1L7KA

X-ray structure of galactose mutarotase from lactococcus lactis complexed with galactose
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords galactose mutarotase
publication title High resolution X-ray structure of galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 95
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1l7kA00
1JYNA 1JYWA 3VD7A 3T2QA 1RWGA 2WW3A 2X03A 1OJNA 3IMHA 2JKPA 3DYMA 3K25A 3OS7A 2CIRA 1HMUA 1MMYA 1X1HA 1NS7A 3DECA 3MV01 1X1JA 3BGAA 3VDBA 3Q1NA 3OBAA 1YQ2A 1MMXA 1YGAA 1LOHA 1NSVA 1JYVA 1JZ6A 1NS0A 1MN0A 1HM2A 3T2PA 1C82A 2ZXQA 3VD3A 1K1XA 1ULVA 1JZ8A 4DUWA 1PX4A 3DYOA 3MUY1 1F1SA 1OJOA 1RWFA 1JZ7A 2WW0A 1W3YA 4AQ0A 2XSGA 3T09A 1N7RA 1F4AA 3WFAA 1J0NA 3I3DA 1NS4A 1LF9A 1CB8A 3T08A 1TXKA 1UG9A 2WZSA 1LURA 4BZEA 1HN1A 2WVZA 2WVXB 1NS2A 3T0AA 1OJPA 3I3EA 4DUVA 1N7OA 3DYPA 3VD9A 1EGUA 1X1IA 1K1YA 2BRPA 1JZ2A 1NSXA 3ECQA 1JZ4A 1J0MA 3VDCA 4RNLA 1JYXA 1RWHA 3SEPA 3NJXA 3T2OA 1SNZA 3IAPA 5A1AA 1F9GA 3VD4A 2XHNA 4BZFA 1MMZA 3T0BA 3E1F1 2HTBA 1Z45A 3NJVA 4BZHA 1I8QA 1OJMA 1HN0A 3I3BA 1N7QA 1MMUA 2BRWA 3MWXA 2WW1A 1DP0A 3DCDA 1N7PA 3T0DA 3J7HA 1L7KA 2WCOA 1SO0A 2CISA 2JKAA 3NREA 1HMWA 2WDAA 1NS8A 1F4HA 2D73A 2WVXA 1K1WA 2CIQA 2JKEA 1JZ3A 1PX3A 1N7NA 1NSMA 1HM3A 3MV11 1RWCA 1NSZA 1NSRA 2BRVX 3VD5A 1RWAA 3CZJA 3A24A 1JZ5A 1RW9A 2E24A 2E22A 2Q1FA 1LXMA 1LXKA 1NSSA 1LF6A 3VDAA 4TTGA 4BZGA 1NSUA 4DUXA 3MUZ1 1L7JA 2ZQ0A 5E1QA 2HTAA 3OB8A 1JOVA 2WW2A 1NKGA 2WVYA 3IAQA
chains in the Genus database with same CATH superfamily
1JYNA 1JYWA 3T2QA 2WW3A 3DX1A 2X03A 2E2TA 2YFOA 2Y73A 1N9EA 3MV01 1X1JA 2EACA 3VDBA 2CWTA 1R34A 1LOHA 1JYVA 2F7RA 1NS0A 1HM2A 3T2PA 1JZ8A 3D3IA 3E7JA 3KIIA 1TQVA 1F1SA 1OJOA 3X3ZA 3BLBA 3ACTA 1SIHA 4AQ0A 2XSGA 3S4CA 2CQTA 1CB8A 1WMPA 2WZSA 3DX2A 4BZEA 3BVVA 1RJOA 1IQXA 3I3EA 1N7OA 3DYPA 4OJZA 1X1IA 2CFKA 1D6UA 1W5ZA 1TQTA 4KTRA 3A0OA 