3DCDA

X-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
300
Chain Sequence
MDYTIENNMIKVVISDHGAEIQSVKSAHTDEEFMWQANPEIWGRHAPVLFPIVGRLKNDEYTYKGKTYHLGQHGFARNADFEVENHTKESITFLLKDNEETRKVYPFKFEFRVNYNLMNNLLEENFSVVNKSDETMIFGVGGHPGFNLPTDHGENKEDFYFDMHPSVTRVRIPLKDASLDWNNRSLAPTDSLIALSDDLFKDDALIYELRGNDNKVSLRTDKNKFHVNVWTRDAPFVGIWSQYPKTDNYVCIEPWWGIADRDDADGDLEHKYGMNHLKPGKEFQAGFSMTYHSTTDEVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose mutarotase related enzyme
publication title X-ray structure of the galactose mutarotase related enzyme Q5FKD7 from Lactobacillus acidophilus at the resolution 1.9A. Northeast Structural Genomics consortium target LaR33. (CASP Target)
rcsb
molecule tags Structural genomics, unknown function
total genus 68
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3dcdA00
1X1JA 3NJXA 1PX3A 1CB8A 1K1WA 1NSVA 1RW9A 3CZJA 1RWAA 3T09A 4BZFA 3VD5A 3ECQA 1YQ2A 1ULVA 1HMWA 3OBAA 1JYVA 3MWXA 4BZHA 2Q1FA 1OJOA 1Z45A 5A1AA 3T2QA 1F4AA 1K1YA 3IMHA 3K25A 3DYPA 2WVYA 4AQ0A 1MMYA 1MMZA 1NSZA 3WFAA 3VD4A 1OJPA 1RWGA 3BGAA 3DECA 3DYOA 3VDAA 1TXKA 1F4HA 1F9GA 3VDBA 1J0MA 1L7KA 1NS8A 1YGAA 4RNLA 2JKPA 1MN0A 3T2OA 2WW2A 1HM3A 1X1HA 2CIRA 1L7JA 2BRPA 2WVXB 1NSRA 3T08A 1N7QA 2BRWA 1DP0A 3I3BA 3VD9A 2JKAA 3DYMA 1JOVA 1J0NA 2WVXA 2WDAA 2HTAA 1HN0A 4DUVA 3T0DA 1JYWA 3VD7A 4TTGA 1LOHA 3MUZ1 1NS0A 2ZXQA 4DUWA 1PX4A 3I3DA 1NKGA 3I3EA 1SO0A 3SEPA 3VD3A 3DCDA 1JZ3A 1JZ8A 1JZ7A 2E22A 3E1F1 2WW3A 1NSSA 1N7NA 1W3YA 2CIQA 1N7OA 3NJVA 1I8QA 1JYXA 1HMUA 4DUXA 1F1SA 1NSUA 2WW0A 1NSMA 1JZ5A 2ZQ0A 1RWFA 1EGUA 2HTBA 2WVZA 1K1XA 3J7HA 2WZSA 2XHNA 1LURA 3IAQA 2X03A 1LXMA 2E24A 2CISA 4BZEA 3NREA 1X1IA 3MUY1 1RWCA 1OJMA 1N7PA 1NS4A 2D73A 3VDCA 1HM2A 1UG9A 1MMUA 2WW1A 1LF9A 1MMXA 1C82A 1N7RA 4BZGA 1OJNA 1LXKA 3OB8A 3IAPA 3T0BA 1JZ4A 3T0AA 3T2PA 2XSGA 3OS7A 3Q1NA 1JZ2A 1HN1A 3A24A 1NSXA 1SNZA 1RWHA 3MV11 5E1QA 1NS7A 1JYNA 3MV01 1NS2A 2BRVX 2JKEA 1LF6A 1JZ6A 2WCOA
