3K25A

Crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
289
structure length
289
Chain Sequence
MYNISFTPDRPLTYHLEDDQSLARLSLVPGRGGLVTEWTVQGQPILYFDRERFQDPSLSVRGGIPILFPICGNLPQDQFNHAGKSYRLKQHGFARDLPWEVIGQQTQDNARLDLRLSHNDATLEAFPFAFELVFSYQLQGHSLRIEQRIANLGDQRMPFSLGFHPYFFCREKLGITLAIPANDYLDQKTGDCHGYDGQLNLTSPELDLAFTQISQPRAHFIDPDRNLKIEVSFSELYQTLVLWTVAGKDYLCLEPWSGPRNALNSGEQLAWVEPYSSRSAWVNFQVSTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1438 protein
publication title Northeast Structural Genomics Consortium Target SgR112
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
total genus 58
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3k25A00
1MMXA 1DP0A 1F4HA 2E22A 1MMZA 1HN0A 1NSRA 3DECA 1K1XA 1W3YA 1N7QA 2X03A 3WFAA 3IAQA 2CIQA 2D73A 1LXKA 1I8QA 1NS7A 2WVXB 3OB8A 2BRPA 3VDBA 3MWXA 3A24A 1PX4A 1LF6A 1LF9A 4DUVA 3T0DA 2CIRA 3MUZ1 1RWHA 1NSXA 3DCDA 3T09A 3VD9A 2WW1A 2Q1FA 4BZGA 3DYOA 2HTAA 1N7OA 1EGUA 1HM3A 3I3EA 4AQ0A 1JZ6A 3CZJA 1NS0A 1F4AA 4BZEA 2WZSA 2CISA 3K25A 1NS4A 1N7PA 1JYWA 3T2PA 1Z45A 2BRWA 3T0AA 4RNLA 1JZ8A 5A1AA 1JZ3A 1HMUA 1HMWA 2HTBA 3T0BA 1X1IA 1OJNA 2XHNA 1L7KA 1K1WA 2WW0A 1F9GA 1HM2A 5E1QA 1N7RA 1F1SA 1RWCA 3OS7A 1HN1A 4TTGA 1L7JA 4BZFA 1RW9A 3VD4A 3NREA 1OJOA 3E1F1 3SEPA 1MMYA 1LURA 2ZQ0A 1NSSA 2WCOA 1K1YA 1N7NA 2BRVX 1RWGA 3NJXA 3T2QA 1NSVA 2E24A 1SNZA 1JYVA 1YQ2A 3MV11 1NSMA 2WW3A 3VD7A 4BZHA 2ZXQA 2WW2A 4DUWA 3VD5A 1CB8A 3DYPA 1NS2A 1NSUA 3T2OA 1LOHA 2XSGA 3I3BA 4DUXA 1NS8A 2JKPA 1JZ2A 3BGAA 3Q1NA 1JYNA 1SO0A 1MN0A 1C82A 3T08A 1UG9A 1JZ4A 3DYMA 1LXMA 3MUY1 1JYXA 3NJVA 3J7HA 1JOVA 3OBAA 1RWAA 1OJPA 3IMHA 3VD3A 1OJMA 1ULVA 1NKGA 1PX3A 1X1JA 3MV01 1J0MA 1MMUA 1NSZA 3ECQA 1X1HA 2JKEA 1TXKA 1YGAA 3IAPA 3I3DA 1JZ7A 1RWFA 2WDAA 1J0NA 2JKAA 3VDCA 1JZ5A 3VDAA 2WVXA 2WVYA 2WVZA
chains in the Genus database with same CATH superfamily