3S4BA 3BUDA 4FNUA 3AFLA 1A2VA 3VD4A 3KN4A 1QALA 3NJVA 3QDEA 3W7SA 3WVFA 3EJUA 3BS6A 1SPUA 3MWXA 2WW1A 3DX3A 1LVNA 3EJTA 4UFCA 3VSMA 4FNTA 1NS8A 2WYHA 1F4HA 2CWUA 1K1WA 4NEIA 3WA3A 2JKEA 4J5TA 1NSMA 3VD5A 2FYVA 1O7DD 1V7WA 3N9HA 3AMOA 3TY1A 2E24A 2Q1FA 3HI7A 3VDAA 2RDYA 3NBBA 1D6ZA 3MUZ1 4FNQA 1UI8A 1NKGA 2WGQA 3IAQA 3CZSA 3WA2X 1IQYA 2CIRA 1MMYA 1X1HA 3D51A 1HWWA 3BGAA 2ZL8A 3Q1NA 3OBAA 1OACA 3WIQA 3BUIA 1C82A 1K1XA 3EJRA 1IU7A 3MUY1 1W6GA 2OOVA 3T09A 1N7RA 3BUBA 2XN2A 2C10A 2CFLA 1TXKA 1D6YA 2W0QA 2XN0A 1LURA 3X41A 1OJPA 4DUVA 1AVKA 3WIRA 2D1WA 3EJPA 4OK4A 1W6CA 4BTWA 1K1YA 1NSXA 2OW7A 1TQWA 1J0MA 3VDCA 4KFFA 1QWUA 4RNLA 1TQUA 1V7XA 2WOHA 2HTBA 1V7VA 4BZHA 1QX1A 3PGBA 1N7QA 2BRWA 1DP0A 3DCDA 1N7PA 4FNVA 3T0DA 3J7HA 4KFDA 2OQEC 3DX4A 4OK2A 1UI7A 2WVXA 3MI6A 1PX3A 2FUTA 3HIGA 1HM3A 1RWCA 1NSZA 1NSRA 3HIIA 4MMIA 1RKYA 4FNPA 3X3YA 2XN1A 3W7UA 1H54A 1LXKA 1NSSA 2F1BA 4MMHA 4TTGA 3DDFA 3NBJA 1NSUA 1L7JA 1AVLA 2HTAA 1JOVA 3DYOA 5KBPA 3ALAA 1RWGA 2ALWA 2F18A 1JRQA 2CWVA 1PU4A 1NS7A 2CQSA 3BUQA 2YFNA 1IVXA 3T0UA 2WO0A 1YQ2A 1QAFA 1SIIA 1MN0A 2ZXQA 1PS3A 2WYIA 3VD3A 2CFGA 3D4ZA 3BVUA 1WMOA 4DUWA 1PX4A 3DDGA 1JZ7A 1W3YA 3S4AA 1F4AA 3WFAA 1J0NA 3I3DA 3T08A 3QFZA 4BTXA 1HN1A 4K35A 2WVZA 4BTYA 3BVXA 3T0AA 2OOVC 3VD9A 1TQSA 2EAEA 3SXXA 2CG0A 3AMOB 4FNRA 4EV5A 3NJXA 3T2OA 5A1AA 1W2ZA 1MMZA 1EKMA 3DX0A 1Z45A 3BUPA 3ACSA 1QWNA 2EABA 1OJMA 3I3BA 1MMUA 3BLCA 2E2VA 5JMFA 2WCOA 1SO0A 2CISA 1IVUA 2D73A 3QFYA 2CIQA 3LVTA 1N7NA 1KSIA 2FUQA 3E80A 3LOYA 3RSYA 3VSNA 3X40A 1WMNA 2F7QA 1RW9A 2E22A 1R33A 1LF6A 4BZGA 4DUXA 3AFJA 3OB8A 3W7WA 2F7PA 2WW2A 3T0BA 2WOFA 3VD7A 5CA3A 1OJNA 5GW7A 3IMHA 2JKPA 3EJSA 3DYMA 2E2UA 3K25A 3OS7A 3RRSA 1HMUA 3CZNA 3X42A 3DECA 4EV2A 1W4NA 1MMXA 3SX1A 1YGAA 1NSVA 2F1AA 1JZ6A 5JMDA 4FNSA 1AV4A 1IVVA 3MPHA 1ULVA 3X3XA 2CFDA 1RWFA 2WW0A 3D4YA 2BT3A 4KTPA 1IVWA 2OQEA 1NS4A 1LF9A 