2HTAA

Crystal structure of a putative mutarotase (yead) from salmonella typhimurium in orthorhombic form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
297
structure length
297
Chain Sequence
ASHMINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLWLSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFELQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGLGDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative enzyme related to aldose 1-epimerase
publication title Structure of the putative mutarotase YeaD from Salmonella typhimurium: structural comparison with galactose mutarotases.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 72
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 5.1.3.15: Glucose-6-phosphate 1-epimerase.
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 2htaA00
2WCOA 3MV11 3T08A 1JYVA 2ZQ0A 5A1AA 1C82A 3T0BA 2E24A 2E22A 3J7HA 1F4AA 1HMUA 1RWHA 3T0AA 1NSZA 1TXKA 1F4HA 1L7JA 2WVXA 3VD7A 2WZSA 1NS2A 1J0NA 1X1JA 3DYOA 3VDCA 1RWCA 1RWGA 1HM2A 3MUZ1 1HM3A 1LXKA 1N7RA 4DUVA 1I8QA 2JKAA 1DP0A 3NJVA 3VD4A 3T0DA 4BZHA 3I3EA 1JYXA 3IAQA 2WVXB 1NSUA 4DUWA 1JYNA 3E1F1 2CIQA 1RWAA 2WW0A 3VDBA 3DCDA 1RW9A 2WW1A 3K25A 3NREA 3I3DA 1YGAA 3VDAA 1PX4A 1N7NA 3BGAA 1X1IA 1N7PA 3MUY1 1EGUA 2HTBA 2BRWA 3T09A 5E1QA 2JKEA 1YQ2A 3ECQA 3VD9A 3SEPA 1N7QA 3OS7A 1JZ3A 1K1WA 2WVYA 1JZ6A 1SO0A 2BRVX 3CZJA 4TTGA 1MN0A 1JZ2A 1NKGA 3IAPA 2ZXQA 1K1YA 3Q1NA 2BRPA 3MV01 1LURA 1HN0A 2JKPA 4BZEA 1JZ5A 1NSXA 1NSSA 2CISA 1K1XA 2WDAA 1F1SA 2Q1FA 2WVZA 1JOVA 1NS4A 2WW2A 2XHNA 1CB8A 1HN1A 3I3BA 1MMXA 1N7OA 1OJNA 3IMHA 1JZ8A 1OJPA 3T2QA 3DYPA 1NSVA 1ULVA 3OBAA 1JYWA 3MWXA 2CIRA 1UG9A 1Z45A 4DUXA 1LOHA 1OJMA 2XSGA 3OB8A 1NS8A 1MMZA 3VD5A 1JZ4A 2HTAA 2D73A 1RWFA 3WFAA 4BZFA 1L7KA 1LXMA 1NSRA 3T2OA 1PX3A 4AQ0A 1NSMA 1HMWA 1NS0A 3T2PA 3DECA 3VD3A 1LF9A 3NJXA 1SNZA 1J0MA 1OJOA 1W3YA 4RNLA 3DYMA 1MMYA 1JZ7A 1X1HA 3A24A 2WW3A 1F9GA 1MMUA 1NS7A 4BZGA 1LF6A 2X03A
