1L7KA

X-ray structure of galactose mutarotase from lactococcus lactis complexed with galactose
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galactose mutarotase
publication title High resolution X-ray structure of galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 95
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1l7kA00
1NS4A 1RWHA 3Q1NA 1F4AA 1K1YA 3VDCA 3VD7A 1F9GA 3I3BA 3OS7A 2D73A 2X03A 1JOVA 1LOHA 1HN1A 1MMXA 1X1HA 1N7RA 2WVYA 1JZ7A 1LF9A 3DYMA 3DECA 3T2OA 2WW2A 3WFAA 2Q1FA 1JZ2A 1NSVA 2WW3A 1MMYA 1C82A 1NKGA 1MMZA 3MUY1 3T09A 3T0AA 4BZFA 1RWAA 3CZJA 2WDAA 3IAPA 3VD3A 3VD5A 1HM2A 1OJMA 3I3DA 4BZHA 1NS2A 3VDBA 2E24A 3NREA 3T0DA 2CISA 3K25A 3IMHA 1HM3A 3SEPA 3VDAA 1JYVA 3E1F1 1I8QA 2XSGA 1F1SA 1HMWA 2XHNA 1RW9A 1Z45A 1TXKA 2BRVX 2WVZA 3DYOA 4BZGA 1MN0A 5A1AA 3A24A 1OJNA 3I3EA 3DCDA 4TTGA 1NS0A 1SNZA 3ECQA 1NSSA 2ZQ0A 3NJXA 1OJPA 1X1IA 1NSUA 3OBAA 1JZ6A 2E22A 1L7KA 2WW1A 2HTBA 3MUZ1 1NSZA 3T08A 1JZ5A 1JYWA 1NSXA 1JZ4A 1PX4A 1F4HA 2BRPA 1ULVA 1N7QA 1N7OA 2WW0A 1JYNA 1NSRA 1UG9A 1YQ2A 3MWXA 3T2PA 2WZSA 1SO0A 4DUVA 1LURA 1NSMA 1L7JA 1J0MA 4DUWA 4DUXA 1N7NA 2ZXQA 3T0BA 1RWCA 5E1QA 1RWFA 2WVXB 3MV11 1YGAA 1JZ3A 2CIQA 2JKPA 2WCOA 2HTAA 3T2QA 3VD4A 1X1JA 3OB8A 1PX3A 1LXKA 1W3YA 1K1WA 3BGAA 1HMUA 4BZEA 3VD9A 4AQ0A 1NS8A 1OJOA 3MV01 3DYPA 3NJVA 1EGUA 1JZ8A 1JYXA 2BRWA 1DP0A 1N7PA 1RWGA 1MMUA 1LF6A 1NS7A 2JKAA 1HN0A 1LXMA 3J7HA 1J0NA 2JKEA 2WVXA 4RNLA 2CIRA 1K1XA 3IAQA 1CB8A
chains in the Genus database with same CATH superfamily
1NS4A 1RWHA 1K1YA 3DX1A 3WIRA 4FNVA 1JRQA 1IVXA 1JOVA 1DYUA 1WMNA 3A0OA 1N7RA 2OW7A 2OOVA 1UI8A 3DECA 2CFDA 3X3ZA 3DDFA 2Q1FA 1HXKA 3BUDA 1NKGA 3W7SA 1R34A 4K35A 3T0AA 3CZJA 3VD5A 1HM2A 3WIQA 4KTRA 3VDBA 2OQEC 3HIGA 3T0DA 3IMHA 2XHNA 2EACA 1RW9A 1TXKA 4BZGA 1SIHA 1OJNA 4FNQA 1SIIA 3DCDA 1IVWA 2F7QA 3QDEA 1JZ6A 3QFZA 2WW1A 1JYWA 3N9HA 