3BS6A

1.8 angstrom crystal structure of the periplasmic domain of the membrane insertase yidc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
271
structure length
258
Chain Sequence
b'KLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPTFRGAAYSTPDEKYEKYKFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inner membrane protein oxaA
publication title The Crystal Structure of the Periplasmic Domain of the Escherichia coli Membrane Protein Insertase YidC Contains a Substrate Binding Cleft
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, protein transport
total genus 57
structure length 258
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.90 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3bs6A00
3WVFA 3BS6A 3BLCA
chains in the Genus database with same CATH superfamily
3DDGA 1X1HA 3AFJA 3K25A 1NSXA 5GW7A 1JYNA 2HTBA 1OJOA 3AMOB 3WVFA 1I8QA 1MMZA 1YQ2A 1K1XA 3MI6A 3DX1A 1NSUA 5CA3A 1NS0A 2XSGA 1F9GA 2D73A 2OOVC 3D3IA 3MPHA 3SXXA 3MWXA 1QWUA 2WCOA 1K1WA 3EJRA 1JZ7A 3DYPA 1JZ5A 2E2UA 3BVWA 4FNRA 3W7UA 3K5TA 1JZ4A 2CG0A 3DX3A 2E2TA 3D4YA 1JRQA 3OS7A 1N7NA 2HTAA 1W6GA 3T08A 3BVTA 2WZSA 1OACA 1V7XA 3W7SA 4BZEA 2F7RA 3EJSA 1LF9A 3RSYA 2WDAA 1IVVA 1NSSA 1X1JA 3NJXA 3KIIA 4FNPA 3BVVA 4KTRA 2XN2A 1AVKA 2CFLA 3I3EA 2D1WA 2C10A 2FYVA 3VD3A 1L7KA 3ACTA 3BUQA 3T0AA 4OK2A 2F1BA 2F1AA 2WOFA 1TQSA 4MMHA 1JZ6A 4NEIA 2BRWA 3SX1A 2CFWA 1JZ2A 3HI7A 1R33A 3T2QA 3W7WA 1RWHA 2CIRA 2WGQA 1TQTA 1SIHA 1H54A 1L7JA 4FNSA 2CQSA 4BZFA 3KN4A 1EGUA 2CWUA 2JKPA 1N7RA 3VD9A 2BT3A 3MV11 3DCDA 2WW1A 3NBBA 4FNQA 3N9HA 1LXKA 3OBAA 1JYXA 3D4ZA 3A0OA 1HTYA 1TQWA 2F7QA 1N7OA 3RRSA 1N7PA 4DUXA 1NSRA 1SNZA 3D50A 3BLCA 1NS2A 1IVXA 2WOHA 2EAEA 1UI7A 3MV01 3E1F1 1R34A 4J5TA 2WVZA 3WFAA 2Y74A 2WW3A 4AQ0A 4KFEA 3WIRA 3LVTA 4BTYA 1JYVA 3NREA 2ALWA 1F1SA 1EKMA 1SPUA 4OK4A 3X40A 4FNTA 1LURA 1PU4A 1HN1A 1IVUA 1US1A 1F4AA 1HN0A 3SEPA 3CZSA 3X3ZA 1MN0A 1AVLA 3LOYA 2JKEA 4FNUA 3WA3A 4DUWA 1WMPA 3VDCA 3IAQA 3ALAA 2ZL8A 3T2PA 5JMDA 1HM2A 3HIGA 1W6CA 1RWFA 3S4BA 1NS7A 3DECA 2OQEA 3S4AA 4MMIA 1TQVA 2E2VA 3D52A 3EJTA 1W7CA 3I3DA 3BS6A 1OJPA 2ZXQA 3HIIA 3QG0A 3TY1A 2E24A 2F18A 3BGAA 