1DYUA 3QG0A 2C11A 1UG9A 2EADA 3W7TA 2YX9A 2WVXB 1NS2A 1EGUA 3D50A 1JZ2A 2BRPA 1HXKA 3BVWA 3ECQA 1JZ4A 1JYXA 1RWHA 3SEPA 1SNZA 3IAPA 2Y74A 1F9GA 2XHNA 4BZFA 3E1F1 2CFWA 1QAKA 3W7XA 3D52A 1I8QA 1HN0A 2OW6A 1HTYA 1L7KA 2JKAA 3NREA 1HMWA 2WDAA 2PNCA 1W7CA 1JZ3A 1US1A 3MV11 2BRVX 1TU5A 3CV5A 3S4DA 1RWAA 3CZJA 4K3AA 3A24A 1JZ5A 3BVTA 1LXMA 2F7OA 4KFEA 2ZQ0A 5E1QA 3K5TA 2CG1A 3EJQA 2WVYA
chains in the Genus database with same CATH topology
1JYNA 1JYWA 3VD7A 3T2QA 1RWGA 2WW3A 2X03A 1OJNA 3IMHA 2JKPA 3DYMA 3K25A 3OS7A 2CIRA 1HMUA 1MMYA 1X1HA 1NS7A 3DECA 3MV01 1X1JA 3BGAA 3VDBA 3Q1NA 3OBAA 1YQ2A 1MMXA 1YGAA 1LOHA 1NSVA 1JYVA 1JZ6A 1NS0A 5JMDA 1MN0A 1HM2A 3T2PA 1C82A 2ZXQA 3VD3A 1K1XA 1ULVA 1JZ8A 3E7JA 4DUWA 1PX4A 3DYOA 3MUY1 1F1SA 1OJOA 1RWFA 1JZ7A 2WW0A 1W3YA 4AQ0A 2XSGA 3T09A 1N7RA 1F4AA 3WFAA 1J0NA 3I3DA 1NS4A 1LF9A 1CB8A 3T08A 1TXKA 1UG9A 2WZSA 1LURA 4BZEA 1HN1A 2WVZA 2WVXB 1NS2A 3T0AA 1OJPA 3I3EA 4DUVA 1N7OA 3DYPA 4OJZA 3VD9A 1EGUA 1X1IA 4OK4A 1K1YA 2BRPA 1JZ2A 1NSXA 3A0OA 3ECQA 1J0MA 3VDCA 1JZ4A 3AFLA 4RNLA 1RWHA 3SEPA 3NJXA 3T2OA 1JYXA 1SNZA 3IAPA 5A1AA 1F9GA 3VD4A 2XHNA 4BZFA 1MMZA 3T0BA 3E1F1 2HTBA 1Z45A 3NJVA 4BZHA 1I8QA 3WVFA 1OJMA 1HN0A 3BS6A 1N7QA 3I3BA 1MMUA 2BRWA 3MWXA 3BLCA 2WW1A 1DP0A 3DCDA 1N7PA 4FNVA 5JMFA 3T0DA 3J7HA 1L7KA 2WCOA 1SO0A 2CISA 2JKAA 3VSMA 3NREA 1HMWA 2WDAA 1NS8A 1F4HA 2D73A 4OK2A 2WVXA 1K1WA 2CIQA 4NEIA 2JKEA 1JZ3A 1PX3A 1N7NA 4J5TA 2FUQA 3E80A 1NSMA 2FUTA 1HM3A 3MV11 1RWCA 1NSZA 1NSRA 2BRVX 3VSNA 4MMIA 3VD5A 1RWAA 3CZJA 3A24A 3TY1A 1JZ5A 1RW9A 2E24A 2E22A 2Q1FA 1LXMA 1LXKA 1NSSA 1LF6A 4MMHA 3VDAA 4TTGA 4BZGA 1NSUA 4DUXA 3MUZ1 1L7JA 2ZQ0A 5E1QA 2HTAA 3OB8A 1JOVA 2WW2A 1NKGA 2WVYA 3IAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYN A;  1JYW A;  3VD7 A;  3T2Q A;  1RWG A;  2WW3 A;  2X03 A;  1OJN A;  3IMH A;  2JKP A;  3DYM A;  3K25 A;  3OS7 A;  2CIR