4KFDA 1IQYA 1W7CA 1NSRA 1W3YA 3S4BA 2F1AA 3HIIA 2X03A 3WFAA 1W2ZA 1H54A 3W7SA 3CZNA 1IQXA 1LXKA 2WVXB 4FNVA 3VDBA 3BLBA 3W7XA 2CIRA 4KFEA 2WOFA 1NSXA 1SIIA 2WW1A 4BZGA 3MI6A 3EJPA 1HM3A 3I3EA 1D6UA 4AQ0A 1DYUA 2WOHA 1V7XA 3NBBA 2F1BA 2PNCA 3DX4A 4UFCA 4BTWA 1R34A 4FNSA 3DDGA 3T2PA 1HWWA 1JZ8A 2D1WA 3D4YA 1W5ZA 1HMUA 3ACTA 1O7DD 3T0BA 2XHNA 1L7KA 2XN0A 2CWTA 1F9GA 5E1QA 2WYIA 1AVLA 3OS7A 1PU4A 1UI7A 1L7JA 1HXKA 3NREA 1OJOA 3W7TA 3EJQA 1TQWA 3K5TA 1TQUA 1NSVA 1N9EA 1QX1A 1NSMA 3S4CA 1AV4A 1TQVA 1V7VA 1IVWA 3DYPA 3X3ZA 1NSUA 3BGAA 1JYNA 3T08A 4K3AA 3DX3A 1LXMA 3BVXA 1JOVA 3OBAA 1ULVA 3MPHA 1TXKA 1QWNA 1YGAA 2E2UA 3I3DA 2CFDA 2WDAA 2OQEC 3BUIA 2FUTA 1QAFA 2WVZA 2W0QA 4BTYA 1K1XA 4KTPA 2E2VA 2F7OA 3CZSA 1I8QA 1IVXA 3D4ZA 3EJUA 3OB8A 1EKMA 2XN1A 4FNQA 1PX4A 1LF9A 4DUVA 3X3XA 1RWHA 1OACA 2YFOA 2HTAA 3D50A 1A2VA 3CV5A 1JZ6A 4MMHA 2WZSA 2CISA 3BLCA 3K25A 1NS4A 4EV5A 3EJSA 5A1AA 3AMOB 4OJZA 3WIRA 3DX2A 1X1IA 2WW0A 3KN4A 1N7RA 1V7WA 3SEPA 1MMYA 3AMOA 3LOYA 2WCOA 1K1YA 1N7NA 2F7PA 1WMPA 1QALA 1W6CA 3W7UA 1TQTA 1YQ2A 4FNUA 3VSMA 3A0OA 1CB8A 3D51A 3E7JA 4J5TA 3I3BA 3AFLA 3QFZA 3AFJA 2F7QA 1MN0A 3BVTA 1JYXA 3NJVA 2F18A 3D52A 2C10A 3VD3A 3BUBA 1PX3A 3MV01 1MMUA 3HIGA 2FYVA 2OQEA 3WIQA 1X1HA 2JKEA 3IAPA 4K35A 3VSNA 2OW7A 1JZ7A 3QG0A 5JMFA 1AVKA 3X41A 1J0NA 1JZ5A 3VDAA 1HTYA 2F7RA 2WVYA 3T0UA 4NEIA 3DX0A 3X42A 1MMXA 1DP0A 1MMZA 4BTXA 3WA3A 2CG1A 2YFNA 1N7QA 2C11A 1NS7A 2BRPA 2Y73A 3A24A 2CWUA 1LF6A 3MUZ1 3EJRA 1JRQA 2Q1FA 3BUDA 1EGUA 3SXXA 2CWVA 1NS0A 1F4AA 3PGBA 1WMNA 1IU7A 1N7PA 1RKYA 1Z45A 2BRWA 2Y74A 3T0AA 1WMOA 3QFYA 2HTBA 1OJNA 3ALAA 1F1SA 1RWCA 1TQSA 4BZFA 3VD4A 4FNRA 3E1F1 2YX9A 3HI7A 1NSSA 2BRVX 1RWGA 3NJXA 3T2QA 3DX1A 1PS3A 3NBJA 1SNZA 3BS6A 3BUQA 3X40A 4EV2A 3BVUA 3TY1A 3MV11 3VD7A 4BZHA 3QDEA 2WW2A 4DUWA 4MMIA 3VD5A 1NS2A 1LOHA 2XSGA 1NS8A 2JKPA 2OW6A 3EJTA 1SO0A 1C82A 3DDFA 3BVVA 1UG9A 3DYMA 3MUY1 3RSYA 3J7HA 1QWUA 2FUQA 3IMHA 1OJPA 1OJMA 1NKGA 2ZL8A 2EADA 1J0MA 1RJOA 5KBPA 3ACSA 2XN2A 2EAEA 