chains in the Genus database with same CATH superfamily
3NJXA 3ACSA 1K1WA 1UI7A 2XN2A 3T09A 3X41A 3VD5A 2RDYA 2YFNA 1HMWA 3X42A 1F4AA 3MI6A 4K35A 1OACA 1WMPA 4OJZA 3W7UA 3K25A 3WA2X 5GW7A 1MMZA 3HIIA 1TXKA 3EJQA 1J0MA 3VSMA 2JKPA 2CQSA 1IVXA 3HIGA 2F7PA 3CZSA 3WIQA 2BRWA 2WYHA 2CWUA 3I3BA 1QWUA 4KFDA 3DYMA 1J0NA 3T0DA 1HN0A 1JYWA 1IVUA 2F7OA 3BUIA 3I3DA 3VD3A 3S4BA 3BVWA 1NSSA 1R34A 3D50A 1PU4A 1F1SA 4OK2A 2WGQA 1QWNA 1EGUA 2WVZA 1D6YA 1K1XA 1TQUA 2CG1A 5CA3A 2WZSA 1LXMA 2CISA 3MUY1 1HM2A 3S4AA 1C82A 2WYIA 3T0BA 3T2PA 4FNRA 2XSGA 3EJPA 1HN1A 3D52A 3DX4A 1TQWA 3N9HA 2OOVC 1TQVA 2F7QA 3VSNA 3E7JA 3HI7A 2XN0A 1NS2A 5JMDA 1AV4A 2E2VA 2CFGA 4BTWA 1X1JA 1W4NA 1PX3A 1NSVA 1RW9A 1SIIA 3ECQA 3AFJA 2F1AA 1ULVA 1O7DD 2OQEA 4BZHA 2FUTA 3DDFA 1IU7A 3DYPA 2OOVA 1W6GA 2WVYA 2C11A 2YX9A 1AVKA 3SXXA 1MMYA 4AQ0A 4BTYA 3VD4A 3VDAA 1F4HA 1D6ZA 1F9GA 2CG0A 4RNLA 3X3YA 3T2OA 3A0OA 2WO0A 2BRPA 2CQTA 1JRQA 1HXKA 4MMIA 3T08A 1N7QA 1DP0A 1RJOA 4FNQA 2JKAA 3BUQA 3RRSA 2HTAA 3MPHA 1NS0A 2F18A 4DUWA 2C10A 1HWWA 2E22A 1RKYA 4K3AA 3T0UA 1N7NA 4KTPA 3AMOB 1LVNA 3D3IA 1JZ5A 3RSYA 3J7HA 3AMOA 3DX3A 1LURA 2Y73A 2CWVA 4J5TA 4BZEA 3NREA 1X1IA 1N9EA 1OJMA 2D73A 3QFZA 2D1WA 2WW1A 3X3XA 5KBPA 1LF9A 1W7CA 3S4DA 2ALWA 2XN1A 4EV2A 1N7RA 1OJNA 3OB8A 4FNPA 1DYUA 2FYVA 1JYNA 3MV01 3W7TA 1IQYA 2PNCA 3W7XA 1CB8A 1A2VA 1RWAA 2E2UA 2YFOA 3OBAA 2Q1FA 2W0QA 1Z45A 2OW7A 3T2QA 3BVXA 1K1YA 3BVTA 3EJUA 2ZL8A 2CFLA 3S4CA 3BS6A 3BUPA 1OJPA 1RWGA 3DECA 3W7WA 2EADA 3VDBA 3K5TA 1QAKA 1L7KA 3W7SA 1MN0A 2WW2A 1HM3A 1X1HA 3BLBA 2WVXB 3BVUA 1NSRA 4BTXA 1EKMA 1JOVA 2WVXA 2WDAA 1SPUA 4OK4A 4DUVA 4TTGA 1KSIA 1TQTA 3MUZ1 2ZXQA 1PX4A 3BVVA 3SEPA 1JZ3A 1SO0A 1JZ8A 3DCDA 1JZ7A 3SX1A 1WMOA 3E1F1 1QX1A 2WOFA 1I8QA 1JYXA 3QG0A 4DUXA 3NBJA 2CWTA 2CFDA 2CFKA 2OW6A 2XHNA 3QFYA 2E2TA 1PS3A 1WMNA 1RWCA 1NS4A 4EV5A 3BUDA 3BLCA 1MMXA 1D6UA 2EABA 1JZ4A 1R33A 3OS7A 1JZ2A 3A24A 1NSXA 1SNZA 3CZNA 3MV11 2WOHA 5E1QA 3PGBA 2EACA 