1TQUA 2CQTA 3PGBA 1A2VA 4J5TA 1NSRA 1UG9A 4MMIA 2EABA 2YFNA 2WZSA 1SO0A 3BVTA 3HI7A 1LURA 1NSMA 1L7JA 4DUWA 4DUXA 1PS3A 2ZXQA 3X42A 4KTPA 3QG0A 1YGAA 3DX4A 3BUBA 3T2QA 3ACSA 2HTAA 3VD4A 1RKYA 1LXKA 3AMOA 1QAKA 1W4NA 3VD9A 3D4ZA 1OJOA 4OK4A 5GW7A 2F7RA 3K5TA 4K3AA 1TQWA 1TQVA 1N7PA 1LF6A 2JKAA 3EJPA 1J0NA 2JKEA 1K1XA 3IAQA 1TQSA 3Q1NA 3W7TA 1F4AA 3W7XA 3HIIA 2XN1A 1W6GA 1HWWA 3CZNA 1R33A 2WVYA 2CWUA 3BLBA 1LF9A 1H54A 1TQTA 3WA3A 3KIIA 3BLCA 1V7XA 1TU5A 1O7DD 3D51A 2WDAA 3IAPA 4FNPA 3NBBA 3K25A 1HM3A 3SEPA 1V7WA 2XSGA 1AVLA 4MMHA 2E2TA 1Z45A 3DYOA 3I3EA 1US1A 1SNZA 1KSIA 1NSSA 2ZQ0A 3NJXA 1OJPA 3DDGA 1IQXA 4FNTA 2BT3A 2E22A 2ZL8A 3T08A 3MUZ1 1NSZA 1JZ5A 4KFEA 1NSXA 3X3XA 1PX4A 1IVUA 1F4HA 1AV4A 1N7QA 1V7VA 1W5ZA 1YQ2A 1QAFA 3VSMA 3S4CA 3MI6A 1AVKA 3QFYA 1RWCA 1RWFA 2WOHA 3DX0A 2CIQA 2CFKA 1X1JA 2EAEA 3NBJA 4KFFA 3CZSA 1K1WA 3TY1A 3EJRA 1NS8A 3SXXA 2CFGA 3RRSA 1EGUA 2CG0A 1JZ8A 1RWGA 3EJQA 1NS7A 1RJOA 2FYVA 1LXMA 3J7HA 2W0QA 3E80A 2CIRA 3DX2A 2F7PA 1QWUA 3VDCA 5CA3A 3VD7A 1F9GA 2E2UA 3AFJA 2WYHA 4FNUA 1UI7A 2D73A 2X03A 1EKMA 1LOHA 1X1HA 2EADA 5JMDA 2CWTA 2CWVA 1JZ7A 2WW2A 3BUQA 1LVNA 2ALWA 3WA2X 1C82A 3D4YA 3T09A 4BZFA 1RWAA 2RDYA 1OACA 3VD3A 1OJMA 2F1AA 1NS2A 1IU7A 2E24A 3BVWA 3NREA 3D52A 2CISA 4BTWA 2OW6A 2F7OA 1I8QA 1N9EA 1HMWA 3S4BA 2WVZA 3X3YA 5A1AA 3W7WA 3A24A 1SPUA 3ECQA 1NSUA 4KFDA 1L7KA 1IVVA 3LVTA 2HTBA 3WVFA 2F18A 2OQEA 4FNSA 2BRPA 2D1WA 2WW0A 1JYNA 1D6UA 3T2PA 2CQSA 5KBPA 1N7NA 3T0BA 3D3IA 5E1QA 2WVXB 2F1BA 3RSYA 3BVVA 4NEIA 2PNCA 1JZ3A 3EJUA 2E2VA 3BGAA 2XN2A 1D6ZA 1HMUA 3KN4A 4BZEA 5JMFA 1WMOA 3MV01 3DYPA 2C11A 1JYXA 1PU4A 1W7CA 1D6YA 1WMPA 1HN0A 2YX9A 2Y74A 1CB8A 3LOYA 1QX1A 2FUTA 3BVXA 3I3BA 3EJTA 3OS7A 2WGQA 3S4DA 1HN1A 1MMXA 2OOVC 3DYMA 3T2OA 3BVUA 1QWNA 3WFAA 1JZ2A 1NSVA 2WW3A 4OK2A 1MMYA 4FNRA 2CG1A 1MMZA 3MUY1 3ACTA 4BTYA 3I3DA 4BZHA 4EV5A 2XN0A 3VDAA 1JYVA 3E1F1 