chains in the Genus database with same CATH superfamily
1D6UA 1H54A 2CG0A 2WOHA 3T0BA 2XN0A 2E22A 3LVTA 1NSZA 3TY1A 2WVXA 5KBPA 2D1WA 3DYOA 3HIGA 1RWGA 1LXKA 3T0DA 3D51A 3AFJA 1AVKA 3WA2X 1JYXA 2WVXB 1NSUA 4FNSA 2WO0A 1RW9A 5GW7A 2Y73A 3I3DA 1PX4A 4OK2A 3WIRA 1SIIA 1X1IA 1EGUA 2EAEA 3T09A 2JKEA 3ALAA 3EJQA 4OK4A 2PNCA 3SEPA 3OS7A 1QX1A 3BVXA 5JMDA 3EJPA 3MV01 3BVTA 4BZEA 2JKPA 2WGQA 1PU4A 1IQXA 2C11A 1RJOA 1IQYA 1MMXA 3T2QA 3OBAA 4DUXA 3W7WA 1NS8A 3BVUA 2F1BA 1D6ZA 1L7KA 1NSRA 1PX3A 2CFLA 2WYIA 1O7DD 1W6CA 1WMOA 3NJXA 3MPHA 1IVWA 4NEIA 4BTWA 3DYMA 3X3YA 2CFGA 3DX0A 4BZGA 1LF6A 2WCOA 1JYVA 2ZQ0A 1TQTA 1C82A 2E24A 3S4DA 3KIIA 3T0AA 3X3XA 1L7JA 1WMPA 3E7JA 3VD7A 2E2UA 2F7QA 1TQUA 3WIQA 3HIIA 2F7PA 3VDCA 3MUZ1 3BVWA 1HM3A 2OW7A 3VD4A 2FUTA 5CA3A 3EJUA 4BZHA 3AFLA 3E1F1 2WW0A 4KTPA 3X41A 2WW1A 3K25A 1YGAA 3VDAA 2CFDA 3BGAA 1N7PA 3T0UA 4FNQA 3EJSA 4EV2A 1JZ3A 3PGBA 2WVYA 4J5TA 3CZJA 4TTGA 2EACA 2ZXQA 2ZL8A 2BRPA 1HN0A 1JZ5A 4UFCA 1NSXA 2F1AA 1F1SA 3BUDA 2WW2A 1JOVA 1NS4A 2XHNA 3I3BA 1HTYA 1IU7A 3RRSA 1OJNA 4EV5A 3IMHA 1JZ8A 1OJPA 2F7OA 4FNUA 2F7RA 1Z45A 1DYUA 1LOHA 1OJMA 2XSGA 2YFNA 3OB8A 1W2ZA 1R33A 3VD5A 2D73A 1RWFA 4K35A 3BLCA 1UI8A 3D3IA 3A0OA 3W7XA 3N9HA 3T2OA 4AQ0A 2E2VA 2CWTA 2OW6A 3S4CA 3DECA 3VD3A 1LF9A 1SNZA 1J0MA 4RNLA 2CWUA 1X1HA 1F9GA 1SIHA 1F4HA 2RDYA 3T08A 5A1AA 3NBBA 4BTYA 1RWHA 1W4NA 4KFFA 1NS2A 2BT3A 2CFWA 1TQWA 1RWCA 1W6GA 4DUVA 1I8QA 2JKAA 1DP0A 3NJVA 2CIQA 2CQSA 1RWAA 3DCDA 2OOVA 3X40A 3NREA 1QAKA 1N7NA 3WVFA 3MUY1 4MMIA 2BRWA 3CZSA 1YQ2A 3QDEA 1AVLA 3X3ZA 3BVVA 3VD9A 1R34A 3W7SA 1N7QA 2CFKA 1K1WA 1SPUA 1JZ6A 2WOFA 1SO0A 2BRVX 2F18A 3D50A 1NKGA 3NBJA 3Q1NA 2OQEC 1D6YA 3HI7A 3BS6A 1QWUA 1NSSA 2CISA 3SX1A 1K1XA 2WDAA 4KFDA 1HN1A 3DX1A 3QFZA 1N7OA 3AMOA 3DYPA 1ULVA 4BTXA 2CIRA 1IVUA 1TU5A 4K3AA 1MMZA 2EABA 3W7TA 1W5ZA 1QWNA 4FNVA 3X42A 3WFAA 3AMOB 1LXMA 2FYVA 1NSMA 3K5TA 1HMWA 3BUBA 3VSMA 3T2PA 1KSIA 1A2VA 3DX3A 