A;  1HMU A;  1MMY A;  1X1H A;  1NS7 A;  3DEC A;  3MV0 1;  1X1J A;  3BGA A;  3VDB A;  3Q1N A;  3OBA A;  1YQ2 A;  1MMX A;  1YGA A;  1LOH A;  1NSV A;  1JYV A;  1JZ6 A;  1NS0 A;  1MN0 A;  1HM2 A;  3T2P A;  1C82 A;  2ZXQ A;  3VD3 A;  1K1X A;  1ULV A;  1JZ8 A;  4DUW A;  1PX4 A;  3DYO A;  3MUY 1;  1F1S A;  1OJO A;  1RWF A;  1JZ7 A;  2WW0 A;  1W3Y A;  4AQ0 A;  2XSG A;  3T09 A;  1N7R A;  1F4A A;  3WFA A;  1J0N A;  3I3D A;  1NS4 A;  1LF9 A;  1CB8 A;  3T08 A;  1TXK A;  1UG9 A;  2WZS A;  1LUR A;  4BZE A;  1HN1 A;  2WVZ A;  2WVX B;  1NS2 A;  3T0A A;  1OJP A;  3I3E A;  4DUV A;  1N7O A;  3DYP A;  3VD9 A;  1EGU A;  1X1I A;  1K1Y A;  2BRP A;  1JZ2 A;  1NSX A;  3ECQ A;  1JZ4 A;  1J0M A;  3VDC A;  4RNL A;  1JYX A;  1RWH A;  3SEP A;  3NJX A;  3T2O A;  1SNZ A;  3IAP A;  5A1A A;  1F9G A;  3VD4 A;  2XHN A;  4BZF A;  1MMZ A;  3T0B A;  3E1F 1;  2HTB A;  1Z45 A;  3NJV A;  4BZH A;  1I8Q A;  1OJM A;  1HN0 A;  3I3B A;  1N7Q A;  1MMU A;  2BRW A;  3MWX A;  2WW1 A;  1DP0 A;  3DCD A;  1N7P A;  3T0D A;  3J7H A;  1L7K A;  2WCO A;  1SO0 A;  2CIS A;  2JKA A;  3NRE A;  1HMW A;  2WDA A;  1NS8 A;  1F4H A;  2D73 A;  2WVX A;  1K1W A;  2CIQ A;  2JKE A;  1JZ3 A;  1PX3 A;  1N7N A;  1NSM A;  1HM3 A;  3MV1 1;  1RWC A;  1NSZ A;  1NSR A;  2BRV X;  3VD5 A;  1RWA A;  3CZJ A;  3A24 A;  1JZ5 A;  1RW9 A;  2E24 A;  2E22 A;  2Q1F A;  1LXM A;  1LXK A;  1NSS A;  1LF6 A;  3VDA A;  4TTG A;  4BZG A;  1NSU A;  4DUX A;  3MUZ 1;  1L7J A;  2ZQ0 A;  5E1Q A;  2HTA A;  3OB8 A;  1JOV A;  2WW2 A;  1NKG A;  2WVY A;  3IAQ A; 
#chains in the Genus database with same CATH topology
 1JYN A;  1JYW A;  3T2Q A;  2WW3 A;  3DX1 A;  2X03 A;  2E2T A;  2YFO A;  2Y73 A;  1N9E A;  3MV0 1;  1X1J A;  2EAC A;  3VDB A;  2CWT A;  1R34 A;  1LOH A;  1JYV A;  2F7R A;  1NS0 A;  1HM2 A;  3T2P A;  1JZ8 A;  3D3I A;  3E7J A;  3KII A;  1TQV A;  1F1S A;  1OJO A;  3X3Z A;  