2JKAA 3WVFA 2WVXA 3BUPA 3S4DA 2EABA 1F4HA 2E22A 1HN0A 1W6GA 1UI8A 2CFKA 3DECA 3N9HA 3X3YA 3KIIA 1TU5A 2CQSA 3IAQA 2CIQA 2D73A 1US1A 2CFLA 3D3IA 3SX1A 1IVUA 3MWXA 1D6ZA 3T0DA 3DCDA 3VD9A 2CFGA 3DYOA 1N7OA 2ALWA 4KFFA 3W7WA 2RDYA 3CZJA 3BVWA 4BZEA 4FNTA 5CA3A 1JYWA 3RRSA 4RNLA 1JZ3A 1D6YA 2CFWA 1HMWA 1K1WA 1HM2A 1HN1A 4TTGA 2CQTA 1LVNA 1RW9A 4KTRA 1LURA 2ZQ0A 2EACA 3E80A 2E24A 1JYVA 2OOVA 3S4AA 1SIHA 1IVVA 2WW3A 2WO0A 2ZXQA 1KSIA 1R33A 3LVTA 1W4NA 3T2OA 2E2TA 4DUXA 1JZ2A 3Q1NA 2WGQA 5GW7A 4OK4A 1JZ4A 4OK2A 1RWAA 1QAKA 1SPUA 1X1JA 1NSZA 3ECQA 2WYHA 3WA2X 1RWFA 2BT3A 2OOVC 2CG0A 3VDCA 3T09A 4FNPA 5JMDA
chains in the Genus database with same CATH topology
1MMXA 1DP0A 1F4HA 2E22A 1MMZA 1HN0A 1NSRA 3DECA 1K1XA 1W3YA 1N7QA 2X03A 3WFAA 3IAQA 2CIQA 2D73A 1LXKA 1I8QA 1NS7A 2WVXB 4FNVA 3OB8A 2BRPA 3VDBA 3MWXA 3A24A 1PX4A 1LF6A 1LF9A 4DUVA 3T0DA 2CIRA 3MUZ1 1RWHA 1NSXA 3DCDA 3T09A 3VD9A 2WW1A 2Q1FA 4BZGA 3DYOA 2HTAA 1N7OA 1EGUA 1HM3A 3I3EA 4AQ0A 1JZ6A 4MMHA 3CZJA 1NS0A 1F4AA 4BZEA 2WZSA 2CISA 3BLCA 3K25A 1NS4A 1N7PA 1JYWA 3T2PA 1Z45A 2BRWA 3T0AA 4RNLA 1JZ8A 5A1AA 1JZ3A 1HMUA 4OJZA 1HMWA 2HTBA 3T0BA 1X1IA 1OJNA 2XHNA 1L7KA 1K1WA 2WW0A 1F9GA 1HM2A 5E1QA 1N7RA 1F1SA 1RWCA 3OS7A 1HN1A 4TTGA 1L7JA 4BZFA 1RW9A 3VD4A 3NREA 1OJOA 3E1F1 3SEPA 1MMYA 1LURA 2ZQ0A 1NSSA 2WCOA 1K1YA 1N7NA 3E80A 2BRVX 1RWGA 3NJXA 3T2QA 1NSVA 2E24A 1SNZA 3BS6A 1JYVA 3TY1A 1YQ2A 3MV11 1NSMA 2WW3A 3VD7A 4BZHA 3VSMA 2ZXQA 2WW2A 3A0OA 4DUWA 4MMIA 3VD5A 1CB8A 3DYPA 1NS2A 3E7JA 1NSUA 3T2OA 4J5TA 1LOHA 2XSGA 3I3BA 4DUXA 1NS8A 2JKPA 3AFLA 1JZ2A 3BGAA 3Q1NA 1JYNA 1SO0A 1MN0A 1C82A 4OK4A 1UG9A 3T08A 1JZ4A 3DYMA 1LXMA 3MUY1 1JYXA 3NJVA 4OK2A 3J7HA 1JOVA 2FUQA 3OBAA 1RWAA 1OJPA 3IMHA 3VD3A 1OJMA 1ULVA 1NKGA 1PX3A 1X1JA 3MV01 1J0MA 1MMUA 1NSZA 3ECQA 1X1HA 2JKEA 1TXKA 1YGAA 3IAPA 3VSNA 3I3DA 1JZ7A 1RWFA 5JMFA 2WDAA 1J0NA 2JKAA 3VDCA 3WVFA 3VDAA 2FUTA 1JZ5A 2WVXA 2WVYA 4NEIA 5JMDA 2WVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMX A;  1DP0 A;  1F4H A;  2E22 A;  1MMZ A;  1HN0 A;  1NSR A;  3DEC A;  1K1X A;  1W3Y A;  1N7Q A;  2X03 A;  3WFA A;  3IAQ A;  2CIQ A;  2D73 A;  1LXK A;  1I8Q A;  1NS7 A;  2WVX B;  3OB8 A;  2BRP A;  3VDB A;  3MWX A;  3A24 A;  1PX4 A;  1LF6 A;  1LF9 A;  4DUV A;  3T0D A;  2CIR A;  3MUZ 1;  1RWH A;  1NSX A;  3DCD A;  3T09 A;  3VD9 A;  2WW1 A;  2Q1F A;  4BZG A;  3DYO A;  2HTA A;  1N7O A;  1EGU A;  1HM3 A;  3I3E A;  4AQ0 A;  1JZ6 A;  3CZJ A;  1NS0 A;  1F4A A;  4BZE A;  2WZS A;  2CIS A;  3K25 A;  1NS4 A;  1N7P A;  1JYW A;  3T2P A;  1Z45 A;  2BRW A;  3T0A A;  4RNL A;  1JZ8 A;  5A1A A;  1JZ3 A;  1HMU A;  1HMW A;  2HTB A;  3T0B A;  1X1I A;  1OJN A;  2XHN A;  1L7K A;  1K1W A;  2WW0 A;  1F9G A;  1HM2 A;  5E1Q A;  1N7R A;  1F1S A;  1RWC A;  3OS7 A;  1HN1 A;  4TTG A;  1L7J A;  4BZF A;  1RW9 A;  3VD4 A;  3NRE A;  1OJO A;  3E1F 1;  3SEP A;  1MMY A;  1LUR A;  2ZQ0 A;  1NSS A;  2WCO A;  1K1Y A;  1N7N A;  2BRV X;  1RWG A;  3NJX A;  3T2Q A;  1NSV A;  2E24 A;  1SNZ A;  1JYV A;  1YQ2 A;  3MV1 1;  1NSM A;  2WW3 A;  3VD7 A;  4BZH A;  2ZXQ A;  2WW2 A;  4DUW A;  3VD5 A;  1CB8 A;  3DYP A;  1NS2 A;  1NSU A;  3T2O A;  1LOH A;  2XSG A;  3I3B A;  4DUX A;  1NS8 A;  2JKP A;  1JZ2 A;  3BGA A;  3Q1N A;  1JYN A;  1SO0 A;  1MN0 A;  1C82 A;  3T08 A;  1UG9 A;  1JZ4 A;  3DYM A;  1LXM A;  3MUY 1;  1JYX A;  3NJV A;  3J7H A;  1JOV A;  3OBA A;  1RWA A;  1OJP A;  3IMH A;  3VD3 A;  1OJM A;  1ULV A;  1NKG A;  1PX3 A;  1X1J A;  3MV0 1;  1J0M A;  1MMU A;  1NSZ A;  3ECQ A;  1X1H A;  2JKE A;  1TXK A;  1YGA A;  3IAP A;  3I3D A;  1JZ7 A;  1RWF A;  2WDA A;  1J0N A;  2JKA A;  3VDC A;  1JZ5 A;  3VDA A;  2WVX A;  2WVY A;  2WVZ A; 
#chains in the Genus database with same CATH topology
