1L7KA

X-ray structure of galactose mutarotase from lactococcus lactis complexed with galactose
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galactose mutarotase
publication title High resolution X-ray structure of galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 95
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1l7kA00
2ZXQA 1JZ4A 1JYWA 1N7RA 3T0BA 1NS7A 1TXKA 3SEPA 3A24A 1L7JA 1LOHA 1NSRA 5A1AA 3T2OA 2E24A 2WDAA 2X03A 3VDCA 2WVXA 1MMXA 2ZQ0A 1JZ8A 1LXKA 3T2QA 4BZEA 3NJXA 1K1WA 1HN1A 1LF6A 3ECQA 3DYOA 1N7PA 1K1XA 2JKEA 1NKGA 1RWHA 3VDBA 1NS2A 3OBAA 2CIRA 1NS8A 3I3EA 2D73A 3OS7A 1Z45A 3K25A 3DCDA 1HM2A 3MUZ1 1OJMA 3VD4A 1JYVA 4BZGA 1EGUA 2Q1FA 4BZHA 1NSUA 2XHNA 1J0MA 2WVYA 2WCOA 1NSSA 2CISA 1F1SA 1F4HA 2XSGA 3VD3A 1YQ2A 2HTBA 3E1F1 3DYMA 1DP0A 4BZFA 1N7QA 3VD9A 1NSZA 1NSVA 1OJPA 2WVZA 3OB8A 1MMZA 1OJOA 4RNLA 2JKAA 3T08A 3T0AA 1L7KA 1HMUA 2BRPA 3J7HA 1OJNA 3WFAA 1HN0A 3T0DA 3NJVA 1ULVA 1HMWA 1JZ3A 3VDAA 3IAPA 3MV01 3NREA 1JZ2A 1MMYA 2E22A 1X1IA 1NS4A 1YGAA 3I3DA 3Q1NA 3MUY1 3MV11 3CZJA 1W3YA 1JYNA 4AQ0A 1N7NA 1MN0A 3DECA 1PX3A 1RWFA 4DUWA 1RWAA 3IMHA 1RWGA 3T2PA 5E1QA 2WW2A 3VD5A 3I3BA 1RW9A 3T09A 3IAQA 1LF9A 1F4AA 1JZ5A 1SNZA 1NSMA 3MWXA 1JOVA 1SO0A 1F9GA 1I8QA 2WW3A 4TTGA 1RWCA 1HM3A 1N7OA 1X1HA 2WZSA 3DYPA 4DUVA 2WW0A 1JZ6A 2HTAA 2BRWA 1MMUA 1PX4A 1UG9A 1LURA 2CIQA 1K1YA 2WVXB 2BRVX 1JZ7A 3BGAA 1J0NA 1NSXA 1LXMA 1C82A 1JYXA 2JKPA 4DUXA 2WW1A 1X1JA 3VD7A 1CB8A 1NS0A
chains in the Genus database with same CATH superfamily
2ZXQA 3KN4A 1JZ4A 3SEPA 3CZSA 1LOHA 1NSRA 1UI7A 4FNQA 2EABA 3T2QA 1RJOA 1N7PA 1D6ZA 1NKGA 3D52A 3OBAA 3E80A 1PU4A 2W0QA 1QAFA 4FNVA 1Z45A 1W7CA 3DCDA 1V7XA 1JYVA 3EJUA 1EGUA 4FNPA 1QX1A 2Q1FA 4BZHA 2WVYA 3EJTA 2CISA 1F1SA 3S4DA 1N7QA 1IVVA 1A2VA 3VD9A 3E7JA 2WVZA 3D4YA 3OB8A 4RNLA 3BUIA 3MPHA 1JZ3A 3MV01 1WMOA 2CFLA 1HXKA 1X1IA 1NS4A 