4KTRA 1TU5A 2BRVX 2JKEA 3WA3A 1V7XA 3CZJA 2BT3A 3D51A 4BZFA 1YQ2A 1IVWA 1JYVA 3MWXA 1OJOA 5A1AA 3E80A 3DX0A 1QAFA 3D4ZA 3IMHA 3X40A 1H54A 3X3ZA 4UFCA 4FNVA 4MMHA 2FUQA 3WVFA 4KFEA 1NSZA 3WFAA 3LOYA 3BGAA 3DYOA 1HTYA 1US1A 1IVVA 2EAEA 4FNUA 2Y74A 1NS8A 1YGAA 4FNTA 2CIRA 1L7JA 1W2ZA 3VD9A 2F7RA 1W6CA 2CFWA 3EJSA 3VD7A 3QDEA 1LOHA 1V7VA 3WIRA 3ALAA 3I3EA 1NKGA 4NEIA 2WW3A 3TY1A 1W3YA 2CIQA 1N7OA 3NJVA 3DDGA 1HMUA 3KN4A 4FNSA 2OQEC 1NSUA 3LVTA 2WW0A 1NSMA 1QALA 2ZQ0A 1RWFA 2HTBA 3AFLA 1V7WA 5JMFA 3BUBA 3CV5A 3IAQA 2X03A 2E24A 3DX2A 1N7PA 3VDCA 1AVLA 2F1BA 1UG9A 1MMUA 3ACTA 1UI8A 3D4YA 3NBBA 1TQSA 4BZGA 1LXKA 3IAPA 3T0AA 3EJTA 3Q1NA 1IQXA 3DX1A 4KFFA 3EJRA 1RWHA 1NS7A 3KIIA 1W5ZA 1SIHA 1LF6A 1JZ6A 2WCOA
chains in the Genus database with same CATH topology
1X1JA 3NJXA 1PX3A 1CB8A 1K1WA 1NSVA 1RW9A 3CZJA 1RWAA 3T09A 4BZFA 3VD5A 3ECQA 1YQ2A 1ULVA 1HMWA 3OBAA 1JYVA 3MWXA 4BZHA 2FUTA 2Q1FA 1OJOA 1Z45A 3E80A 5A1AA 3T2QA 1F4AA 4OJZA 1K1YA 3IMHA 3K25A 3DYPA 2WVYA 4FNVA 4MMHA 4AQ0A 1MMYA 2FUQA 3BS6A 1MMZA 3WVFA 1NSZA 3WFAA 3VD4A 1OJPA 1RWGA 3BGAA 3DECA 3DYOA 3VDAA 1TXKA 1F4HA 1F9GA 3VDBA 1J0MA 1L7KA 1NS8A 1YGAA 3VSMA 4RNLA 2JKPA 1MN0A 3T2OA 2WW2A 1HM3A 1X1HA 2CIRA 1L7JA 3A0OA 2BRPA 2WVXB 4MMIA 1NSRA 3T08A 1N7QA 2BRWA 1DP0A 3I3BA 3VD9A 2JKAA 3DYMA 1JOVA 1J0NA 2WVXA 2WDAA 2HTAA 1HN0A 4OK4A 4DUVA 3T0DA 1JYWA 3VD7A 4TTGA 1LOHA 3MUZ1 1NS0A 2ZXQA 4DUWA 1PX4A 3I3DA 1NKGA 3I3EA 1SO0A 4NEIA 3SEPA 3DCDA 3VD3A 1JZ3A 1JZ8A 1JZ7A 2E22A 3E1F1 2WW3A 1NSSA 1N7NA 3TY1A 1W3YA 2CIQA 1N7OA 3NJVA 1I8QA 1JYXA 1HMUA 4DUXA 1F1SA 4OK2A 1NSUA 2WW0A 1NSMA 1JZ5A 2ZQ0A 1RWFA 1EGUA 2HTBA 2WVZA 1K1XA 3AFLA 3J7HA 5JMFA 2WZSA 2XHNA 1LURA 3IAQA 2X03A 1LXMA 2E24A 4J5TA 2CISA 4BZEA 3NREA 1X1IA 3MUY1 1RWCA 1OJMA 1N7PA 1NS4A 2D73A 3VDCA 1HM2A 1UG9A 1MMUA 2WW1A 1LF9A 3BLCA 1MMXA 1C82A 1N7RA 4BZGA 1OJNA 1LXKA 3OB8A 3IAPA 3T0BA 1JZ4A 3T0AA 3T2PA 2XSGA 3OS7A 3Q1NA 1JZ2A 1HN1A 3A24A 1NSXA 1SNZA 