3BS6A

1.8 angstrom crystal structure of the periplasmic domain of the membrane insertase yidc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
271
structure length
258
Chain Sequence
KLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPTFRGAAYSTPDEKYEKYKFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, protein transport
molecule keywords Inner membrane protein oxaA
publication title The Crystal Structure of the Periplasmic Domain of the Escherichia coli Membrane Protein Insertase YidC Contains a Substrate Binding Cleft
pubmed doi rcsb
source organism Escherichia coli
total genus 57
structure length 258
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.90 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3bs6A00
3BLCA 3BS6A 3WVFA
chains in the Genus database with same CATH superfamily
4FNRA 2CIRA 2XN0A 3I3EA 4KFFA 2F7OA 3MV01 1DP0A 1F4HA 1OJNA 1NS7A 2YFNA 3EJQA 3WVFA 2XN2A 2WW1A 1IVVA 1TQTA 3NJXA 5E1QA 4AQ0A 3MUY1 3BS6A 3BUDA 3D4YA 1LF6A 1UI7A 2WW2A 5A1AA 3DYPA 3ACTA 3WIRA 3BVUA 1PS3A 1SIHA 2F7RA 3WFAA 1K1XA 1DYUA 2Q1FA 4TTGA 3DX0A 1AVLA 3T0AA 3DYMA 2OW6A 2E22A 1HWWA 3DDFA 4EV5A 4RNLA 3VDAA 3EJSA 5JMFA 2EACA 2CFGA 1HTYA 2EABA 1RJOA 1J0MA 3QFYA 2BRVX 1TU5A 1NS8A 2OOVA 3BUQA 1SIIA 1NKGA 3OS7A 2XSGA 2WOHA 1SNZA 2F7QA 3DYOA 3PGBA 1N9EA 4OK2A 3BLCA 1LXKA 4DUVA 1RWAA 1IVWA 3KN4A 4BTWA 4K3AA 3EJPA 3HI7A 1HXKA 1N7OA 3X40A 3ALAA 1US1A 2ZQ0A 4FNSA 1AV4A 3AFJA 1TQSA 3T0UA 2WZSA 1D6YA 2JKPA 1QALA 2D1WA 3NREA 3W7UA 1TXKA 1HMWA 1K1YA 4BZEA 1QWUA 2CIQA 1JZ2A 4FNUA 3TY1A 3X42A 3VD3A 3VDBA 2WO0A 1X1JA 2ZXQA 2YFOA 3T08A 1NSUA 3E7JA 4BTYA 1JYVA 2WYHA 2CQSA 2WVZA 3AFLA 1AVKA 1F1SA 3OBAA 1UI8A 3HIGA 4DUXA 2WYIA 3X41A 4KTPA 1D6ZA 2CISA 1HN0A 3VDCA 4BTXA 1MMXA 1RWCA 1EKMA 3LVTA 3T09A 2BRPA 3DECA 1F9GA 2CWTA 1ULVA 1JRQA 3MV11 1Z45A 1R34A 3BGAA 2CWUA 3BUPA 1EGUA 2F7PA 2BRWA 2HTAA 3EJRA 1X1IA 2Y73A 3VD5A 4BZFA 1N7PA 1JZ5A 3T2PA 1WMPA 2W0QA 2F18A 4K35A 2OQEA 3NBJA 1JOVA 3WA3A 3BUIA 2Y74A 3EJTA 1D6UA 3VD4A 1CB8A 1WMOA 3EJUA 3IAQA 1QAFA 1I8QA 4BZGA 3CV5A 1LF9A 4OJZA 3ECQA 1SO0A 4KTRA 2ALWA 1NSXA 3HIIA 1QAKA 3MUZ1 3MPHA 1YGAA 3IMHA 3S4BA 1KSIA 1JZ8A 1UG9A 