2JKAA 1QAKA 1IU7A 1TXKA 3WIQA 1OJNA 1V7VA 1DP0A 1MMYA 1QWNA 2CIQA 2XN1A 1V7WA 1AV4A 2EADA 3CV5A 3CZJA 3ACSA 3VSMA 3VD4A 1N7QA 1X1IA 2ZQ0A 2W0QA 1LXMA 3W7XA 1W4NA 3T0BA 1W2ZA 3I3BA 2YFOA 3MUY1 4KFFA 3DX0A 3X3YA 2OW6A 3DX2A 1RWCA 1OJMA 3D51A 5E1QA 2Q1FA 2WYHA 4FNVA 3S4CA 2BRVX 1JZ3A 2WVXA 1UG9A 4K35A 4RNLA 4TTGA 2OQEC 3QDEA 1IQXA 1UI8A 4BZGA 2CFKA 1IVWA 3X3XA 3BVXA 3VSNA 1RWGA 3BVUA 1J0MA 1YGAA 4BTWA 1PX3A 1D6UA 1LVNA 1W5ZA 5A1AA 3MUZ1 1RW9A 3ECQA 2YX9A 2XHNA 1JOVA 3AMOA 2PNCA 1MMXA 2WYIA 1TU5A 1PX4A 3DX4A 3QFYA 1PS3A 3PGBA 3T09A 2CQTA 3VDBA 4UFCA 2EABA 1NSZA 1MMUA 1SIIA 4EV5A 1RWAA 1HMWA 2FUTA 1LF6A 2Y73A 2FUQA 3BLBA 1F4HA 1WMOA 4BTXA 1Z45A 3E7JA 2CG1A 1HWWA 1A2VA 1RJOA 1QX1A 1WMNA 3IAPA 3QFZA 4K3AA 2EACA 1HMUA 3E80A 1NS8A 1LOHA 3VDAA 1JZ8A 3WA2X 1N9EA 3AFLA 3EJQA 2CFDA 2WW0A 3BUDA 2C11A 4KTPA 1NSVA 3W7TA 3IMHA 5JMFA 1RKYA 3T0UA 4KFDA 2OW7A 1SO0A 3T0DA 3X42A 4BZHA 3Q1NA 1J0NA 2OOVA 1D6YA 2WO0A 2WVYA 2RDYA 1C82A 1KSIA 3EJUA 3NJVA 4OJZA 2F7PA 3X41A 1CB8A 1NSMA 1QALA 2BRPA 2YFNA 1O7DD 2F7OA 3DDFA 4EV2A 3OB8A 3J7HA 3NBJA 1TQUA 1QAFA 3CZNA 1IQYA 3VD7A 3DYOA 3VD5A 5KBPA 3BUBA 2CISA 2WVXB 2E22A 1ULVA 2XN0A 3EJPA 1JYWA 3BUPA 3T2OA 2CWVA 1NS4A 1HXKA 1K1YA 1DYUA 1W3YA 4DUVA 3S4DA 1NKGA 2WW2A 2CWTA 3DYMA 1D6ZA 3A24A 2X03A 3BUIA 1HM3A 2CFGA
chains in the Genus database with same CATH topology
3T09A 3BS6A 1OJPA 1L7JA 1X1HA 4BZFA 2ZXQA 3VDBA 3K25A 1NSXA 1NSZA 3TY1A 1MMUA 1JYNA 1EGUA 2HTBA 1OJOA 3WVFA 2E24A 2JKPA 3BGAA 1I8QA 2JKAA 1N7RA 1RWAA 1HMWA 2FUTA 3I3DA 1MMZA 1LF6A 3VD9A 1YQ2A 1TXKA 2FUQA 1F4HA 3MV11 1K1XA 1Z45A 3DCDA 2WW1A 1OJNA 3E7JA 1LXKA 1DP0A 1MMYA 2CIQA 3OBAA 1JYXA 3IAPA 3A0OA 1NSUA 1N7OA 1HMUA 3E80A 3CZJA 1N7PA 1NS8A 4DUXA 1NS0A 1NSRA 2XSGA 1LOHA 1SNZA 1F9GA 3VDAA 2D73A 1JZ8A 3BLCA 3VSMA 3AFLA 3VD4A 3MWXA 1NS2A 1N7QA 1X1IA 2WCOA 1K1WA 2ZQ0A 1JZ7A 1LXMA 2WW0A 3MV01 3DYPA 1NSVA 3E1F1 3IMHA 3T0BA 1JZ5A 3I3BA 4J5TA 2WVZA 3MUY1 3WFAA 5JMFA 1JZ4A 2WW3A 4AQ0A 1SO0A 3OS7A 3T0DA 1RWCA 1N7NA 4BZHA 3Q1NA 1J0NA 3NREA 1OJMA 1JYVA 2WVYA 1F1SA 1C82A 5E1QA 3NJVA 2HTAA 4OJZA 3T08A 4OK4A 2Q1FA 1CB8A 4FNVA 1LURA 1NSMA 2WZSA 1HN1A 2BRPA 2BRVX 1JZ3A 1F4AA 2WVXA 4BZEA 