 4KFD A;  1IQY A;  1W7C A;  1NSR A;  1W3Y A;  3S4B A;  2F1A A;  3HII A;  2X03 A;  3WFA A;  1W2Z A;  1H54 A;  3W7S A;  3CZN A;  1IQX A;  1LXK A;  2WVX B;  4FNV A;  3VDB A;  3BLB A;  3W7X A;  2CIR A;  4KFE A;  2WOF A;  1NSX A;  1SII A;  2WW1 A;  4BZG A;  3MI6 A;  3EJP A;  1HM3 A;  3I3E A;  1D6U A;  4AQ0 A;  1DYU A;  2WOH A;  1V7X A;  3NBB A;  2F1B A;  2PNC A;  3DX4 A;  4UFC A;  4BTW A;  1R34 A;  4FNS A;  3DDG A;  3T2P A;  1HWW A;  1JZ8 A;  2D1W A;  3D4Y A;  1W5Z A;  1HMU A;  3ACT A;  1O7D D;  3T0B A;  2XHN A;  1L7K A;  2XN0 A;  2CWT A;  1F9G A;  5E1Q A;  2WYI A;  1AVL A;  3OS7 A;  1PU4 A;  1UI7 A;  1L7J A;  1HXK A;  3NRE A;  1OJO A;  3W7T A;  3EJQ A;  1TQW A;  3K5T A;  1TQU A;  1NSV A;  1N9E A;  1QX1 A;  1NSM A;  3S4C A;  1AV4 A;  1TQV A;  1V7V A;  1IVW A;  3DYP A;  3X3Z A;  1NSU A;  3BGA A;  1JYN A;  3T08 A;  4K3A A;  3DX3 A;  1LXM A;  3BVX A;  1JOV A;  3OBA A;  1ULV A;  3MPH A;  1TXK A;  1QWN A;  1YGA A;  2E2U A;  3I3D A;  2CFD A;  2WDA A;  2OQE C;  3BUI A;  2FUT A;  1QAF A;  2WVZ A;  2W0Q A;  4BTY A;  1K1X A;  4KTP A;  2E2V A;  2F7O A;  3CZS A;  1I8Q A;  1IVX A;  3D4Z A;  3EJU A;  3OB8 A;  1EKM A;  2XN1 A;  4FNQ A;  1PX4 A;  1LF9 A;  4DUV A;  3X3X A;  1RWH A;  1OAC A;  2YFO A;  2HTA A;  3D50 A;  1A2V A;  3CV5 A;  1JZ6 A;  4MMH A;  2WZS A;  2CIS A;  3BLC A;  3K25 A;  1NS4 A;  4EV5 A;  3EJS A;  5A1A A;  3AMO B;  4OJZ A;  3WIR A;  3DX2 A;  1X1I A;  2WW0 A;  3KN4 A;  1N7R A;  1V7W A;  3SEP A;  1MMY A;  3AMO A;  3LOY A;  2WCO A;  1K1Y A;  1N7N A;  2F7P A;  1WMP A;  1QAL A;  1W6C A;  3W7U A;  1TQT A;  1YQ2 A;  4FNU A;  3VSM A;  3A0O A;  1CB8 A;  3D51 A;  3E7J A;  4J5T A;  3I3B A;  3AFL A;  3QFZ A;  3AFJ A;  2F7Q A;  1MN0 A;  3BVT A;  1JYX A;  3NJV A;  2F18 A;  3D52 A;  2C10 A;  3VD3 A;  3BUB A;  1PX3 A;  3MV0 1;  1MMU A;  3HIG A;  2FYV A;  2OQE A;  3WIQ A;  1X1H A;  2JKE A;  3IAP A;  4K35 A;  3VSN A;  2OW7 A;  1JZ7 A;  3QG0 A;  5JMF A;  1AVK A;  3X41 A;  1J0N A;  1JZ5 A;  3VDA A;  1HTY A;  2F7R A;  2WVY A;  3T0U A;  4NEI A;  3DX0 A;  3X42 A;  1MMX A;  1DP0 A;  