2E2VA 3ACSA 3CZNA 4KFEA 2F1AA 1PX4A 3D51A 1PX3A 1NS4A 3DX1A 3MI6A 3W7WA 1HM2A 2WCOA 3DDGA 4KFDA 3CZJA 1JYWA 2OW7A 1LXMA 5JMDA 3K25A 3AMOA 3NJVA 1RW9A 3SXXA 2WDAA 5GW7A 2D73A 2C10A 3SX1A 3BVXA 1JZ4A 1SPUA 3D52A 3N9HA 1PU4A 2E2UA 1IVXA 1V7XA 4FNVA 3W7SA 3S4DA 2WVXA 3NBBA 2PNCA 2FUQA 2XHNA 3VD9A 1JYXA 1RWFA 1QWNA 4FNPA 1W6CA 4MMHA 3X3YA 2JKAA 5KBPA 2OQEC 1TQVA 1IQXA 3BVVA 3KIIA 3D50A 1QX1A 1LOHA 1W6GA 1TQUA 3QG0A 1W2ZA 2X03A 3SEPA 2EADA 1OJMA 2OOVC 3E80A 1TQWA 1V7WA 5CA3A 2CFLA 3OB8A 1LVNA 1W4NA 2HTBA 3E1F1 1C82A 1N7QA 4DUWA 1IU7A 3S4AA 1MMUA 1RKYA 1LURA 3RSYA 1A2VA 3BLBA 3DCDA 3IAPA 3WIQA 1R33A 3DX4A 1NSRA 1RWGA 1MMYA 2XN1A 3X3XA 1L7JA 3D3IA 3DX3A 2EAEA 1W5ZA 3VSNA 4UFCA 3X3ZA 4FNTA 3QDEA 1HM3A 2CG1A 2WGQA 2CG0A 3I3BA 2WOFA 3VD7A 4NEIA 2C11A 3VSMA 2FUTA 1N7RA 3DX2A 1MN0A 1IVUA 1RWHA 2F1BA 2RDYA 1OJOA 1NS0A 2CWVA 3CZSA 1H54A 2E24A 1K1WA 1X1HA 4EV2A 1N7NA 3A24A 3T0DA 2ZL8A 4OK4A 1HMUA 2CQTA 3AMOB 2E2TA 3T2QA 1NSZA 3LOYA 1V7VA 2BT3A 3T0BA 1W3YA 4BZHA 1NSVA 4FNQA 3MWXA 3BVTA 1JYNA 3S4CA 1MMZA 4J5TA 2JKEA 1WMNA 2FYVA 3I3DA 1J0NA 3Q1NA 3D4ZA 1HN1A 2WVXB 2CFWA 4MMIA 3BUBA 1JZ7A 1NS2A 1F4AA 2CFKA 3QFZA 1O7DD 1OJPA 3T2OA 3BVWA 1NSMA 2WW3A 2YX9A 1YQ2A 3W7XA 1OACA 2CFDA 2WVYA 1W7CA 2WW0A 1JZ3A 3K5TA 3RRSA 3A0OA 3W7TA 1NSSA 1IQYA 1JZ6A 3J7HA 3WA2X 1L7KA
chains in the Genus database with same CATH topology
1HMWA 1PX4A 1K1YA 4BZEA 2CIQA 1PX3A 2CIRA 1JZ2A 3I3EA 3TY1A 1NS4A 3VD3A 3VDBA 1X1JA 1HM3A 2ZXQA 3MV01 1DP0A 1F4HA 1HM2A 1OJNA 2WCOA 3T08A 1NS7A 1NSUA 3E7JA 1JYVA 3WVFA 2WW1A 3CZJA 1JYWA 3I3BA 2WVZA 3AFLA 1LXMA 5JMDA 1F1SA 3OBAA 3VD7A 3NJXA 5E1QA 3K25A 4AQ0A 4DUXA 3MUY1 3BS6A 3NJVA 4NEIA 1RW9A 1LF6A 2WW2A 3VSMA 2FUTA 5A1AA 1N7RA 1MN0A 2WDAA 2CISA 2D73A 1RWHA 1HN0A 3DYPA 3VDCA 1MMXA 1RWCA 1JZ4A 3WFAA 1K1XA 1OJOA 1NS0A 2Q1FA 3T09A 2BRPA 3DECA 4TTGA 3T0AA 3DYMA 2E22A 1F9GA 2E24A 4FNVA 1K1WA 1ULVA 4RNLA 3VDAA 2WVXA 3MV11 1Z45A 5JMFA 1X1HA 3BGAA 2FUQA 1N7NA 1EGUA 3A24A 1J0MA 2BRWA 2HTAA 3T0DA 2XHNA 4OK4A 1HMUA 3VD9A 1JYXA 1X1IA 1RWFA 2BRVX 1NS8A 3T2QA 1NSZA 4MMHA 3T0BA 1W3YA 3VD5A 1NSVA 2JKAA 4BZFA 4BZHA 1N7PA 1JZ5A 3T2PA 3MWXA 1NKGA 1JYNA 1MMZA 1JOVA 2XSGA 3OS7A 4J5TA 