3KN4A 4FNPA 3D4ZA 1OACA 3ACSA 1EKMA 4KFEA 3BUPA 3QFYA 1W3YA 1N9EA 1MMYA 1JZ7A 3A24A 2WW3A 3EJTA 2ALWA 2X03A 3MV11 1AV4A 2YX9A 4FNTA 3SXXA 1WMNA 2YFOA 3CV5A 3J7HA 1F4AA 1HMUA 1TXKA 5JMFA 4FNRA 2WZSA 1J0NA 3MI6A 1HWWA 1X1JA 1TQSA 2Y74A 1HM2A 2XN2A 3DX2A 1N7RA 3CZNA 2EADA 3I3EA 1US1A 3IAQA 4DUWA 1JYNA 1W7CA 3ACTA 3VDBA 3DDFA 2HTBA 5E1QA 1QALA 3BUIA 3ECQA 2E2TA 3BUQA 3D52A 2CWVA 3VSNA 1MN0A 1JZ2A 3IAPA 1K1YA 1JRQA 1QAFA 1LURA 3BLBA 3DDGA 1RKYA 2Q1FA 2WVZA 2OQEA 1IVXA 1CB8A 2WYHA 1V7XA 3WA3A 3W7UA 1NSVA 1JYWA 3MWXA 1UG9A 1UI7A 3LOYA 2W0QA 1V7WA 1JZ4A 3S4BA 2HTAA 3DX4A 3S4AA 4BZFA 4OJZA 1TQVA 2C10A 2FUQA 2XN1A 1NS0A 4KTRA 1PS3A 1LVNA 3RSYA 3E80A 3QG0A 2CQTA 1IVVA 1OJOA 3D4YA 2CG1A 4MMHA 1HXKA 1V7VA 2OOVC 1MMUA 1NS7A 3EJRA
chains in the Genus database with same CATH topology
2WCOA 3MV11 3T08A 1JYVA 2ZQ0A 5A1AA 1C82A 3T0BA 2E24A 2E22A 3J7HA 1F4AA 1HMUA 1RWHA 3T0AA 1NSZA 1TXKA 3TY1A 5JMFA 1F4HA 1L7JA 2WVXA 3E7JA 3VD7A 2WZSA 1NS2A 1J0NA 1X1JA 3DYOA 3VDCA 1RWCA 1RWGA 1HM2A 3MUZ1 1HM3A 1LXKA 1N7RA 4DUVA 1I8QA 2JKAA 1DP0A 3NJVA 3VD4A 2FUTA 3T0DA 4BZHA 3I3EA 1JYXA 3IAQA 2WVXB 1NSUA 4DUWA 3AFLA 3E1F1 1JYNA 2CIQA 1RWAA 2WW0A 3VDBA 3DCDA 1RW9A 2WW1A 3K25A 3NREA 3I3DA 1YGAA 3VDAA 1PX4A 1N7NA 3WVFA 4OK2A 3BGAA 1X1IA 1N7PA 3MUY1 1EGUA 2HTBA 4MMIA 2BRWA 3T09A 5E1QA 2JKEA 1YQ2A 3ECQA 4OK4A 3VD9A 3SEPA 1N7QA 3OS7A 1JZ3A 1K1WA 4J5TA 2WVYA 1JZ6A 1SO0A 2BRVX 3CZJA 3VSNA 4TTGA 1MN0A 1JZ2A 1NKGA 5JMDA 3IAPA 2ZXQA 1K1YA 3Q1NA 2BRPA 3MV01 1LURA 3BS6A 1HN0A 2JKPA 4BZEA 1JZ5A 1NSXA 1NSSA 2CISA 1K1XA 2WDAA 1F1SA 2Q1FA 2WVZA 1JOVA 1NS4A 2WW2A 2XHNA 1CB8A 1HN1A 3I3BA 1MMXA 1N7OA 1OJNA 3IMHA 1JZ8A 1OJPA 3T2QA 3DYPA 1NSVA 1ULVA 3OBAA 1JYWA 3MWXA 2CIRA 1UG9A 1Z45A 4DUXA 1LOHA 1OJMA 2XSGA 3OB8A 1NS8A 1MMZA 3VD5A 1JZ4A 2HTAA 2D73A 1RWFA 4FNVA 3BLCA 3WFAA 4BZFA 1L7KA 1LXMA 1NSRA 4OJZA 3A0OA 3T2OA 1PX3A 4AQ0A 2FUQA 1NSMA 3VSMA 1HMWA 1NS0A 3T2PA 3DECA 3VD3A 3E80A 1LF9A 3NJXA 1SNZA 1J0MA 