3I3DA 4FNRA 3WVFA 3AFJA 3WIRA 5GW7A 1IQYA 3DECA 2WYIA 1PX3A 3BVVA 3DX4A 3AMOB 1V7WA 4MMHA 1RWAA 3IMHA 3D3IA 1N9EA 2FUTA 2CFGA 3IAQA 1F4AA 1DYUA 2F7RA 5JMFA 1F9GA 1I8QA 1HWWA 2HTAA 1PX4A 1IVUA 1LURA 2E2VA 1K1YA 1JZ7A 2OQEA 1J0NA 1LXMA 1C82A 3ACTA 2OW7A 4BTYA 3VD7A 1JYWA 1R34A 1N7RA 3T0BA 4BTWA 1NS7A 1JRQA 1L7JA 1IVWA 2X03A 2C10A 4OJZA 4FNTA 3N9HA 1LXKA 3BUDA 4MMIA 3PGBA 3VSMA 2CQTA 2JKEA 1TQTA 3X42A 2OQEC 2CWUA 1RWHA 3VDBA 2Y73A 4EV5A 1NS2A 3VSNA 2CIRA 3ACSA 3S4CA 2XN0A 1D6YA 1W4NA 3OS7A 1W2ZA 1UI8A 1IU7A 3K25A 1SPUA 3EJQA 3MUZ1 4BZGA 3NBJA 3SX1A 2D1WA 1YQ2A 2HTBA 4BZFA 3QG0A 1OJOA 2WYHA 1KSIA 3X41A 1L7KA 1HMUA 3ALAA 3WFAA 3BLCA 3WIQA 3T0DA 1ULVA 1HMWA 3IAPA 1JZ2A 3NREA 1MMYA 3WA2X 3QFZA 2FUQA 4KFDA 2ZL8A 2F18A 3QFYA 1MN0A 3CV5A 3BUPA 4BTXA 4FNSA 3W7TA 2WW2A 3BUBA 3SXXA 1LF9A 3X3YA 2F1AA 1NSMA 1TQUA 3MWXA 2OOVA 1R33A 4TTGA 3BVXA 1HM3A 1N7OA 1X1HA 2WZSA 2WW0A 4KFEA 3LOYA 3AFLA 3QDEA 2BRVX 1AVLA 3HIGA 3BVWA 3BS6A 2WW1A 4DUXA 3W7SA 3MI6A 1NS0A 3LVTA 4NEIA 3A24A 3EJPA 2WGQA 2E24A 3K5TA 2CWVA 4BZEA 3NJXA 1LF6A 3ECQA 3A0OA 3X3XA 3D4ZA 1NS8A 2XN2A 2YFNA 2YFOA 3I3EA 1WMNA 2EAEA 2F1BA 1HM2A 3X40A 1OJMA 3VD4A 3S4BA 4KTRA 4K3AA 4UFCA 1NSUA 2XHNA 1J0MA 3W7UA 2E2TA 4J5TA 1NSSA 3VD3A 3E1F1 1H54A 3EJRA 1NSZA 2F7QA 3S4AA 3T08A 2BRPA 1IQXA 3J7HA 3BLBA 1HN0A 3NJVA 5JMDA 3W7WA 1QWNA 2E22A 4OK4A 3Q1NA 1YGAA 3D50A 2EADA 2Y74A 1W3YA 4OK2A 4KFFA 2CG0A 3X3ZA 3DDFA 2E2UA 2YX9A 2CFDA 1IVXA 1RWFA 2F7OA 1QWUA 1RWGA 3BVTA 3DX2A 1SIHA 1D6UA 2CFKA 1JOVA 1V7VA 1W5ZA 3DYPA 3HI7A 1QALA 2BRWA 1UG9A 2CIQA 3BGAA 2FYVA 1SIIA 1NSXA 5KBPA 3DX0A 1TXKA 2EACA 3DX3A 5A1AA 3T2OA 1OACA 2WDAA 1QAKA 3VDCA 3DDGA 1TQSA 1MMXA 2WVXA 4K35A 2ZQ0A 1JZ8A 2WO0A 1K1WA 1HN1A 2WOFA 2XN1A 3D51A 2WOHA 3DYOA 1K1XA 1W6GA 4EV2A 2D73A 2RDYA 2OOVC 2ALWA 1LVNA 2PNCA 3TY1A 2WCOA 1F4HA 2XSGA 3DYMA 1DP0A 1W6CA 1NSVA 1OJPA 3T0UA 1MMZA 2JKAA 3KIIA 3T0AA 