1HTYA 1F1SA 3AFLA 3MPHA 2BRVX 3X40A 2WYIA 3VSNA 1MN0A 1IQYA 3E7JA 2CFLA 4TTGA 1NS0A 2YFOA 3BUIA 1X1IA 4EV2A 3OBAA 3X41A 3D50A 2FUQA 3AMOB 3S4AA 2Y73A 3EJSA 1JZ4A 1ULVA 3ALAA 1N7OA 4UFCA 3MWXA 4DUVA 4BTXA 3BS6A 1J0MA 2WO0A 3CV5A 1QALA 3MV11 3W7UA 1W2ZA 2JKPA 2WCOA 3BUPA 2WOFA 3OB8A 1PX3A 1W3YA 4AQ0A 3NJVA 4OJZA 2BRWA 1DP0A 3SX1A 3DX3A 1MMUA 2CFWA 3T0UA 2C10A 2WVXA 4RNLA 1W6CA
chains in the Genus database with same CATH topology
1NS4A 1RWHA 3Q1NA 1F4AA 1K1YA 2FUTA 3VDCA 3VD7A 1F9GA 3I3BA 4FNVA 3OS7A 2D73A 2X03A 1JOVA 1LOHA 1HN1A 1MMXA 1X1HA 3A0OA 1N7RA 5JMDA 2WVYA 1JZ7A 1LF9A 3DYMA 3DECA 3T2OA 2WW2A 3WFAA 2Q1FA 1JZ2A 1NSVA 2WW3A 3BLCA 4OK2A 1MMYA 1C82A 1NKGA 1MMZA 3MUY1 3T09A 3T0AA 4BZFA 1RWAA 3CZJA 2WDAA 3IAPA 3VD3A 3VD5A 1HM2A 1OJMA 3I3DA 4BZHA 1NS2A 3VDBA 2E24A 3NREA 3T0DA 2CISA 3K25A 3IMHA 1HM3A 3SEPA 3VDAA 1JYVA 3E1F1 1I8QA 2XSGA 1F1SA 1HMWA 3AFLA 4MMHA 2XHNA 1RW9A 1Z45A 1TXKA 2BRVX 2WVZA 3DYOA 3VSNA 4BZGA 1MN0A 5A1AA 3E7JA 3A24A 1OJNA 3I3EA 3DCDA 4TTGA 1NS0A 1SNZA 3ECQA 1NSSA 2ZQ0A 3NJXA 1OJPA 1X1IA 1NSUA 3OBAA 1JZ6A 2E22A 1L7KA 2FUQA 2WW1A 2HTBA 3MUZ1 1NSZA 3T08A 3WVFA 1JZ5A 1JYWA 1NSXA 1JZ4A 1PX4A 1F4HA 2BRPA 1ULVA 1N7QA 1N7OA 2WW0A 4J5TA 1JYNA 1NSRA 1UG9A 4MMIA 1YQ2A 3MWXA 3T2PA 2WZSA 1SO0A 3VSMA 4DUVA 1LURA 3BS6A 1NSMA 1L7JA 1J0MA 4DUWA 4DUXA 1N7NA 2ZXQA 3T0BA 1RWCA 5E1QA 1RWFA 2WVXB 4NEIA 3MV11 1YGAA 1JZ3A 2CIQA 2JKPA 2WCOA 2HTAA 3T2QA 3VD4A 1X1JA 3OB8A 1PX3A 1LXKA 1W3YA 1K1WA 3BGAA 3TY1A 1HMUA 5JMFA 4BZEA 3VD9A 4AQ0A 1NS8A 1OJOA 4OK4A 3MV01 3DYPA 3NJVA 1EGUA 1JZ8A 1JYXA 4OJZA 2BRWA 1DP0A 1N7PA 1RWGA 1MMUA 1LF6A 1NS7A 2JKAA 1HN0A 1LXMA 3J7HA 1J0NA 2JKEA 3E80A 2WVXA 4RNLA 2CIRA 1K1XA 3IAQA 1CB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NS4 A;  1RWH A;  3Q1N A;  1F4A A;  1K1Y A;  3VDC A;  3VD7 A;  1F9G A;  3I3B A;  3OS7 A;  2D73 A;  2X03 A;  1JOV A;  1LOH A;  