4NEIA 1OJOA 1W3YA 4RNLA 3DYMA 1MMYA 1JZ7A 1X1HA 3A24A 2WW3A 1F9GA 4MMHA 1MMUA 1NS7A 4BZGA 1LF6A 2X03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCO A;  3MV1 1;  3T08 A;  1JYV A;  2ZQ0 A;  5A1A A;  1C82 A;  3T0B A;  2E24 A;  2E22 A;  3J7H A;  1F4A A;  1HMU A;  1RWH A;  3T0A A;  1NSZ A;  1TXK A;  1F4H A;  1L7J A;  2WVX A;  3VD7 A;  2WZS A;  1NS2 A;  1J0N A;  1X1J A;  3DYO A;  3VDC A;  1RWC A;  1RWG A;  1HM2 A;  3MUZ 1;  1HM3 A;  1LXK A;  1N7R A;  4DUV A;  1I8Q A;  2JKA A;  1DP0 A;  3NJV A;  3VD4 A;  3T0D A;  4BZH A;  3I3E A;  1JYX A;  3IAQ A;  2WVX B;  1NSU A;  4DUW A;  1JYN A;  3E1F 1;  2CIQ A;  1RWA A;  2WW0 A;  3VDB A;  3DCD A;  1RW9 A;  2WW1 A;  3K25 A;  3NRE A;  3I3D A;  1YGA A;  3VDA A;  1PX4 A;  1N7N A;  3BGA A;  1X1I A;  1N7P A;  3MUY 1;  1EGU A;  2HTB A;  2BRW A;  3T09 A;  5E1Q A;  2JKE A;  1YQ2 A;  3ECQ A;  3VD9 A;  3SEP A;  1N7Q A;  3OS7 A;  1JZ3 A;  1K1W A;  2WVY A;  1JZ6 A;  1SO0 A;  2BRV X;  3CZJ A;  4TTG A;  1MN0 A;  1JZ2 A;  1NKG A;  3IAP A;  2ZXQ A;  1K1Y A;  3Q1N A;  2BRP A;  3MV0 1;  1LUR A;  1HN0 A;  2JKP A;  4BZE A;  1JZ5 A;  1NSX A;  1NSS A;  2CIS A;  1K1X A;  2WDA A;  1F1S A;  2Q1F A;  2WVZ A;  1JOV A;  1NS4 A;  2WW2 A;  2XHN A;  1CB8 A;  1HN1 A;  3I3B A;  1MMX A;  1N7O A;  1OJN A;  3IMH A;  1JZ8 A;  1OJP A;  3T2Q A;  3DYP A;  1NSV A;  1ULV A;  3OBA A;  1JYW A;  3MWX A;  2CIR A;  1UG9 A;  1Z45 A;  4DUX A;  1LOH A;  1OJM A;  2XSG A;  3OB8 A;  1NS8 A;  1MMZ A;  3VD5 A;  1JZ4 A;  2HTA A;  2D73 A;  1RWF A;  3WFA A;  4BZF A;  1L7K A;  1LXM A;  1NSR A;  3T2O A;  1PX3 A;  4AQ0 A;  1NSM A;  1HMW A;  1NS0 A;  3T2P A;  3DEC A;  3VD3 A;  1LF9 A;  3NJX A;  1SNZ A;  1J0M A;  1OJO A;  1W3Y A;  4RNL A;  3DYM A;  1MMY A;  1JZ7 A;  1X1H A;  3A24 A;  2WW3 A;  1F9G A;  1MMU A;  1NS7 A;  4BZG A;  1LF6 A;  2X03 A; 
#chains in the Genus database with same CATH topology