1OJNA 3W7XA 2F7PA 3VDAA 2CG1A 2CWTA 3HIIA 1TQWA 4KTPA 3MUY1 1PS3A 3MV11 1TQVA 3CZJA 1JYNA 3RSYA 4AQ0A 3NBBA 1N7NA 2CQSA 1TU5A 4DUWA 1O7DD 3T2PA 3EJSA 5E1QA 3VD5A 3I3BA 1RW9A 3WA3A 3T09A 5CA3A 3BUQA 1JZ5A 2BT3A 1SNZA 3RRSA 3BVUA 1SO0A 3CZNA 3DX1A 3AMOA 2WW3A 1RWCA 2OW6A 4FNUA 4DUVA 1EKMA 1US1A 1AVKA 1JZ6A 1AV4A 1WMPA 1MMUA 1RKYA 2WVXB 2C11A 1HTYA 2CFWA 1JYXA 2JKPA 1X1JA 1CB8A
chains in the Genus database with same CATH topology
2ZXQA 1JZ4A 4NEIA 1JYWA 1N7RA 3T0BA 1NS7A 1TXKA 3SEPA 3A24A 1L7JA 1LOHA 1NSRA 5A1AA 3T2OA 2E24A 2WDAA 2X03A 3VDCA 2WVXA 1MMXA 4OJZA 2ZQ0A 1JZ8A 1LXKA 3T2QA 4BZEA 3NJXA 1K1WA 4MMIA 1HN1A 1LF6A 3ECQA 3VSMA 3DYOA 1N7PA 1K1XA 3A0OA 2JKEA 1NKGA 1RWHA 3VDBA 1NS2A 3VSNA 3OBAA 3E80A 2CIRA 1NS8A 3I3EA 2D73A 4FNVA 3OS7A 1Z45A 3K25A 3DCDA 1HM2A 3MUZ1 1OJMA 3VD4A 1JYVA 4BZGA 1EGUA 2Q1FA 4BZHA 1NSUA 2XHNA 3TY1A 1J0MA 2WVYA 4J5TA 2WCOA 1NSSA 2CISA 1F1SA 1F4HA 2XSGA 3VD3A 1YQ2A 2HTBA 3E1F1 3DYMA 1DP0A 4BZFA 1N7QA 3VD9A 1NSZA 1NSVA 3E7JA 1OJPA 2WVZA 3OB8A 1MMZA 1OJOA 4RNLA 2JKAA 3T08A 3T0AA 1L7KA 1HMUA 2BRPA 3J7HA 1OJNA 3WFAA 1HN0A 3BLCA 3NJVA 1ULVA 3T0DA 1HMWA 1JZ3A 3VDAA 5JMDA 3IAPA 3MV01 3NREA 1JZ2A 1MMYA 2E22A 1X1IA 4OK4A 1NS4A 1YGAA 3I3DA 3Q1NA 3MUY1 3MV11 3WVFA 3CZJA 1W3YA 1JYNA 2FUQA 4OK2A 4AQ0A 1N7NA 1MN0A 3DECA 1PX3A 1RWFA 4DUWA 4MMHA 1RWAA 3IMHA 1RWGA 3T2PA 5E1QA 2WW2A 3VD5A 3I3BA 1RW9A 3T09A 2FUTA 3IAQA 1LF9A 1F4AA 1JZ5A 1SNZA 1NSMA 5JMFA 3MWXA 1JOVA 1SO0A 1F9GA 1I8QA 2WW3A 4TTGA 1RWCA 1HM3A 1N7OA 1X1HA 2WZSA 3DYPA 4DUVA 2WW0A 1JZ6A 2HTAA 2BRWA 3AFLA 1MMUA 1PX4A 1UG9A 1LURA 2CIQA 1K1YA 2WVXB 2BRVX 1JZ7A 3BGAA 1J0NA 1NSXA 1LXMA 1C82A 1JYXA 2JKPA 3BS6A 2WW1A 4DUXA 1X1JA 3VD7A 1CB8A 1NS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXQ A;  1JZ4 A;  1JYW A;  1N7R A;  3T0B A;  1NS7 A;  1TXK A;  3SEP A;  3A24 A;  1L7J A;  1LOH A;  1NSR A;  5A1A A;  3T2O A;  