1RWHA 3MV11 3VSNA 5E1QA 3E7JA 1NS7A 1JYNA 3MV01 1NS2A 5JMDA 2BRVX 2JKEA 1LF6A 1JZ6A 2WCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1J A;  3NJX A;  1PX3 A;  1CB8 A;  1K1W A;  1NSV A;  1RW9 A;  3CZJ A;  1RWA A;  3T09 A;  4BZF A;  3VD5 A;  3ECQ A;  1YQ2 A;  1ULV A;  1HMW A;  3OBA A;  1JYV A;  3MWX A;  4BZH A;  2Q1F A;  1OJO A;  1Z45 A;  5A1A A;  3T2Q A;  1F4A A;  1K1Y A;  3IMH A;  3K25 A;  3DYP A;  2WVY A;  4AQ0 A;  1MMY A;  1MMZ A;  1NSZ A;  3WFA A;  3VD4 A;  1OJP A;  1RWG A;  3BGA A;  3DEC A;  3DYO A;  3VDA A;  1TXK A;  1F4H A;  1F9G A;  3VDB A;  1J0M A;  1L7K A;  1NS8 A;  1YGA A;  4RNL A;  2JKP A;  1MN0 A;  3T2O A;  2WW2 A;  1HM3 A;  1X1H A;  2CIR A;  1L7J A;  2BRP A;  2WVX B;  1NSR A;  3T08 A;  1N7Q A;  2BRW A;  1DP0 A;  3I3B A;  3VD9 A;  2JKA A;  3DYM A;  1JOV A;  1J0N A;  2WVX A;  2WDA A;  2HTA A;  1HN0 A;  4DUV A;  3T0D A;  1JYW A;  3VD7 A;  4TTG A;  1LOH A;  3MUZ 1;  1NS0 A;  2ZXQ A;  4DUW A;  1PX4 A;  3I3D A;  1NKG A;  3I3E A;  1SO0 A;  3SEP A;  3VD3 A;  3DCD A;  1JZ3 A;  1JZ8 A;  1JZ7 A;  2E22 A;  3E1F 1;  2WW3 A;  1NSS A;  1N7N A;  1W3Y A;  2CIQ A;  1N7O A;  3NJV A;  1I8Q A;  1JYX A;  1HMU A;  4DUX A;  1F1S A;  1NSU A;  2WW0 A;  1NSM A;  1JZ5 A;  2ZQ0 A;  1RWF A;  1EGU A;  2HTB A;  2WVZ A;  1K1X A;  3J7H A;  2WZS A;  2XHN A;  1LUR A;  3IAQ A;  2X03 A;  1LXM A;  2E24 A;  2CIS A;  4BZE A;  3NRE A;  1X1I A;  3MUY 1;  1RWC A;  1OJM A;  1N7P A;  1NS4 A;  2D73 A;  3VDC A;  1HM2 A;  1UG9 A;  1MMU A;  2WW1 A;  1LF9 A;  1MMX A;  1C82 A;  1N7R A;  4BZG A;  1OJN A;  1LXK A;  3OB8 A;  3IAP A;  3T0B A;  1JZ4 A;  3T0A A;  3T2P A;  2XSG A;  3OS7 A;  3Q1N A;  1JZ2 A;  1HN1 A;  3A24 A;  1NSX A;  1SNZ A;  1RWH A;  3MV1 1;  5E1Q A;  1NS7 A;  1JYN A;  3MV0 1;  1NS2 A;  2BRV X;  2JKE A;  1LF6 A;  1JZ6 A;  2WCO A; 
#chains in the Genus database with same CATH topology