 1D6U A;  1H54 A;  2CG0 A;  2WOH A;  3T0B A;  2XN0 A;  2E22 A;  3LVT A;  1NSZ A;  3TY1 A;  2WVX A;  5KBP A;  2D1W A;  3DYO A;  3HIG A;  1RWG A;  1LXK A;  3T0D A;  3D51 A;  3AFJ A;  1AVK A;  3WA2 X;  1JYX A;  2WVX B;  1NSU A;  4FNS A;  2WO0 A;  1RW9 A;  5GW7 A;  2Y73 A;  3I3D A;  1PX4 A;  4OK2 A;  3WIR A;  1SII A;  1X1I A;  1EGU A;  2EAE A;  3T09 A;  2JKE A;  3ALA A;  3EJQ A;  4OK4 A;  2PNC A;  3SEP A;  3OS7 A;  1QX1 A;  3BVX A;  5JMD A;  3EJP A;  3MV0 1;  3BVT A;  4BZE A;  2JKP A;  2WGQ A;  1PU4 A;  1IQX A;  2C11 A;  1RJO A;  1IQY A;  1MMX A;  3T2Q A;  3OBA A;  4DUX A;  3W7W A;  1NS8 A;  3BVU A;  2F1B A;  1D6Z A;  1L7K A;  1NSR A;  1PX3 A;  2CFL A;  2WYI A;  1O7D D;  1W6C A;  1WMO A;  3NJX A;  3MPH A;  1IVW A;  4NEI A;  4BTW A;  3DYM A;  3X3Y A;  2CFG A;  3DX0 A;  4BZG A;  1LF6 A;  2WCO A;  1JYV A;  2ZQ0 A;  1TQT A;  1C82 A;  2E24 A;  3S4D A;  3KII A;  3T0A A;  3X3X A;  1L7J A;  1WMP A;  3E7J A;  3VD7 A;  2E2U A;  2F7Q A;  1TQU A;  3WIQ A;  3HII A;  2F7P A;  3VDC A;  3MUZ 1;  3BVW A;  1HM3 A;  2OW7 A;  3VD4 A;  2FUT A;  5CA3 A;  3EJU A;  4BZH A;  3AFL A;  3E1F 1;  2WW0 A;  4KTP A;  3X41 A;  2WW1 A;  3K25 A;  1YGA A;  3VDA A;  2CFD A;  3BGA A;  1N7P A;  3T0U A;  4FNQ A;  3EJS A;  4EV2 A;  1JZ3 A;  3PGB A;  2WVY A;  4J5T A;  3CZJ A;  4TTG A;  2EAC A;  2ZXQ A;  2ZL8 A;  2BRP A;  1HN0 A;  1JZ5 A;  4UFC A;  1NSX A;  2F1A A;  1F1S A;  3BUD A;  2WW2 A;  1JOV A;  1NS4 A;  2XHN A;  3I3B A;  1HTY A;  1IU7 A;  3RRS A;  1OJN A;  4EV5 A;  3IMH A;  1JZ8 A;  1OJP A;  2F7O A;  4FNU A;  2F7R A;  1Z45 A;  1DYU A;  1LOH A;  1OJM A;  2XSG A;  2YFN A;  3OB8 A;  1W2Z A;  1R33 A;  3VD5 A;  2D73 A;  1RWF A;  4K35 A;  3BLC A;  1UI8 A;  3D3I A;  3A0O A;  3W7X A;  3N9H A;  3T2O A;  4AQ0 A;  2E2V A;  2CWT A;  2OW6 A;  3S4C A;  3DEC A;  3VD3 A;  1LF9 A;  1SNZ A;  1J0M A;  4RNL A;  2CWU A;  1X1H A;  1F9G A;  1SIH A;  1F4H A;  2RDY A;  3T08 A;  5A1A A;  3NBB A;  4BTY A;  1RWH A;  1W4N A;  4KFF A;  1NS2 A;  2BT3 A;  2CFW A;  1TQW A;  1RWC A;  