1SNZA 3DYOA 2JKEA 3I3DA 4OK2A 1LOHA 1J0NA 3Q1NA 3BLCA 1LXKA 3VD4A 4DUVA 1CB8A 1RWAA 1HN1A 3IAQA 2X03A 2WVXB 4MMIA 3SEPA 1JZ7A 1OJMA 1I8QA 3E80A 1NS2A 4BZGA 1LF9A 4OJZA 3ECQA 1SO0A 1N7OA 1F4AA 1NSXA 3OB8A 1OJPA 2HTBA 3MUZ1 2ZQ0A 3T2OA 3E1F1 1NSMA 2WW3A 1C82A 1YQ2A 1N7QA 2WVYA 4DUWA 1YGAA 2WW0A 1MMUA 3IMHA 1JZ3A 1LURA 2WZSA 2JKPA 1JZ8A 3A0OA 3DCDA 3IAPA 1NSSA 3NREA 1UG9A 1JZ6A 1NSRA 1RWGA 1MMYA 3J7HA 1L7KA 1L7JA 1TXKA 3VSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLC A;  3BS6 A;  3WVF A; 
#chains in the Genus database with same CATH topology
 4FNR A;  2CIR A;  2XN0 A;  3I3E A;  4KFF A;  2F7O A;  3MV0 1;  1DP0 A;  1F4H A;  1OJN A;  1NS7 A;  2YFN A;  3EJQ A;  3WVF A;  2XN2 A;  2WW1 A;  1IVV A;  1TQT A;  3NJX A;  5E1Q A;  4AQ0 A;  3MUY 1;  3BS6 A;  3BUD A;  3D4Y A;  1LF6 A;  1UI7 A;  2WW2 A;  5A1A A;  3DYP A;  3ACT A;  3WIR A;  3BVU A;  1PS3 A;  1SIH A;  2F7R A;  3WFA A;  1K1X A;  1DYU A;  2Q1F A;  4TTG A;  3DX0 A;  1AVL A;  3T0A A;  3DYM A;  2OW6 A;  2E22 A;  1HWW A;  3DDF A;  4EV5 A;  4RNL A;  3VDA A;  3EJS A;  5JMF A;  2EAC A;  2CFG A;  1HTY A;  2EAB A;  1RJO A;  1J0M A;  3QFY A;  2BRV X;  1TU5 A;  1NS8 A;  2OOV A;  3BUQ A;  1SII A;  1NKG A;  3OS7 A;  2XSG A;  2WOH A;  1SNZ A;  2F7Q A;  3DYO A;  3PGB A;  1N9E A;  4OK2 A;  3BLC A;  1LXK A;  4DUV A;  1RWA A;  1IVW A;  3KN4 A;  4BTW A;  4K3A A;  3EJP A;  3HI7 A;  1HXK A;  1N7O A;  3X40 A;  3ALA A;  1US1 A;  2ZQ0 A;  4FNS A;  1AV4 A;  3AFJ A;  1TQS A;  3T0U A;  2WZS A;  1D6Y A;  2JKP A;  1QAL A;  2D1W A;  3NRE A;  3W7U A;  1TXK A;  1HMW A;  1K1Y A;  4BZE A;  1QWU A;  2CIQ A;  1JZ2 A;  4FNU A;  3TY1 A;  3X42 A;  3VD3 A;  3VDB A;  2WO0 A;  1X1J A;  2ZXQ A;  2YFO A;  3T08 A;  1NSU A;  3E7J A;  4BTY A;  1JYV A;  2WYH A;  2CQS A;  2WVZ A;  3AFL A;  1AVK A;  1F1S A;  3OBA A;  1UI8 A;  3HIG A;  4DUX A;  2WYI A;  3X41 A;  4KTP A;  1D6Z A;  2CIS A;  1HN0 A;  3VDC A;  4BTX A;  1MMX A;  1RWC A;  1EKM A;  3LVT A;  3T09 A;  2BRP A;  3DEC A;  1F9G A;  2CWT A;  1ULV A;  1JRQ A;  3MV1 1;  1Z45 A;  1R34 A;  3BGA A;  2CWU A;  3BUP A;  1EGU A;  2F7P A;  2BRW A;  2HTA A;  3EJR A;  1X1I A;  2Y73 A;  3VD5 A;  4BZF