3BLB A;  3ACT A;  1SIH A;  4AQ0 A;  2XSG A;  3S4C A;  2CQT A;  1CB8 A;  1WMP A;  2WZS A;  3DX2 A;  4BZE A;  3BVV A;  1RJO A;  1IQX A;  3I3E A;  1N7O A;  3DYP A;  4OJZ A;  1X1I A;  2CFK A;  1D6U A;  1W5Z A;  1TQT A;  4KTR A;  3A0O A;  3S4B A;  3BUD A;  4FNU A;  3AFL A;  1A2V A;  3VD4 A;  3KN4 A;  1QAL A;  3NJV A;  3QDE A;  3W7S A;  3WVF A;  3EJU A;  3BS6 A;  1SPU A;  3MWX A;  2WW1 A;  3DX3 A;  1LVN A;  3EJT A;  4UFC A;  3VSM A;  4FNT A;  1NS8 A;  2WYH A;  1F4H A;  2CWU A;  1K1W A;  4NEI A;  3WA3 A;  2JKE A;  4J5T A;  1NSM A;  3VD5 A;  2FYV A;  1O7D D;  1V7W A;  3N9H A;  3AMO A;  3TY1 A;  2E24 A;  2Q1F A;  3HI7 A;  3VDA A;  2RDY A;  3NBB A;  1D6Z A;  3MUZ 1;  4FNQ A;  1UI8 A;  1NKG A;  2WGQ A;  3IAQ A;  3CZS A;  3WA2 X;  1IQY A;  2CIR A;  1MMY A;  1X1H A;  3D51 A;  1HWW A;  3BGA A;  2ZL8 A;  3Q1N A;  3OBA A;  1OAC A;  3WIQ A;  3BUI A;  1C82 A;  1K1X A;  3EJR A;  1IU7 A;  3MUY 1;  1W6G A;  2OOV A;  3T09 A;  1N7R A;  3BUB A;  2XN2 A;  2C10 A;  2CFL A;  1TXK A;  1D6Y A;  2W0Q A;  2XN0 A;  1LUR A;  3X41 A;  1OJP A;  4DUV A;  1AVK A;  3WIR A;  2D1W A;  3EJP A;  4OK4 A;  1W6C A;  4BTW A;  1K1Y A;  1NSX A;  2OW7 A;  1TQW A;  1J0M A;  3VDC A;  4KFF A;  1QWU A;  4RNL A;  1TQU A;  1V7X A;  2WOH A;  2HTB A;  1V7V A;  4BZH A;  1QX1 A;  3PGB A;  1N7Q A;  2BRW A;  1DP0 A;  3DCD A;  1N7P A;  4FNV A;  3T0D A;  3J7H A;  4KFD A;  2OQE C;  3DX4 A;  4OK2 A;  1UI7 A;  2WVX A;  3MI6 A;  1PX3 A;  2FUT A;  3HIG A;  1HM3 A;  1RWC A;  1NSZ A;  1NSR A;  3HII A;  4MMI A;  1RKY A;  4FNP A;  3X3Y A;  2XN1 A;  3W7U A;  1H54 A;  1LXK A;  1NSS A;  2F1B A;  4MMH A;  4TTG A;  3DDF A;  3NBJ A;  1NSU A;  1L7J A;  1AVL A;  2HTA A;  1JOV A;  3DYO A;  5KBP A;  3ALA A;  1RWG A;  2ALW A;  2F18 A;  1JRQ A;  2CWV A;  1PU4 A;  1NS7 A;  2CQS A;  3BUQ A;  2YFN A;  1IVX A;  3T0U A;  2WO0 A;  1YQ2 A;  1QAF A;  1SII A;  1MN0 A;  