1W6G A;  4DUV A;  1I8Q A;  2JKA A;  1DP0 A;  3NJV A;  2CIQ A;  2CQS A;  1RWA A;  3DCD A;  2OOV A;  3X40 A;  3NRE A;  1QAK A;  1N7N A;  3WVF A;  3MUY 1;  4MMI A;  2BRW A;  3CZS A;  1YQ2 A;  3QDE A;  1AVL A;  3X3Z A;  3BVV A;  3VD9 A;  1R34 A;  3W7S A;  1N7Q A;  2CFK A;  1K1W A;  1SPU A;  1JZ6 A;  2WOF A;  1SO0 A;  2BRV X;  2F18 A;  3D50 A;  1NKG A;  3NBJ A;  3Q1N A;  2OQE C;  1D6Y A;  3HI7 A;  3BS6 A;  1QWU A;  1NSS A;  2CIS A;  3SX1 A;  1K1X A;  2WDA A;  4KFD A;  1HN1 A;  3DX1 A;  3QFZ A;  1N7O A;  3AMO A;  3DYP A;  1ULV A;  4BTX A;  2CIR A;  1IVU A;  1TU5 A;  4K3A A;  1MMZ A;  2EAB A;  3W7T A;  1W5Z A;  1QWN A;  4FNV A;  3X42 A;  3WFA A;  3AMO B;  1LXM A;  2FYV A;  1NSM A;  3K5T A;  1HMW A;  3BUB A;  3VSM A;  3T2P A;  1KSI A;  1A2V A;  3DX3 A;  3KN4 A;  4FNP A;  3D4Z A;  1OAC A;  3ACS A;  1EKM A;  4KFE A;  3BUP A;  3QFY A;  1W3Y A;  1N9E A;  1MMY A;  1JZ7 A;  3A24 A;  2WW3 A;  3EJT A;  2ALW A;  2X03 A;  3MV1 1;  1AV4 A;  2YX9 A;  4FNT A;  3SXX A;  1WMN A;  2YFO A;  3CV5 A;  3J7H A;  1F4A A;  1HMU A;  1TXK A;  5JMF A;  4FNR A;  2WZS A;  1J0N A;  3MI6 A;  1HWW A;  1X1J A;  1TQS A;  2Y74 A;  1HM2 A;  2XN2 A;  3DX2 A;  1N7R A;  3CZN A;  2EAD A;  3I3E A;  1US1 A;  3IAQ A;  4DUW A;  1JYN A;  1W7C A;  3ACT A;  3VDB A;  3DDF A;  2HTB A;  5E1Q A;  1QAL A;  3BUI A;  3ECQ A;  2E2T A;  3BUQ A;  3D52 A;  2CWV A;  3VSN A;  1MN0 A;  1JZ2 A;  3IAP A;  1K1Y A;  1JRQ A;  1QAF A;  1LUR A;  3BLB A;  3DDG A;  1RKY A;  2Q1F A;  2WVZ A;  2OQE A;  1IVX A;  1CB8 A;  2WYH A;  1V7X A;  3WA3 A;  3W7U A;  1NSV A;  1JYW A;  3MWX A;  1UG9 A;  1UI7 A;  3LOY A;  2W0Q A;  1V7W A;  1JZ4 A;  3S4B A;  2HTA A;  3DX4 A;  3S4A A;  4BZF A;  4OJZ A;  1TQV A;  2C10 A;  2FUQ A;  2XN1 A;  1NS0 A;  4KTR A;  1PS3 A;  1LVN A;  3RSY A;  3E80 A;  3QG0 A;  2CQT A;  1IVV A;  1OJO A;  3D4Y A;  2CG1 A;  4MMH A;  1HXK A;  1V7V A;  2OOV C;  1MMU A;  1NS7 A;  3EJR A; 
#chains in the Genus database with same CATH homology