1MMZ A;  4BTX A;  3WA3 A;  2CG1 A;  2YFN A;  1N7Q A;  2C11 A;  1NS7 A;  2BRP A;  2Y73 A;  3A24 A;  2CWU A;  1LF6 A;  3MUZ 1;  3EJR A;  1JRQ A;  2Q1F A;  3BUD A;  1EGU A;  3SXX A;  2CWV A;  1NS0 A;  1F4A A;  3PGB A;  1WMN A;  1IU7 A;  1N7P A;  1RKY A;  1Z45 A;  2BRW A;  2Y74 A;  3T0A A;  1WMO A;  3QFY A;  2HTB A;  1OJN A;  3ALA A;  1F1S A;  1RWC A;  1TQS A;  4BZF A;  3VD4 A;  4FNR A;  3E1F 1;  2YX9 A;  3HI7 A;  1NSS A;  2BRV X;  1RWG A;  3NJX A;  3T2Q A;  3DX1 A;  1PS3 A;  3NBJ A;  1SNZ A;  3BS6 A;  3BUQ A;  3X40 A;  4EV2 A;  3BVU A;  3TY1 A;  3MV1 1;  3VD7 A;  4BZH A;  3QDE A;  2WW2 A;  4DUW A;  4MMI A;  3VD5 A;  1NS2 A;  1LOH A;  2XSG A;  1NS8 A;  2JKP A;  2OW6 A;  3EJT A;  1SO0 A;  1C82 A;  3DDF A;  3BVV A;  1UG9 A;  3DYM A;  3MUY 1;  3RSY A;  3J7H A;  1QWU A;  2FUQ A;  3IMH A;  1OJP A;  1OJM A;  1NKG A;  2ZL8 A;  2EAD A;  1J0M A;  1RJO A;  5KBP A;  3ACS A;  2XN2 A;  2EAE A;  2JKA A;  3WVF A;  2WVX A;  3BUP A;  3S4D A;  2EAB A;  1F4H A;  2E22 A;  1HN0 A;  1W6G A;  1UI8 A;  2CFK A;  3DEC A;  3N9H A;  3X3Y A;  3KII A;  1TU5 A;  2CQS A;  3IAQ A;  2CIQ A;  2D73 A;  1US1 A;  2CFL A;  3D3I A;  3SX1 A;  1IVU A;  3MWX A;  1D6Z A;  3T0D A;  3DCD A;  3VD9 A;  2CFG A;  3DYO A;  1N7O A;  2ALW A;  4KFF A;  3W7W A;  2RDY A;  3CZJ A;  3BVW A;  4BZE A;  4FNT A;  5CA3 A;  1JYW A;  3RRS A;  4RNL A;  1JZ3 A;  1D6Y A;  2CFW A;  1HMW A;  1K1W A;  1HM2 A;  1HN1 A;  4TTG A;  2CQT A;  1LVN A;  1RW9 A;  4KTR A;  1LUR A;  2ZQ0 A;  2EAC A;  3E80 A;  2E24 A;  1JYV A;  2OOV A;  3S4A A;  1SIH A;  1IVV A;  2WW3 A;  2WO0 A;  2ZXQ A;  1KSI A;  1R33 A;  3LVT A;  1W4N A;  3T2O A;  2E2T A;  4DUX A;  1JZ2 A;  3Q1N A;  2WGQ A;  5GW7 A;  4OK4 A;  1JZ4 A;  4OK2 A;  1RWA A;  1QAK A;  1SPU A;  1X1J A;  1NSZ A;  3ECQ A;  2WYH A;  3WA2 X;  1RWF A;  2BT3 A;  2OOV C;  2CG0 A;  3VDC A;  3T09 A;  4FNP A;  5JMD A; 
#chains in the Genus database with same CATH homology