2ZXQ A;  1PS3 A;  2WYI A;  3VD3 A;  2CFG A;  3D4Z A;  3BVU A;  1WMO A;  4DUW A;  1PX4 A;  3DDG A;  1JZ7 A;  1W3Y A;  3S4A A;  1F4A A;  3WFA A;  1J0N A;  3I3D A;  3T08 A;  3QFZ A;  4BTX A;  1HN1 A;  4K35 A;  2WVZ A;  4BTY A;  3BVX A;  3T0A A;  2OOV C;  3VD9 A;  1TQS A;  2EAE A;  3SXX A;  2CG0 A;  3AMO B;  4FNR A;  4EV5 A;  3NJX A;  3T2O A;  5A1A A;  1W2Z A;  1MMZ A;  1EKM A;  3DX0 A;  1Z45 A;  3BUP A;  3ACS A;  1QWN A;  2EAB A;  1OJM A;  3I3B A;  1MMU A;  3BLC A;  2E2V A;  5JMF A;  2WCO A;  1SO0 A;  2CIS A;  1IVU A;  2D73 A;  3QFY A;  2CIQ A;  3LVT A;  1N7N A;  1KSI A;  2FUQ A;  3E80 A;  3LOY A;  3RSY A;  3VSN A;  3X40 A;  1WMN A;  2F7Q A;  1RW9 A;  2E22 A;  1R33 A;  1LF6 A;  4BZG A;  4DUX A;  3AFJ A;  3OB8 A;  3W7W A;  2F7P A;  2WW2 A;  3T0B A;  2WOF A;  3VD7 A;  5CA3 A;  1OJN A;  5GW7 A;  3IMH A;  2JKP A;  3EJS A;  3DYM A;  2E2U A;  3K25 A;  3OS7 A;  3RRS A;  1HMU A;  3CZN A;  3X42 A;  3DEC A;  4EV2 A;  1W4N A;  1MMX A;  3SX1 A;  1YGA A;  1NSV A;  2F1A A;  1JZ6 A;  5JMD A;  4FNS A;  1AV4 A;  1IVV A;  3MPH A;  1ULV A;  3X3X A;  2CFD A;  1RWF A;  2WW0 A;  3D4Y A;  2BT3 A;  4KTP A;  1IVW A;  2OQE A;  1NS4 A;  1LF9 A;  1DYU A;  3QG0 A;  2C11 A;  1UG9 A;  2EAD A;  3W7T A;  2YX9 A;  2WVX B;  1NS2 A;  1EGU A;  3D50 A;  1JZ2 A;  2BRP A;  1HXK A;  3BVW A;  3ECQ A;  1JZ4 A;  1JYX A;  1RWH A;  3SEP A;  1SNZ A;  3IAP A;  2Y74 A;  1F9G A;  2XHN A;  4BZF A;  3E1F 1;  2CFW A;  1QAK A;  3W7X A;  3D52 A;  1I8Q A;  1HN0 A;  2OW6 A;  1HTY A;  1L7K A;  2JKA A;  3NRE A;  1HMW A;  2WDA A;  2PNC A;  1W7C A;  1JZ3 A;  1US1 A;  3MV1 1;  2BRV X;  1TU5 A;  3CV5 A;  3S4D A;  1RWA A;  3CZJ A;  4K3A A;  3A24 A;  1JZ5 A;  3BVT A;  1LXM A;  2F7O A;  4KFE A;  2ZQ0 A;  5E1Q A;  3K5T A;  2CG1 A;  3EJQ A;  2WVY A; 
#chains in the Genus database with same CATH homology