1HN1 A;  1MMX A;  1X1H A;  1N7R A;  2WVY A;  1JZ7 A;  1LF9 A;  3DYM A;  3DEC A;  3T2O A;  2WW2 A;  3WFA A;  2Q1F A;  1JZ2 A;  1NSV A;  2WW3 A;  1MMY A;  1C82 A;  1NKG A;  1MMZ A;  3MUY 1;  3T09 A;  3T0A A;  4BZF A;  1RWA A;  3CZJ A;  2WDA A;  3IAP A;  3VD3 A;  3VD5 A;  1HM2 A;  1OJM A;  3I3D A;  4BZH A;  1NS2 A;  3VDB A;  2E24 A;  3NRE A;  3T0D A;  2CIS A;  3K25 A;  3IMH A;  1HM3 A;  3SEP A;  3VDA A;  1JYV A;  3E1F 1;  1I8Q A;  2XSG A;  1F1S A;  1HMW A;  2XHN A;  1RW9 A;  1Z45 A;  1TXK A;  2BRV X;  2WVZ A;  3DYO A;  4BZG A;  1MN0 A;  5A1A A;  3A24 A;  1OJN A;  3I3E A;  3DCD A;  4TTG A;  1NS0 A;  1SNZ A;  3ECQ A;  1NSS A;  2ZQ0 A;  3NJX A;  1OJP A;  1X1I A;  1NSU A;  3OBA A;  1JZ6 A;  2E22 A;  1L7K A;  2WW1 A;  2HTB A;  3MUZ 1;  1NSZ A;  3T08 A;  1JZ5 A;  1JYW A;  1NSX A;  1JZ4 A;  1PX4 A;  1F4H A;  2BRP A;  1ULV A;  1N7Q A;  1N7O A;  2WW0 A;  1JYN A;  1NSR A;  1UG9 A;  1YQ2 A;  3MWX A;  3T2P A;  2WZS A;  1SO0 A;  4DUV A;  1LUR A;  1NSM A;  1L7J A;  1J0M A;  4DUW A;  4DUX A;  1N7N A;  2ZXQ A;  3T0B A;  1RWC A;  5E1Q A;  1RWF A;  2WVX B;  3MV1 1;  1YGA A;  1JZ3 A;  2CIQ A;  2JKP A;  2WCO A;  2HTA A;  3T2Q A;  3VD4 A;  1X1J A;  3OB8 A;  1PX3 A;  1LXK A;  1W3Y A;  1K1W A;  3BGA A;  1HMU A;  4BZE A;  3VD9 A;  4AQ0 A;  1NS8 A;  1OJO A;  3MV0 1;  3DYP A;  3NJV A;  1EGU A;  1JZ8 A;  1JYX A;  2BRW A;  1DP0 A;  1N7P A;  1RWG A;  1MMU A;  1LF6 A;  1NS7 A;  2JKA A;  1HN0 A;  1LXM A;  3J7H A;  1J0N A;  2JKE A;  2WVX A;  4RNL A;  2CIR A;  1K1X A;  3IAQ A;  1CB8 A; 
#chains in the Genus database with same CATH topology
 1NS4 A;  1RWH A;  1K1Y A;  3DX1 A;  3WIR A;  4FNV A;  1JRQ A;  1IVX A;  1JOV A;  1DYU A;  1WMN A;  3A0O A;  1N7R A;  2OW7 A;  2OOV A;  1UI8 A;  3DEC A;  2CFD A;  3X3Z A;  3DDF A;  2Q1F A;  1HXK A;  3BUD A;  1NKG A;  3W7S A;  1R34 A;  4K35 A;  3T0A A;  3CZJ A;  3VD5 A;  1HM2 