 3NJX A;  3ACS A;  1K1W A;  1UI7 A;  2XN2 A;  3T09 A;  3X41 A;  3VD5 A;  2RDY A;  2YFN A;  1HMW A;  3X42 A;  1F4A A;  3MI6 A;  4K35 A;  1OAC A;  1WMP A;  4OJZ A;  3W7U A;  3K25 A;  3WA2 X;  5GW7 A;  1MMZ A;  3HII A;  1TXK A;  3EJQ A;  1J0M A;  3VSM A;  2JKP A;  2CQS A;  1IVX A;  3HIG A;  2F7P A;  3CZS A;  3WIQ A;  2BRW A;  2WYH A;  2CWU A;  3I3B A;  1QWU A;  4KFD A;  3DYM A;  1J0N A;  3T0D A;  1HN0 A;  1JYW A;  1IVU A;  2F7O A;  3BUI A;  3I3D A;  3VD3 A;  3S4B A;  3BVW A;  1NSS A;  1R34 A;  3D50 A;  1PU4 A;  1F1S A;  4OK2 A;  2WGQ A;  1QWN A;  1EGU A;  2WVZ A;  1D6Y A;  1K1X A;  1TQU A;  2CG1 A;  5CA3 A;  2WZS A;  1LXM A;  2CIS A;  3MUY 1;  1HM2 A;  3S4A A;  1C82 A;  2WYI A;  3T0B A;  3T2P A;  4FNR A;  2XSG A;  3EJP A;  1HN1 A;  3D52 A;  3DX4 A;  1TQW A;  3N9H A;  2OOV C;  1TQV A;  2F7Q A;  3VSN A;  3E7J A;  3HI7 A;  2XN0 A;  1NS2 A;  5JMD A;  1AV4 A;  2E2V A;  2CFG A;  4BTW A;  1X1J A;  1W4N A;  1PX3 A;  1NSV A;  1RW9 A;  1SII A;  3ECQ A;  3AFJ A;  2F1A A;  1ULV A;  1O7D D;  2OQE A;  4BZH A;  2FUT A;  3DDF A;  1IU7 A;  3DYP A;  2OOV A;  1W6G A;  2WVY A;  2C11 A;  2YX9 A;  1AVK A;  3SXX A;  1MMY A;  4AQ0 A;  4BTY A;  3VD4 A;  3VDA A;  1F4H A;  1D6Z A;  1F9G A;  2CG0 A;  4RNL A;  3X3Y A;  3T2O A;  3A0O A;  2WO0 A;  2BRP A;  2CQT A;  1JRQ A;  1HXK A;  4MMI A;  3T08 A;  1N7Q A;  1DP0 A;  1RJO A;  4FNQ A;  2JKA A;  3BUQ A;  3RRS A;  2HTA A;  3MPH A;  1NS0 A;  2F18 A;  4DUW A;  2C10 A;  1HWW A;  2E22 A;  1RKY A;  4K3A A;  3T0U A;  1N7N A;  4KTP A;  3AMO B;  1LVN A;  3D3I A;  1JZ5 A;  3RSY A;  3J7H A;  3AMO A;  3DX3 A;  1LUR A;  2Y73 A;  2CWV A;  4J5T A;  4BZE A;  3NRE A;  1X1I A;  1N9E A;  1OJM A;  2D73 A;  3QFZ A;  2D1W A;  2WW1 A;  3X3X A;  5KBP A;  1LF9 A;  1W7C A;  3S4D A;  2ALW A;  2XN1 A;  4EV2 A;  1N7R A;  1OJN A;  3OB8 A;  4FNP A;  1DYU A;  2FYV A;  1JYN A;  3MV0 1;  3W7T A;  1IQY A;  2PNC A;  3W7X A;  1CB8 A;  1A2V A;  1RWA A;  2E2U A;  2YFO A;  3OBA A;  2Q1F A;  2W0Q A;  1Z45 A;  2OW7 A;  3T2Q A;  3BVX A;  1K1Y