1HN0A 1UG9A 3SEPA 1MN0A 1LF9A 4RNLA 4TTGA 2WDAA 1NSSA 1X1JA 2JKEA 4BZGA 3OB8A 3J7HA 4DUWA 3NJXA 3VDCA 3IAQA 3VD7A 3I3EA 3T2PA 3DYOA 3VD5A 5JMDA 1HM2A 3VSNA 3VD3A 1L7KA 3T0AA 1RWFA 2CISA 2WVXB 4OK2A 2E22A 1ULVA 1RWGA 1JYWA 3T2OA 1J0MA 1NS4A 1YGAA 1PX3A 1NS7A 4MMHA 1JZ6A 4NEIA 2BRWA 1K1YA 3MUZ1 5A1AA 1JZ2A 3DECA 1RW9A 1W3YA 3ECQA 4DUVA 2XHNA 1NKGA 4MMIA 2WW2A 1JOVA 3T2QA 1MMXA 3DYMA 1PX4A 1RWHA 3A24A 2CIRA 2X03A 1HM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVF A;  3BS6 A;  3BLC A; 
#chains in the Genus database with same CATH topology
 3DDG A;  1X1H A;  3AFJ A;  3K25 A;  1NSX A;  5GW7 A;  1JYN A;  2HTB A;  1OJO A;  3AMO B;  3WVF A;  1I8Q A;  1MMZ A;  1YQ2 A;  1K1X A;  3MI6 A;  3DX1 A;  1NSU A;  5CA3 A;  1NS0 A;  2XSG A;  1F9G A;  2D73 A;  2OOV C;  3D3I A;  3MPH A;  3SXX A;  3MWX A;  1QWU A;  2WCO A;  1K1W A;  3EJR A;  1JZ7 A;  3DYP A;  1JZ5 A;  2E2U A;  3BVW A;  4FNR A;  3W7U A;  3K5T A;  1JZ4 A;  2CG0 A;  3DX3 A;  2E2T A;  3D4Y A;  1JRQ A;  3OS7 A;  1N7N A;  2HTA A;  1W6G A;  3T08 A;  3BVT A;  2WZS A;  1OAC A;  1V7X A;  3W7S A;  4BZE A;  2F7R A;  3EJS A;  1LF9 A;  3RSY A;  2WDA A;  1IVV A;  1NSS A;  1X1J A;  3NJX A;  3KII A;  4FNP A;  3BVV A;  4KTR A;  2XN2 A;  1AVK A;  2CFL A;  3I3E A;  2D1W A;  2C10 A;  2FYV A;  3VD3 A;  1L7K A;  3ACT A;  3BUQ A;  3T0A A;  4OK2 A;  2F1B A;  2F1A A;  2WOF A;  1TQS A;  4MMH A;  1JZ6 A;  4NEI A;  2BRW A;  3SX1 A;  2CFW A;  1JZ2 A;  3HI7 A;  1R33 A;  3T2Q A;  3W7W A;  1RWH A;  2CIR A;  2WGQ A;  1TQT A;  1SIH A;  1H54 A;  1L7J A;  4FNS A;  2CQS A;  4BZF A;  3KN4 A;  1EGU A;  2CWU A;  2JKP A;  1N7R A;  3VD9 A;  2BT3 A;  3MV1 1;  3DCD A;  2WW1 A;  3NBB A;  4FNQ A;  3N9H A;  1LXK A;  3OBA A;  1JYX A;  3D4Z A;  3A0O A;  1HTY A;  1TQW A;  2F7Q A;  1N7O A;  3RRS A;  1N7P A;  4DUX A;  1NSR A;  1SNZ A;  3D50 A;  3BLC A;  1NS2 A;  1IVX A;  2WOH A;  2EAE A;  1UI7 A;  3MV0 1;  3E1F 1;  1R34 A;  4J5T A;  2WVZ A;  3WFA A;  2Y74 A;  2WW3 A;  4AQ0 A;  4KFE A;  3WIR A;  3LVT A;  4BTY A;  1JYV A;  3NRE A;  2ALW A;  1F1S A;  1EKM A;  1SPU A;  4OK4 A;  3X40 A;  4FNT A;  1LUR A;  1PU4 A;  1HN1 A;  1IVU A;  1US1 A;  1F4A A;  