A;  3WIQ A;  4KTR A;  3VDB A;  2OQE C;  3HIG A;  3T0D A;  3IMH A;  2XHN A;  2EAC A;  1RW9 A;  1TXK A;  4BZG A;  1SIH A;  1OJN A;  4FNQ A;  1SII A;  3DCD A;  1IVW A;  2F7Q A;  3QDE A;  1JZ6 A;  3QFZ A;  2WW1 A;  1JYW A;  3N9H A;  1TQU A;  2CQT A;  3PGB A;  1A2V A;  4J5T A;  1NSR A;  1UG9 A;  4MMI A;  2EAB A;  2YFN A;  2WZS A;  1SO0 A;  3BVT A;  3HI7 A;  1LUR A;  1NSM A;  1L7J A;  4DUW A;  4DUX A;  1PS3 A;  2ZXQ A;  3X42 A;  4KTP A;  3QG0 A;  1YGA A;  3DX4 A;  3BUB A;  3T2Q A;  3ACS A;  2HTA A;  3VD4 A;  1RKY A;  1LXK A;  3AMO A;  1QAK A;  1W4N A;  3VD9 A;  3D4Z A;  1OJO A;  4OK4 A;  5GW7 A;  2F7R A;  3K5T A;  4K3A A;  1TQW A;  1TQV A;  1N7P A;  1LF6 A;  2JKA A;  3EJP A;  1J0N A;  2JKE A;  1K1X A;  3IAQ A;  1TQS A;  3Q1N A;  3W7T A;  1F4A A;  3W7X A;  3HII A;  2XN1 A;  1W6G A;  1HWW A;  3CZN A;  1R33 A;  2WVY A;  2CWU A;  3BLB A;  1LF9 A;  1H54 A;  1TQT A;  3WA3 A;  3KII A;  3BLC A;  1V7X A;  1TU5 A;  1O7D D;  3D51 A;  2WDA A;  3IAP A;  4FNP A;  3NBB A;  3K25 A;  1HM3 A;  3SEP A;  1V7W A;  2XSG A;  1AVL A;  4MMH A;  2E2T A;  1Z45 A;  3DYO A;  3I3E A;  1US1 A;  1SNZ A;  1KSI A;  1NSS A;  2ZQ0 A;  3NJX A;  1OJP A;  3DDG A;  1IQX A;  4FNT A;  2BT3 A;  2E22 A;  2ZL8 A;  3T08 A;  3MUZ 1;  1NSZ A;  1JZ5 A;  4KFE A;  1NSX A;  3X3X A;  1PX4 A;  1IVU A;  1F4H A;  1AV4 A;  1N7Q A;  1V7V A;  1W5Z A;  1YQ2 A;  1QAF A;  3VSM A;  3S4C A;  3MI6 A;  1AVK A;  3QFY A;  1RWC A;  1RWF A;  2WOH A;  3DX0 A;  2CIQ A;  2CFK A;  1X1J A;  2EAE A;  3NBJ A;  4KFF A;  3CZS A;  1K1W A;  3TY1 A;  3EJR A;  1NS8 A;  3SXX A;  2CFG A;  3RRS A;  1EGU A;  2CG0 A;  1JZ8 A;  1RWG A;  3EJQ A;  1NS7 A;  1RJO A;  2FYV A;  1LXM A;  3J7H A;  2W0Q A;  3E80 A;  2CIR A;  3DX2 A;  2F7P A;  1QWU A;  3VDC A;  5CA3 A;  3VD7 A;  1F9G A;  2E2U A;  3AFJ A;  2WYH A;  4FNU A;  1UI7 A;  2D73 A;  2X03 A;  1EKM A;  1LOH A;  1X1H A;  