 1MMX A;  1DP0 A;  1F4H A;  2E22 A;  1MMZ A;  1HN0 A;  1NSR A;  3DEC A;  1K1X A;  1W3Y A;  1N7Q A;  2X03 A;  3WFA A;  3IAQ A;  2CIQ A;  2D73 A;  1LXK A;  1I8Q A;  1NS7 A;  2WVX B;  4FNV A;  3OB8 A;  2BRP A;  3VDB A;  3MWX A;  3A24 A;  1PX4 A;  1LF6 A;  1LF9 A;  4DUV A;  3T0D A;  2CIR A;  3MUZ 1;  1RWH A;  1NSX A;  3DCD A;  3T09 A;  3VD9 A;  2WW1 A;  2Q1F A;  4BZG A;  3DYO A;  2HTA A;  1N7O A;  1EGU A;  1HM3 A;  3I3E A;  4AQ0 A;  1JZ6 A;  4MMH A;  3CZJ A;  1NS0 A;  1F4A A;  4BZE A;  2WZS A;  2CIS A;  3BLC A;  3K25 A;  1NS4 A;  1N7P A;  1JYW A;  3T2P A;  1Z45 A;  2BRW A;  3T0A A;  4RNL A;  1JZ8 A;  5A1A A;  1JZ3 A;  1HMU A;  4OJZ A;  1HMW A;  2HTB A;  3T0B A;  1X1I A;  1OJN A;  2XHN A;  1L7K A;  1K1W A;  2WW0 A;  1F9G A;  1HM2 A;  5E1Q A;  1N7R A;  1F1S A;  1RWC A;  3OS7 A;  1HN1 A;  4TTG A;  1L7J A;  4BZF A;  1RW9 A;  3VD4 A;  3NRE A;  1OJO A;  3E1F 1;  3SEP A;  1MMY A;  1LUR A;  2ZQ0 A;  1NSS A;  2WCO A;  1K1Y A;  1N7N A;  3E80 A;  2BRV X;  1RWG A;  3NJX A;  3T2Q A;  1NSV A;  2E24 A;  1SNZ A;  3BS6 A;  1JYV A;  3TY1 A;  1YQ2 A;  3MV1 1;  1NSM A;  2WW3 A;  3VD7 A;  4BZH A;  3VSM A;  2ZXQ A;  2WW2 A;  3A0O A;  4DUW A;  4MMI A;  3VD5 A;  1CB8 A;  3DYP A;  1NS2 A;  3E7J A;  1NSU A;  3T2O A;  4J5T A;  1LOH A;  2XSG A;  3I3B A;  4DUX A;  1NS8 A;  2JKP A;  3AFL A;  1JZ2 A;  3BGA A;  3Q1N A;  1JYN A;  1SO0 A;  1MN0 A;  1C82 A;  4OK4 A;  1UG9 A;  3T08 A;  1JZ4 A;  3DYM A;  1LXM A;  3MUY 1;  1JYX A;  3NJV A;  4OK2 A;  3J7H A;  1JOV A;  2FUQ A;  3OBA A;  1RWA A;  1OJP A;  3IMH A;  3VD3 A;  1OJM A;  1ULV A;  1NKG A;  1PX3 A;  1X1J A;  3MV0 1;  1J0M A;  1MMU A;  1NSZ A;  3ECQ A;  1X1H A;  2JKE A;  1TXK A;  1YGA A;  3IAP A;  3VSN A;  3I3D A;  1JZ7 A;  1RWF A;  5JMF A;  2WDA A;  1J0N A;  2JKA A;  3VDC A;  3WVF A;  3VDA A;  2FUT A;  1JZ5 A;  2WVX A;  2WVY A;  4NEI A;  5JMD A;  2WVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...