A;  1N7P A;  1JZ5 A;  3T2P A;  1WMP A;  2W0Q A;  2F18 A;  4K35 A;  2OQE A;  3NBJ A;  1JOV A;  3WA3 A;  3BUI A;  2Y74 A;  3EJT A;  1D6U A;  3VD4 A;  1CB8 A;  1WMO A;  3EJU A;  3IAQ A;  1QAF A;  1I8Q A;  4BZG A;  3CV5 A;  1LF9 A;  4OJZ A;  3ECQ A;  1SO0 A;  4KTR A;  2ALW A;  1NSX A;  3HII A;  1QAK A;  3MUZ 1;  3MPH A;  1YGA A;  3IMH A;  3S4B A;  1KSI A;  1JZ8 A;  1UG9 A;  2E2V A;  3ACS A;  3CZN A;  4KFE A;  2F1A A;  1PX4 A;  3D51 A;  1PX3 A;  1NS4 A;  3DX1 A;  3MI6 A;  3W7W A;  1HM2 A;  2WCO A;  3DDG A;  4KFD A;  3CZJ A;  1JYW A;  2OW7 A;  1LXM A;  5JMD A;  3K25 A;  3AMO A;  3NJV A;  1RW9 A;  3SXX A;  2WDA A;  5GW7 A;  2D73 A;  2C10 A;  3SX1 A;  3BVX A;  1JZ4 A;  1SPU A;  3D52 A;  3N9H A;  1PU4 A;  2E2U A;  1IVX A;  1V7X A;  4FNV A;  3W7S A;  3S4D A;  2WVX A;  3NBB A;  2PNC A;  2FUQ A;  2XHN A;  3VD9 A;  1JYX A;  1RWF A;  1QWN A;  4FNP A;  1W6C A;  4MMH A;  3X3Y A;  2JKA A;  5KBP A;  2OQE C;  1TQV A;  1IQX A;  3BVV A;  3KII A;  3D50 A;  1QX1 A;  1LOH A;  1W6G A;  1TQU A;  3QG0 A;  1W2Z A;  2X03 A;  3SEP A;  2EAD A;  1OJM A;  2OOV C;  3E80 A;  1TQW A;  1V7W A;  5CA3 A;  2CFL A;  3OB8 A;  1LVN A;  1W4N A;  2HTB A;  3E1F 1;  1C82 A;  1N7Q A;  4DUW A;  1IU7 A;  3S4A A;  1MMU A;  1RKY A;  1LUR A;  3RSY A;  1A2V A;  3BLB A;  3DCD A;  3IAP A;  3WIQ A;  1R33 A;  3DX4 A;  1NSR A;  1RWG A;  1MMY A;  2XN1 A;  3X3X A;  1L7J A;  3D3I A;  3DX3 A;  2EAE A;  1W5Z A;  3VSN A;  4UFC A;  3X3Z A;  4FNT A;  3QDE A;  1HM3 A;  2CG1 A;  2WGQ A;  2CG0 A;  3I3B A;  2WOF A;  3VD7 A;  4NEI A;  2C11 A;  3VSM A;  2FUT A;  1N7R A;  3DX2 A;  1MN0 A;  1IVU A;  1RWH A;  2F1B A;  2RDY A;  1OJO A;  1NS0 A;  2CWV A;  3CZS A;  1H54 A;  2E24 A;  1K1W A;  1X1H A;  4EV2 A;  1N7N A;  3A24 A;  3T0D A;  2ZL8 A;  4OK4 A;  1HMU A;  2CQT A;  3AMO B;  2E2T A;  3T2Q A;  1NSZ A;  3LOY A;  1V7V A;  2BT3 A;  3T0B A;  1W3Y A;  4BZH A;  1NSV A;  4FNQ A;  3MWX A;  3BVT A;  1JYN A;  3S4C A;  1MMZ A;  4J5T A;  2JKE A;  1WMN A;  2FYV A;  3I3D A;  1J0N A;  3Q1N A;  3D4Z A;  1HN1 A;  2WVX B;  2CFW A;  4MMI A;  3BUB A;  1JZ7 A;  1NS2 A;  1F4A A;  2CFK A;  3QFZ A;  1O7D D;  1OJP A;  3T2O A;  3BVW A;  1NSM A;  2WW3 A;  2YX9 A;  1YQ2 A;  3W7X A;  1OAC A;  2CFD A;  2WVY A;  1W7C A;  2WW0 A;  1JZ3 A;  3K5T A;  3RRS A;  3A0O A;  3W7T A;  1NSS A;  1IQY A;  1JZ6 A;  3J7H A;  3WA2 X;  1L7K A; 