 2WCO A;  3MV1 1;  3T08 A;  1JYV A;  2ZQ0 A;  5A1A A;  1C82 A;  3T0B A;  2E24 A;  2E22 A;  3J7H A;  1F4A A;  1HMU A;  1RWH A;  3T0A A;  1NSZ A;  1TXK A;  3TY1 A;  5JMF A;  1F4H A;  1L7J A;  2WVX A;  3E7J A;  3VD7 A;  2WZS A;  1NS2 A;  1J0N A;  1X1J A;  3DYO A;  3VDC A;  1RWC A;  1RWG A;  1HM2 A;  3MUZ 1;  1HM3 A;  1LXK A;  1N7R A;  4DUV A;  1I8Q A;  2JKA A;  1DP0 A;  3NJV A;  3VD4 A;  2FUT A;  3T0D A;  4BZH A;  3I3E A;  1JYX A;  3IAQ A;  2WVX B;  1NSU A;  4DUW A;  3AFL A;  3E1F 1;  1JYN A;  2CIQ A;  1RWA A;  2WW0 A;  3VDB A;  3DCD A;  1RW9 A;  2WW1 A;  3K25 A;  3NRE A;  3I3D A;  1YGA A;  3VDA A;  1PX4 A;  1N7N A;  3WVF A;  4OK2 A;  3BGA A;  1X1I A;  1N7P A;  3MUY 1;  1EGU A;  2HTB A;  4MMI A;  2BRW A;  3T09 A;  5E1Q A;  2JKE A;  1YQ2 A;  3ECQ A;  4OK4 A;  3VD9 A;  3SEP A;  1N7Q A;  3OS7 A;  1JZ3 A;  1K1W A;  4J5T A;  2WVY A;  1JZ6 A;  1SO0 A;  2BRV X;  3CZJ A;  3VSN A;  4TTG A;  1MN0 A;  1JZ2 A;  1NKG A;  5JMD A;  3IAP A;  2ZXQ A;  1K1Y A;  3Q1N A;  2BRP A;  3MV0 1;  1LUR A;  3BS6 A;  1HN0 A;  2JKP A;  4BZE A;  1JZ5 A;  1NSX A;  1NSS A;  2CIS A;  1K1X A;  2WDA A;  1F1S A;  2Q1F A;  2WVZ A;  1JOV A;  1NS4 A;  2WW2 A;  2XHN A;  1CB8 A;  1HN1 A;  3I3B A;  1MMX A;  1N7O A;  1OJN A;  3IMH A;  1JZ8 A;  1OJP A;  3T2Q A;  3DYP A;  1NSV A;  1ULV A;  3OBA A;  1JYW A;  3MWX A;  2CIR A;  1UG9 A;  1Z45 A;  4DUX A;  1LOH A;  1OJM A;  2XSG A;  3OB8 A;  1NS8 A;  1MMZ A;  3VD5 A;  1JZ4 A;  2HTA A;  2D73 A;  1RWF A;  4FNV A;  3BLC A;  3WFA A;  4BZF A;  1L7K A;  1LXM A;  1NSR A;  4OJZ A;  3A0O A;  3T2O A;  1PX3 A;  4AQ0 A;  2FUQ A;  1NSM A;  3VSM A;  1HMW A;  1NS0 A;  3T2P A;  3DEC A;  3VD3 A;  3E80 A;  1LF9 A;  3NJX A;  1SNZ A;  1J0M A;  4NEI A;  1OJO A;  1W3Y A;  4RNL A;  3DYM A;  1MMY A;  1JZ7 A;  1X1H A;  3A24 A;  2WW3 A;  1F9G A;  4MMH A;  1MMU A;  1NS7 A;  4BZG A;  1LF6 A;  2X03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...