2E24 A;  2WDA A;  2X03 A;  3VDC A;  2WVX A;  1MMX A;  2ZQ0 A;  1JZ8 A;  1LXK A;  3T2Q A;  4BZE A;  3NJX A;  1K1W A;  1HN1 A;  1LF6 A;  3ECQ A;  3DYO A;  1N7P A;  1K1X A;  2JKE A;  1NKG A;  1RWH A;  3VDB A;  1NS2 A;  3OBA A;  2CIR A;  1NS8 A;  3I3E A;  2D73 A;  3OS7 A;  1Z45 A;  3K25 A;  3DCD A;  1HM2 A;  3MUZ 1;  1OJM A;  3VD4 A;  1JYV A;  4BZG A;  1EGU A;  2Q1F A;  4BZH A;  1NSU A;  2XHN A;  1J0M A;  2WVY A;  2WCO A;  1NSS A;  2CIS A;  1F1S A;  1F4H A;  2XSG A;  3VD3 A;  1YQ2 A;  2HTB A;  3E1F 1;  3DYM A;  1DP0 A;  4BZF A;  1N7Q A;  3VD9 A;  1NSZ A;  1NSV A;  1OJP A;  2WVZ A;  3OB8 A;  1MMZ A;  1OJO A;  4RNL A;  2JKA A;  3T08 A;  3T0A A;  1L7K A;  1HMU A;  2BRP A;  3J7H A;  1OJN A;  3WFA A;  1HN0 A;  3T0D A;  3NJV A;  1ULV A;  1HMW A;  1JZ3 A;  3VDA A;  3IAP A;  3MV0 1;  3NRE A;  1JZ2 A;  1MMY A;  2E22 A;  1X1I A;  1NS4 A;  1YGA A;  3I3D A;  3Q1N A;  3MUY 1;  3MV1 1;  3CZJ A;  1W3Y A;  1JYN A;  4AQ0 A;  1N7N A;  1MN0 A;  3DEC A;  1PX3 A;  1RWF A;  4DUW A;  1RWA A;  3IMH A;  1RWG A;  3T2P A;  5E1Q A;  2WW2 A;  3VD5 A;  3I3B A;  1RW9 A;  3T09 A;  3IAQ A;  1LF9 A;  1F4A A;  1JZ5 A;  1SNZ A;  1NSM A;  3MWX A;  1JOV A;  1SO0 A;  1F9G A;  1I8Q A;  2WW3 A;  4TTG A;  1RWC A;  1HM3 A;  1N7O A;  1X1H A;  2WZS A;  3DYP A;  4DUV A;  2WW0 A;  1JZ6 A;  2HTA A;  2BRW A;  1MMU A;  1PX4 A;  1UG9 A;  1LUR A;  2CIQ A;  1K1Y A;  2WVX B;  2BRV X;  1JZ7 A;  3BGA A;  1J0N A;  1NSX A;  1LXM A;  1C82 A;  1JYX A;  2JKP A;  4DUX A;  2WW1 A;  1X1J A;  3VD7 A;  1CB8 A;  1NS0 A; 
#chains in the Genus database with same CATH topology
 2ZXQ A;  3KN4 A;  1JZ4 A;  3SEP A;  3CZS A;  1LOH A;  1NSR A;  1UI7 A;  4FNQ A;  2EAB A;  3T2Q A;  1RJO A;  1N7P A;  1D6Z A;  1NKG A;  3D52 A;  3OBA A;  3E80 A;  1PU4 A;  2W0Q A;  1QAF A;  4FNV A;  1Z45 A;  1W7C A;  3DCD A;  1V7X A;  1JYV A;  3EJU A;  1EGU A;  4FNP A;  1QX1 