#chains in the Genus database with same CATH homology
 1HMW A;  1PX4 A;  1K1Y A;  4BZE A;  2CIQ A;  1PX3 A;  2CIR A;  1JZ2 A;  3I3E A;  3TY1 A;  1NS4 A;  3VD3 A;  3VDB A;  1X1J A;  1HM3 A;  2ZXQ A;  3MV0 1;  1DP0 A;  1F4H A;  1HM2 A;  1OJN A;  2WCO A;  3T08 A;  1NS7 A;  1NSU A;  3E7J A;  1JYV A;  3WVF A;  2WW1 A;  3CZJ A;  1JYW A;  3I3B A;  2WVZ A;  3AFL A;  1LXM A;  5JMD A;  1F1S A;  3OBA A;  3VD7 A;  3NJX A;  5E1Q A;  3K25 A;  4AQ0 A;  4DUX A;  3MUY 1;  3BS6 A;  3NJV A;  4NEI A;  1RW9 A;  1LF6 A;  2WW2 A;  3VSM A;  2FUT A;  5A1A A;  1N7R A;  1MN0 A;  2WDA A;  2CIS A;  2D73 A;  1RWH A;  1HN0 A;  3DYP A;  3VDC A;  1MMX A;  1RWC A;  1JZ4 A;  3WFA A;  1K1X A;  1OJO A;  1NS0 A;  2Q1F A;  3T09 A;  2BRP A;  3DEC A;  4TTG A;  3T0A A;  3DYM A;  2E22 A;  1F9G A;  2E24 A;  4FNV A;  1K1W A;  1ULV A;  4RNL A;  3VDA A;  2WVX A;  3MV1 1;  1Z45 A;  5JMF A;  1X1H A;  3BGA A;  2FUQ A;  1N7N A;  1EGU A;  3A24 A;  1J0M A;  2BRW A;  2HTA A;  3T0D A;  2XHN A;  4OK4 A;  1HMU A;  3VD9 A;  1JYX A;  1X1I A;  1RWF A;  2BRV X;  1NS8 A;  3T2Q A;  1NSZ A;  4MMH A;  3T0B A;  1W3Y A;  3VD5 A;  1NSV A;  2JKA A;  4BZF A;  4BZH A;  1N7P A;  1JZ5 A;  3T2P A;  3MWX A;  1NKG A;  1JYN A;  1MMZ A;  1JOV A;  2XSG A;  3OS7 A;  4J5T A;  1SNZ A;  3DYO A;  2JKE A;  3I3D A;  4OK2 A;  1LOH A;  1J0N A;  3Q1N A;  3BLC A;  1LXK A;  3VD4 A;  4DUV A;  1CB8 A;  1RWA A;  1HN1 A;  3IAQ A;  2X03 A;  2WVX B;  4MMI A;  3SEP A;  1JZ7 A;  1OJM A;  1I8Q A;  3E80 A;  1NS2 A;  4BZG A;  1LF9 A;  4OJZ A;  3ECQ A;  1SO0 A;  1N7O A;  1F4A A;  1NSX A;  3OB8 A;  1OJP A;  2HTB A;  3MUZ 1;  2ZQ0 A;  3T2O A;  3E1F 1;  1NSM A;  2WW3 A;  1C82 A;  1YQ2 A;  1N7Q A;  2WVY A;  4DUW A;  1YGA A;  2WW0 A;  1MMU A;  3IMH A;  1JZ3 A;  1LUR A;  2WZS A;  2JKP A;  1JZ8 A;  3A0O A;  3DCD A;  3IAP A;  1NSS A;  3NRE A;  1UG9 A;  1JZ6 A;  1NSR A;  1RWG A;  1MMY A;  3J7H A;  1L7K A;  1L7J A;  1TXK A;  3VSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...