2EAD A;  5JMD A;  2CWT A;  2CWV A;  1JZ7 A;  2WW2 A;  3BUQ A;  1LVN A;  2ALW A;  3WA2 X;  1C82 A;  3D4Y A;  3T09 A;  4BZF A;  1RWA A;  2RDY A;  1OAC A;  3VD3 A;  1OJM A;  2F1A A;  1NS2 A;  1IU7 A;  2E24 A;  3BVW A;  3NRE A;  3D52 A;  2CIS A;  4BTW A;  2OW6 A;  2F7O A;  1I8Q A;  1N9E A;  1HMW A;  3S4B A;  2WVZ A;  3X3Y A;  5A1A A;  3W7W A;  3A24 A;  1SPU A;  3ECQ A;  1NSU A;  4KFD A;  1L7K A;  1IVV A;  3LVT A;  2HTB A;  3WVF A;  2F18 A;  2OQE A;  4FNS A;  2BRP A;  2D1W A;  2WW0 A;  1JYN A;  1D6U A;  3T2P A;  2CQS A;  5KBP A;  1N7N A;  3T0B A;  3D3I A;  5E1Q A;  2WVX B;  2F1B A;  3RSY A;  3BVV A;  4NEI A;  2PNC A;  1JZ3 A;  3EJU A;  2E2V A;  3BGA A;  2XN2 A;  1D6Z A;  1HMU A;  3KN4 A;  4BZE A;  5JMF A;  1WMO A;  3MV0 1;  3DYP A;  2C11 A;  1JYX A;  1PU4 A;  1W7C A;  1D6Y A;  1WMP A;  1HN0 A;  2YX9 A;  2Y74 A;  1CB8 A;  3LOY A;  1QX1 A;  2FUT A;  3BVX A;  3I3B A;  3EJT A;  3OS7 A;  2WGQ A;  3S4D A;  1HN1 A;  1MMX A;  2OOV C;  3DYM A;  3T2O A;  3BVU A;  1QWN A;  3WFA A;  1JZ2 A;  1NSV A;  2WW3 A;  4OK2 A;  1MMY A;  4FNR A;  2CG1 A;  1MMZ A;  3MUY 1;  3ACT A;  4BTY A;  3I3D A;  4BZH A;  4EV5 A;  2XN0 A;  3VDA A;  1JYV A;  3E1F 1;  1HTY A;  1F1S A;  3AFL A;  3MPH A;  2BRV X;  3X40 A;  2WYI A;  3VSN A;  1MN0 A;  1IQY A;  3E7J A;  2CFL A;  4TTG A;  1NS0 A;  2YFO A;  3BUI A;  1X1I A;  4EV2 A;  3OBA A;  3X41 A;  3D50 A;  2FUQ A;  3AMO B;  3S4A A;  2Y73 A;  3EJS A;  1JZ4 A;  1ULV A;  3ALA A;  1N7O A;  4UFC A;  3MWX A;  4DUV A;  4BTX A;  3BS6 A;  1J0M A;  2WO0 A;  3CV5 A;  1QAL A;  3MV1 1;  3W7U A;  1W2Z A;  2JKP A;  2WCO A;  3BUP A;  2WOF A;  3OB8 A;  1PX3 A;  1W3Y A;  4AQ0 A;  3NJV A;  4OJZ A;  2BRW A;  1DP0 A;  3SX1 A;  3DX3 A;  1MMU A;  2CFW A;  3T0U A;  2C10 A;  2WVX A;  4RNL A;  1W6C A; 
#chains in the Genus database with same CATH homology