A;  2Q1F A;  4BZH A;  2WVY A;  3EJT A;  2CIS A;  1F1S A;  3S4D A;  1N7Q A;  1IVV A;  1A2V A;  3VD9 A;  3E7J A;  2WVZ A;  3D4Y A;  3OB8 A;  4RNL A;  3BUI A;  3MPH A;  1JZ3 A;  3MV0 1;  1WMO A;  2CFL A;  1HXK A;  1X1I A;  1NS4 A;  3I3D A;  4FNR A;  3WVF A;  3AFJ A;  3WIR A;  5GW7 A;  1IQY A;  3DEC A;  2WYI A;  1PX3 A;  3BVV A;  3DX4 A;  3AMO B;  1V7W A;  4MMH A;  1RWA A;  3IMH A;  3D3I A;  1N9E A;  2FUT A;  2CFG A;  3IAQ A;  1F4A A;  1DYU A;  2F7R A;  5JMF A;  1F9G A;  1I8Q A;  1HWW A;  2HTA A;  1PX4 A;  1IVU A;  1LUR A;  2E2V A;  1K1Y A;  1JZ7 A;  2OQE A;  1J0N A;  1LXM A;  1C82 A;  3ACT A;  2OW7 A;  4BTY A;  3VD7 A;  1JYW A;  1R34 A;  1N7R A;  3T0B A;  4BTW A;  1NS7 A;  1JRQ A;  1L7J A;  1IVW A;  2X03 A;  2C10 A;  4OJZ A;  4FNT A;  3N9H A;  1LXK A;  3BUD A;  4MMI A;  3PGB A;  3VSM A;  2CQT A;  2JKE A;  1TQT A;  3X42 A;  2OQE C;  2CWU A;  1RWH A;  3VDB A;  2Y73 A;  4EV5 A;  1NS2 A;  3VSN A;  2CIR A;  3ACS A;  3S4C A;  2XN0 A;  1D6Y A;  1W4N A;  3OS7 A;  1W2Z A;  1UI8 A;  1IU7 A;  3K25 A;  1SPU A;  3EJQ A;  3MUZ 1;  4BZG A;  3NBJ A;  3SX1 A;  2D1W A;  1YQ2 A;  2HTB A;  4BZF A;  3QG0 A;  1OJO A;  2WYH A;  1KSI A;  3X41 A;  1L7K A;  1HMU A;  3ALA A;  3WFA A;  3BLC A;  3WIQ A;  3T0D A;  1ULV A;  1HMW A;  3IAP A;  1JZ2 A;  3NRE A;  1MMY A;  3WA2 X;  3QFZ A;  2FUQ A;  4KFD A;  2ZL8 A;  2F18 A;  3QFY A;  1MN0 A;  3CV5 A;  3BUP A;  4BTX A;  4FNS A;  3W7T A;  2WW2 A;  3BUB A;  3SXX A;  1LF9 A;  3X3Y A;  2F1A A;  1NSM A;  1TQU A;  3MWX A;  2OOV A;  1R33 A;  4TTG A;  3BVX A;  1HM3 A;  1N7O A;  1X1H A;  2WZS A;  2WW0 A;  4KFE A;  3LOY A;  3AFL A;  3QDE A;  2BRV X;  1AVL A;  3HIG A;  3BVW A;  3BS6 A;  2WW1 A;  4DUX A;  3W7S A;  3MI6 A;  1NS0 A;  3LVT A;  4NEI A;  3A24 A;  3EJP A;  2WGQ A;  2E24 A;  3K5T A;  2CWV A;  4BZE A;  3NJX A;  1LF6 A;  3ECQ A;  3A0O A;  3X3X A;  3D4Z A;  1NS8 A;  