A;  3BVT A;  3EJU A;  2ZL8 A;  2CFL A;  3S4C A;  3BS6 A;  3BUP A;  1OJP A;  1RWG A;  3DEC A;  3W7W A;  2EAD A;  3VDB A;  3K5T A;  1QAK A;  1L7K A;  3W7S A;  1MN0 A;  2WW2 A;  1HM3 A;  1X1H A;  3BLB A;  2WVX B;  3BVU A;  1NSR A;  4BTX A;  1EKM A;  1JOV A;  2WVX A;  2WDA A;  1SPU A;  4OK4 A;  4DUV A;  4TTG A;  1KSI A;  1TQT A;  3MUZ 1;  2ZXQ A;  1PX4 A;  3BVV A;  3SEP A;  1JZ3 A;  1SO0 A;  1JZ8 A;  3DCD A;  1JZ7 A;  3SX1 A;  1WMO A;  3E1F 1;  1QX1 A;  2WOF A;  1I8Q A;  1JYX A;  3QG0 A;  4DUX A;  3NBJ A;  2CWT A;  2CFD A;  2CFK A;  2OW6 A;  2XHN A;  3QFY A;  2E2T A;  1PS3 A;  1WMN A;  1RWC A;  1NS4 A;  4EV5 A;  3BUD A;  3BLC A;  1MMX A;  1D6U A;  2EAB A;  1JZ4 A;  1R33 A;  3OS7 A;  1JZ2 A;  3A24 A;  1NSX A;  1SNZ A;  3CZN A;  3MV1 1;  2WOH A;  5E1Q A;  3PGB A;  2EAC A;  4KTR A;  1TU5 A;  2BRV X;  2JKE A;  3WA3 A;  1V7X A;  3CZJ A;  2BT3 A;  3D51 A;  4BZF A;  1YQ2 A;  1IVW A;  1JYV A;  3MWX A;  1OJO A;  5A1A A;  3E80 A;  3DX0 A;  1QAF A;  3D4Z A;  3IMH A;  3X40 A;  1H54 A;  3X3Z A;  4UFC A;  4FNV A;  4MMH A;  2FUQ A;  3WVF A;  4KFE A;  1NSZ A;  3WFA A;  3LOY A;  3BGA A;  3DYO A;  1HTY A;  1US1 A;  1IVV A;  2EAE A;  4FNU A;  2Y74 A;  1NS8 A;  1YGA A;  4FNT A;  2CIR A;  1L7J A;  1W2Z A;  3VD9 A;  2F7R A;  1W6C A;  2CFW A;  3EJS A;  3VD7 A;  3QDE A;  1LOH A;  1V7V A;  3WIR A;  3ALA A;  3I3E A;  1NKG A;  4NEI A;  2WW3 A;  3TY1 A;  1W3Y A;  2CIQ A;  1N7O A;  3NJV A;  3DDG A;  1HMU A;  3KN4 A;  4FNS A;  2OQE C;  1NSU A;  3LVT A;  2WW0 A;  1NSM A;  1QAL A;  2ZQ0 A;  1RWF A;  2HTB A;  3AFL A;  1V7W A;  5JMF A;  3BUB A;  3CV5 A;  3IAQ A;  2X03 A;  2E24 A;  3DX2 A;  1N7P A;  3VDC A;  1AVL A;  2F1B A;  1UG9 A;  1MMU A;  3ACT A;  1UI8 A;  3D4Y A;  3NBB A;  1TQS A;  4BZG A;  1LXK A;  3IAP A;  3T0A A;  3EJT A;  3Q1N A;  1IQX A;  3DX1 A;  4KFF A;  3EJR A;  1RWH A;  1NS7 A;  3KII A;  1W5Z A;  1SIH A;  1LF6 A;  1JZ6 A;  2WCO A; 
#chains in the Genus database with same CATH homology