1HN0 A;  3SEP A;  3CZS A;  3X3Z A;  1MN0 A;  1AVL A;  3LOY A;  2JKE A;  4FNU A;  3WA3 A;  4DUW A;  1WMP A;  3VDC A;  3IAQ A;  3ALA A;  2ZL8 A;  3T2P A;  5JMD A;  1HM2 A;  3HIG A;  1W6C A;  1RWF A;  3S4B A;  1NS7 A;  3DEC A;  2OQE A;  3S4A A;  4MMI A;  1TQV A;  2E2V A;  3D52 A;  3EJT A;  1W7C A;  3I3D A;  3BS6 A;  1OJP A;  2ZXQ A;  3HII A;  3QG0 A;  3TY1 A;  2E24 A;  2F18 A;  3BGA A;  2JKA A;  1QAK A;  1IU7 A;  1TXK A;  3WIQ A;  1OJN A;  1V7V A;  1DP0 A;  1MMY A;  1QWN A;  2CIQ A;  2XN1 A;  1V7W A;  1AV4 A;  2EAD A;  3CV5 A;  3CZJ A;  3ACS A;  3VSM A;  3VD4 A;  1N7Q A;  1X1I A;  2ZQ0 A;  2W0Q A;  1LXM A;  3W7X A;  1W4N A;  3T0B A;  1W2Z A;  3I3B A;  2YFO A;  3MUY 1;  4KFF A;  3DX0 A;  3X3Y A;  2OW6 A;  3DX2 A;  1RWC A;  1OJM A;  3D51 A;  5E1Q A;  2Q1F A;  2WYH A;  4FNV A;  3S4C A;  2BRV X;  1JZ3 A;  2WVX A;  1UG9 A;  4K35 A;  4RNL A;  4TTG A;  2OQE C;  3QDE A;  1IQX A;  1UI8 A;  4BZG A;  2CFK A;  1IVW A;  3X3X A;  3BVX A;  3VSN A;  1RWG A;  3BVU A;  1J0M A;  1YGA A;  4BTW A;  1PX3 A;  1D6U A;  1LVN A;  1W5Z A;  5A1A A;  3MUZ 1;  1RW9 A;  3ECQ A;  2YX9 A;  2XHN A;  1JOV A;  3AMO A;  2PNC A;  1MMX A;  2WYI A;  1TU5 A;  1PX4 A;  3DX4 A;  3QFY A;  1PS3 A;  3PGB A;  3T09 A;  2CQT A;  3VDB A;  4UFC A;  2EAB A;  1NSZ A;  1MMU A;  1SII A;  4EV5 A;  1RWA A;  1HMW A;  2FUT A;  1LF6 A;  2Y73 A;  2FUQ A;  3BLB A;  1F4H A;  1WMO A;  4BTX A;  1Z45 A;  3E7J A;  2CG1 A;  1HWW A;  1A2V A;  1RJO A;  1QX1 A;  1WMN A;  3IAP A;  3QFZ A;  4K3A A;  2EAC A;  1HMU A;  3E80 A;  1NS8 A;  1LOH A;  3VDA A;  1JZ8 A;  3WA2 X;  1N9E A;  3AFL A;  3EJQ A;  2CFD A;  2WW0 A;  3BUD A;  2C11 A;  4KTP A;  1NSV A;  3W7T A;  3IMH A;  5JMF A;  1RKY A;  3T0U A;  4KFD A;  2OW7 A;  1SO0 A;  3T0D A;  3X42 A;  4BZH A;  3Q1N A;  1J0N A;  2OOV A;  1D6Y A;  2WO0 A;  2WVY A;  2RDY A;  1C82 A;  1KSI A;  3EJU A;  3NJV A;  4OJZ A;  2F7P A;  3X41 A;  1CB8 A;  1NSM A;  1QAL A;  2BRP A;  2YFN A;  1O7D D;  2F7O A;  3DDF A;  4EV2 A;  3OB8 A;  3J7H A;  3NBJ A;  1TQU A;  1QAF A;  3CZN A;  1IQY A;  3VD7 A;  3DYO A;  3VD5 A;  5KBP A;  3BUB A;  2CIS A;  2WVX B;  2E22 A;  1ULV A;  2XN0 A;  3EJP A;  1JYW A;  3BUP A;  3T2O A;  2CWV A;  1NS4 A;  1HXK A;  1K1Y A;  1DYU A;  1W3Y A;  4DUV A;  3S4D A;  1NKG A;  2WW2 A;  2CWT A;  3DYM A;  1D6Z A;  3A24 A;  2X03 A;  3BUI A;  1HM3 A;  2CFG A; 