2XN2 A;  2YFN A;  2YFO A;  3I3E A;  1WMN A;  2EAE A;  2F1B A;  1HM2 A;  3X40 A;  1OJM A;  3VD4 A;  3S4B A;  4KTR A;  4K3A A;  4UFC A;  1NSU A;  2XHN A;  1J0M A;  3W7U A;  2E2T A;  4J5T A;  1NSS A;  3VD3 A;  3E1F 1;  1H54 A;  3EJR A;  1NSZ A;  2F7Q A;  3S4A A;  3T08 A;  2BRP A;  1IQX A;  3J7H A;  3BLB A;  1HN0 A;  3NJV A;  5JMD A;  3W7W A;  1QWN A;  2E22 A;  4OK4 A;  3Q1N A;  1YGA A;  3D50 A;  2EAD A;  2Y74 A;  1W3Y A;  4OK2 A;  4KFF A;  2CG0 A;  3X3Z A;  3DDF A;  2E2U A;  2YX9 A;  2CFD A;  1IVX A;  1RWF A;  2F7O A;  1QWU A;  1RWG A;  3BVT A;  3DX2 A;  1SIH A;  1D6U A;  2CFK A;  1JOV A;  1V7V A;  1W5Z A;  3DYP A;  3HI7 A;  1QAL A;  2BRW A;  1UG9 A;  2CIQ A;  3BGA A;  2FYV A;  1SII A;  1NSX A;  5KBP A;  3DX0 A;  1TXK A;  2EAC A;  3DX3 A;  5A1A A;  3T2O A;  1OAC A;  2WDA A;  1QAK A;  3VDC A;  3DDG A;  1TQS A;  1MMX A;  2WVX A;  4K35 A;  2ZQ0 A;  1JZ8 A;  2WO0 A;  1K1W A;  1HN1 A;  2WOF A;  2XN1 A;  3D51 A;  2WOH A;  3DYO A;  1K1X A;  1W6G A;  4EV2 A;  2D73 A;  2RDY A;  2OOV C;  2ALW A;  1LVN A;  2PNC A;  3TY1 A;  2WCO A;  1F4H A;  2XSG A;  3DYM A;  1DP0 A;  1W6C A;  1NSV A;  1OJP A;  3T0U A;  1MMZ A;  2JKA A;  3KII A;  3T0A A;  1OJN A;  3W7X A;  2F7P A;  3VDA A;  2CG1 A;  2CWT A;  3HII A;  1TQW A;  4KTP A;  3MUY 1;  1PS3 A;  3MV1 1;  1TQV A;  3CZJ A;  1JYN A;  3RSY A;  4AQ0 A;  3NBB A;  1N7N A;  2CQS A;  1TU5 A;  4DUW A;  1O7D D;  3T2P A;  3EJS A;  5E1Q A;  3VD5 A;  3I3B A;  1RW9 A;  3WA3 A;  3T09 A;  5CA3 A;  3BUQ A;  1JZ5 A;  2BT3 A;  1SNZ A;  3RRS A;  3BVU A;  1SO0 A;  3CZN A;  3DX1 A;  3AMO A;  2WW3 A;  1RWC A;  2OW6 A;  4FNU A;  4DUV A;  1EKM A;  1US1 A;  1AVK A;  1JZ6 A;  1AV4 A;  1WMP A;  1MMU A;  1RKY A;  2WVX B;  2C11 A;  1HTY A;  2CFW A;  1JYX A;  2JKP A;  1X1J A;  1CB8 A; 
#chains in the Genus database with same CATH homology
