  1LXM A;  1YQ2 A;  1LXK A;  3E7J A;  3DCD A;  1NSR A;  3MV1 1;  3IAQ A;  3VDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...