#chains in the Genus database with same CATH homology
 3T09 A;  3BS6 A;  1OJP A;  1L7J A;  1X1H A;  4BZF A;  2ZXQ A;  3VDB A;  3K25 A;  1NSX A;  1NSZ A;  3TY1 A;  1MMU A;  1JYN A;  1EGU A;  2HTB A;  1OJO A;  3WVF A;  2E24 A;  2JKP A;  3BGA A;  1I8Q A;  2JKA A;  1N7R A;  1RWA A;  1HMW A;  2FUT A;  3I3D A;  1MMZ A;  1LF6 A;  3VD9 A;  1YQ2 A;  1TXK A;  2FUQ A;  1F4H A;  3MV1 1;  1K1X A;  1Z45 A;  3DCD A;  2WW1 A;  1OJN A;  3E7J A;  1LXK A;  1DP0 A;  1MMY A;  2CIQ A;  3OBA A;  1JYX A;  3IAP A;  3A0O A;  1NSU A;  1N7O A;  1HMU A;  3E80 A;  3CZJ A;  1N7P A;  1NS8 A;  4DUX A;  1NS0 A;  1NSR A;  2XSG A;  1LOH A;  1SNZ A;  1F9G A;  3VDA A;  2D73 A;  1JZ8 A;  3BLC A;  3VSM A;  3AFL A;  3VD4 A;  3MWX A;  1NS2 A;  1N7Q A;  1X1I A;  2WCO A;  1K1W A;  2ZQ0 A;  1JZ7 A;  1LXM A;  2WW0 A;  3MV0 1;  3DYP A;  1NSV A;  3E1F 1;  3IMH A;  3T0B A;  1JZ5 A;  3I3B A;  4J5T A;  2WVZ A;  3MUY 1;  3WFA A;  5JMF A;  1JZ4 A;  2WW3 A;  4AQ0 A;  1SO0 A;  3OS7 A;  3T0D A;  1RWC A;  1N7N A;  4BZH A;  3Q1N A;  1J0N A;  3NRE A;  1OJM A;  1JYV A;  2WVY A;  1F1S A;  1C82 A;  5E1Q A;  3NJV A;  2HTA A;  4OJZ A;  3T08 A;  4OK4 A;  2Q1F A;  1CB8 A;  4FNV A;  1LUR A;  1NSM A;  2WZS A;  1HN1 A;  2BRP A;  2BRV X;  1JZ3 A;  1F4A A;  2WVX A;  4BZE A;  1HN0 A;  1UG9 A;  3SEP A;  1MN0 A;  1LF9 A;  4RNL A;  4TTG A;  2WDA A;  1NSS A;  1X1J A;  2JKE A;  4BZG A;  3OB8 A;  3J7H A;  4DUW A;  3NJX A;  3VDC A;  3IAQ A;  3VD7 A;  3I3E A;  3T2P A;  3DYO A;  3VD5 A;  5JMD A;  1HM2 A;  3VSN A;  3VD3 A;  1L7K A;  3T0A A;  1RWF A;  2CIS A;  2WVX B;  4OK2 A;  2E22 A;  1ULV A;  1RWG A;  1JYW A;  3T2O A;  1J0M A;  1NS4 A;  1YGA A;  1PX3 A;  1NS7 A;  4MMH A;  1JZ6 A;  4NEI A;  2BRW A;  1K1Y A;  3MUZ 1;  5A1A A;  1JZ2 A;  3DEC A;  1RW9 A;  1W3Y A;  3ECQ A;  4DUV A;  2XHN A;  1NKG A;  4MMI A;  2WW2 A;  1JOV A;  3T2Q A;  1MMX A;  3DYM A;  1PX4 A;  1RWH A;  3A24 A;  2CIR A;  2X03 A;  1HM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...