 2ZXQ A;  1JZ4 A;  4NEI A;  1JYW A;  1N7R A;  3T0B A;  1NS7 A;  1TXK A;  3SEP A;  3A24 A;  1L7J A;  1LOH A;  1NSR A;  5A1A A;  3T2O A;  2E24 A;  2WDA A;  2X03 A;  3VDC A;  2WVX A;  1MMX A;  4OJZ A;  2ZQ0 A;  1JZ8 A;  1LXK A;  3T2Q A;  4BZE A;  3NJX A;  1K1W A;  4MMI A;  1HN1 A;  1LF6 A;  3ECQ A;  3VSM A;  3DYO A;  1N7P A;  1K1X A;  3A0O A;  2JKE A;  1NKG A;  1RWH A;  3VDB A;  1NS2 A;  3VSN A;  3OBA A;  3E80 A;  2CIR A;  1NS8 A;  3I3E A;  2D73 A;  4FNV A;  3OS7 A;  1Z45 A;  3K25 A;  3DCD A;  1HM2 A;  3MUZ 1;  1OJM A;  3VD4 A;  1JYV A;  4BZG A;  1EGU A;  2Q1F A;  4BZH A;  1NSU A;  2XHN A;  3TY1 A;  1J0M A;  2WVY A;  4J5T A;  2WCO A;  1NSS A;  2CIS A;  1F1S A;  1F4H A;  2XSG A;  3VD3 A;  1YQ2 A;  2HTB A;  3E1F 1;  3DYM A;  1DP0 A;  4BZF A;  1N7Q A;  3VD9 A;  1NSZ A;  1NSV A;  3E7J A;  1OJP A;  2WVZ A;  3OB8 A;  1MMZ A;  1OJO A;  4RNL A;  2JKA A;  3T08 A;  3T0A A;  1L7K A;  1HMU A;  2BRP A;  3J7H A;  1OJN A;  3WFA A;  1HN0 A;  3BLC A;  3NJV A;  1ULV A;  3T0D A;  1HMW A;  1JZ3 A;  3VDA A;  5JMD A;  3IAP A;  3MV0 1;  3NRE A;  1JZ2 A;  1MMY A;  2E22 A;  1X1I A;  4OK4 A;  1NS4 A;  1YGA A;  3I3D A;  3Q1N A;  3MUY 1;  3MV1 1;  3WVF A;  3CZJ A;  1W3Y A;  1JYN A;  2FUQ A;  4OK2 A;  4AQ0 A;  1N7N A;  1MN0 A;  3DEC A;  1PX3 A;  1RWF A;  4DUW A;  4MMH A;  1RWA A;  3IMH A;  1RWG A;  3T2P A;  5E1Q A;  2WW2 A;  3VD5 A;  3I3B A;  1RW9 A;  3T09 A;  2FUT A;  3IAQ A;  1LF9 A;  1F4A A;  1JZ5 A;  1SNZ A;  1NSM A;  5JMF A;  3MWX A;  1JOV A;  1SO0 A;  1F9G A;  1I8Q A;  2WW3 A;  4TTG A;  1RWC A;  1HM3 A;  1N7O A;  1X1H A;  2WZS A;  3DYP A;  4DUV A;  2WW0 A;  1JZ6 A;  2HTA A;  2BRW A;  3AFL A;  1MMU A;  1PX4 A;  1UG9 A;  1LUR A;  2CIQ A;  1K1Y A;  2WVX B;  2BRV X;  1JZ7 A;  3BGA A;  1J0N A;  1NSX A;  1LXM A;  1C82 A;  1JYX A;  2JKP A;  3BS6 A;  2WW1 A;  4DUX A;  1X1J A;  3VD7 A;  1CB8 A;  1NS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...