 1JYN A;  1JYW A;  3VD7 A;  3T2Q A;  1RWG A;  2WW3 A;  2X03 A;  1OJN A;  3IMH A;  2JKP A;  3DYM A;  3K25 A;  3OS7 A;  2CIR A;  1HMU A;  1MMY A;  1X1H A;  1NS7 A;  3DEC A;  3MV0 1;  1X1J A;  3BGA A;  3VDB A;  3Q1N A;  3OBA A;  1YQ2 A;  1MMX A;  1YGA A;  1LOH A;  1NSV A;  1JYV A;  1JZ6 A;  1NS0 A;  5JMD A;  1MN0 A;  1HM2 A;  3T2P A;  1C82 A;  2ZXQ A;  3VD3 A;  1K1X A;  1ULV A;  1JZ8 A;  3E7J A;  4DUW A;  1PX4 A;  3DYO A;  3MUY 1;  1F1S A;  1OJO A;  1RWF A;  1JZ7 A;  2WW0 A;  1W3Y A;  4AQ0 A;  2XSG A;  3T09 A;  1N7R A;  1F4A A;  3WFA A;  1J0N A;  3I3D A;  1NS4 A;  1LF9 A;  1CB8 A;  3T08 A;  1TXK A;  1UG9 A;  2WZS A;  1LUR A;  4BZE A;  1HN1 A;  2WVZ A;  2WVX B;  1NS2 A;  3T0A A;  1OJP A;  3I3E A;  4DUV A;  1N7O A;  3DYP A;  4OJZ A;  3VD9 A;  1EGU A;  1X1I A;  4OK4 A;  1K1Y A;  2BRP A;  1JZ2 A;  1NSX A;  3A0O A;  3ECQ A;  1J0M A;  3VDC A;  1JZ4 A;  3AFL A;  4RNL A;  1RWH A;  3SEP A;  3NJX A;  3T2O A;  1JYX A;  1SNZ A;  3IAP A;  5A1A A;  1F9G A;  3VD4 A;  2XHN A;  4BZF A;  1MMZ A;  3T0B A;  3E1F 1;  2HTB A;  1Z45 A;  3NJV A;  4BZH A;  1I8Q A;  3WVF A;  1OJM A;  1HN0 A;  3BS6 A;  1N7Q A;  3I3B A;  1MMU A;  2BRW A;  3MWX A;  3BLC A;  2WW1 A;  1DP0 A;  3DCD A;  1N7P A;  4FNV A;  5JMF A;  3T0D A;  3J7H A;  1L7K A;  2WCO A;  1SO0 A;  2CIS A;  2JKA A;  3VSM A;  3NRE A;  1HMW A;  2WDA A;  1NS8 A;  1F4H A;  2D73 A;  4OK2 A;  2WVX A;  1K1W A;  2CIQ A;  4NEI A;  2JKE A;  1JZ3 A;  1PX3 A;  1N7N A;  4J5T A;  2FUQ A;  3E80 A;  1NSM A;  2FUT A;  1HM3 A;  3MV1 1;  1RWC A;  1NSZ A;  1NSR A;  2BRV X;  3VSN A;  4MMI A;  3VD5 A;  1RWA A;  3CZJ A;  3A24 A;  3TY1 A;  1JZ5 A;  1RW9 A;  2E24 A;  2E22 A;  2Q1F A;  1LXM A;  1LXK A;  1NSS A;  1LF6 A;  4MMH A;  3VDA A;  4TTG A;  4BZG A;  1NSU A;  4DUX A;  3MUZ 1;  1L7J A;  2ZQ0 A;  5E1Q A;  2HTA A;  3OB8 A;  1JOV A;  2WW2 A;  1NKG A;  2WVY A;  3IAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...