 1NS4 A;  1RWH A;  3Q1N A;  1F4A A;  1K1Y A;  2FUT A;  3VDC A;  3VD7 A;  1F9G A;  3I3B A;  4FNV A;  3OS7 A;  2D73 A;  2X03 A;  1JOV A;  1LOH A;  1HN1 A;  1MMX A;  1X1H A;  3A0O A;  1N7R A;  5JMD A;  2WVY A;  1JZ7 A;  1LF9 A;  3DYM A;  3DEC A;  3T2O A;  2WW2 A;  3WFA A;  2Q1F A;  1JZ2 A;  1NSV A;  2WW3 A;  3BLC A;  4OK2 A;  1MMY A;  1C82 A;  1NKG A;  1MMZ A;  3MUY 1;  3T09 A;  3T0A A;  4BZF A;  1RWA A;  3CZJ A;  2WDA A;  3IAP A;  3VD3 A;  3VD5 A;  1HM2 A;  1OJM A;  3I3D A;  4BZH A;  1NS2 A;  3VDB A;  2E24 A;  3NRE A;  3T0D A;  2CIS A;  3K25 A;  3IMH A;  1HM3 A;  3SEP A;  3VDA A;  1JYV A;  3E1F 1;  1I8Q A;  2XSG A;  1F1S A;  1HMW A;  3AFL A;  4MMH A;  2XHN A;  1RW9 A;  1Z45 A;  1TXK A;  2BRV X;  2WVZ A;  3DYO A;  3VSN A;  4BZG A;  1MN0 A;  5A1A A;  3E7J A;  3A24 A;  1OJN A;  3I3E A;  3DCD A;  4TTG A;  1NS0 A;  1SNZ A;  3ECQ A;  1NSS A;  2ZQ0 A;  3NJX A;  1OJP A;  1X1I A;  1NSU A;  3OBA A;  1JZ6 A;  2E22 A;  1L7K A;  2FUQ A;  2WW1 A;  2HTB A;  3MUZ 1;  1NSZ A;  3T08 A;  3WVF A;  1JZ5 A;  1JYW A;  1NSX A;  1JZ4 A;  1PX4 A;  1F4H A;  2BRP A;  1ULV A;  1N7Q A;  1N7O A;  2WW0 A;  4J5T A;  1JYN A;  1NSR A;  1UG9 A;  4MMI A;  1YQ2 A;  3MWX A;  3T2P A;  2WZS A;  1SO0 A;  3VSM A;  4DUV A;  1LUR A;  3BS6 A;  1NSM A;  1L7J A;  1J0M A;  4DUW A;  4DUX A;  1N7N A;  2ZXQ A;  3T0B A;  1RWC A;  5E1Q A;  1RWF A;  2WVX B;  4NEI A;  3MV1 1;  1YGA A;  1JZ3 A;  2CIQ A;  2JKP A;  2WCO A;  2HTA A;  3T2Q A;  3VD4 A;  1X1J A;  3OB8 A;  1PX3 A;  1LXK A;  1W3Y A;  1K1W A;  3BGA A;  3TY1 A;  1HMU A;  5JMF A;  4BZE A;  3VD9 A;  4AQ0 A;  1NS8 A;  1OJO A;  4OK4 A;  3MV0 1;  3DYP A;  3NJV A;  1EGU A;  1JZ8 A;  1JYX A;  4OJZ A;  2BRW A;  1DP0 A;  1N7P A;  1RWG A;  1MMU A;  1LF6 A;  1NS7 A;  2JKA A;  1HN0 A;  1LXM A;  3J7H A;  1J0N A;  2JKE A;  3E80 A;  2WVX A;  4RNL A;  2CIR A;  1K1X A;  3IAQ A;  1CB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...