 1X1J A;  3NJX A;  1PX3 A;  1CB8 A;  1K1W A;  1NSV A;  1RW9 A;  3CZJ A;  1RWA A;  3T09 A;  4BZF A;  3VD5 A;  3ECQ A;  1YQ2 A;  1ULV A;  1HMW A;  3OBA A;  1JYV A;  3MWX A;  4BZH A;  2FUT A;  2Q1F A;  1OJO A;  1Z45 A;  3E80 A;  5A1A A;  3T2Q A;  1F4A A;  4OJZ A;  1K1Y A;  3IMH A;  3K25 A;  3DYP A;  2WVY A;  4FNV A;  4MMH A;  4AQ0 A;  1MMY A;  2FUQ A;  3BS6 A;  1MMZ A;  3WVF A;  1NSZ A;  3WFA A;  3VD4 A;  1OJP A;  1RWG A;  3BGA A;  3DEC A;  3DYO A;  3VDA A;  1TXK A;  1F4H A;  1F9G A;  3VDB A;  1J0M A;  1L7K A;  1NS8 A;  1YGA A;  3VSM A;  4RNL A;  2JKP A;  1MN0 A;  3T2O A;  2WW2 A;  1HM3 A;  1X1H A;  2CIR A;  1L7J A;  3A0O A;  2BRP A;  2WVX B;  4MMI A;  1NSR A;  3T08 A;  1N7Q A;  2BRW A;  1DP0 A;  3I3B A;  3VD9 A;  2JKA A;  3DYM A;  1JOV A;  1J0N A;  2WVX A;  2WDA A;  2HTA A;  1HN0 A;  4OK4 A;  4DUV A;  3T0D A;  1JYW A;  3VD7 A;  4TTG A;  1LOH A;  3MUZ 1;  1NS0 A;  2ZXQ A;  4DUW A;  1PX4 A;  3I3D A;  1NKG A;  3I3E A;  1SO0 A;  4NEI A;  3SEP A;  3DCD A;  3VD3 A;  1JZ3 A;  1JZ8 A;  1JZ7 A;  2E22 A;  3E1F 1;  2WW3 A;  1NSS A;  1N7N A;  3TY1 A;  1W3Y A;  2CIQ A;  1N7O A;  3NJV A;  1I8Q A;  1JYX A;  1HMU A;  4DUX A;  1F1S A;  4OK2 A;  1NSU A;  2WW0 A;  1NSM A;  1JZ5 A;  2ZQ0 A;  1RWF A;  1EGU A;  2HTB A;  2WVZ A;  1K1X A;  3AFL A;  3J7H A;  5JMF A;  2WZS A;  2XHN A;  1LUR A;  3IAQ A;  2X03 A;  1LXM A;  2E24 A;  4J5T A;  2CIS A;  4BZE A;  3NRE A;  1X1I A;  3MUY 1;  1RWC A;  1OJM A;  1N7P A;  1NS4 A;  2D73 A;  3VDC A;  1HM2 A;  1UG9 A;  1MMU A;  2WW1 A;  1LF9 A;  3BLC A;  1MMX A;  1C82 A;  1N7R A;  4BZG A;  1OJN A;  1LXK A;  3OB8 A;  3IAP A;  3T0B A;  1JZ4 A;  3T0A A;  3T2P A;  2XSG A;  3OS7 A;  3Q1N A;  1JZ2 A;  1HN1 A;  3A24 A;  1NSX A;  1SNZ A;  1RWH A;  3MV1 1;  3VSN A;  5E1Q A;  3E7J A;  1NS7 A;  1JYN A;  3MV0 1;  1NS2 A;  5JMD A;  2BRV X;  2JKE A;  1LF6 A;  1JZ6 A;  2WCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...