3DCDA

X-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
300
Chain Sequence
MDYTIENNMIKVVISDHGAEIQSVKSAHTDEEFMWQANPEIWGRHAPVLFPIVGRLKNDEYTYKGKTYHLGQHGFARNADFEVENHTKESITFLLKDNEETRKVYPFKFEFRVNYNLMNNLLEENFSVVNKSDETMIFGVGGHPGFNLPTDHGENKEDFYFDMHPSVTRVRIPLKDASLDWNNRSLAPTDSLIALSDDLFKDDALIYELRGNDNKVSLRTDKNKFHVNVWTRDAPFVGIWSQYPKTDNYVCIEPWWGIADRDDADGDLEHKYGMNHLKPGKEFQAGFSMTYHSTTDEVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Galactose mutarotase related enzyme
publication title X-ray structure of the galactose mutarotase related enzyme Q5FKD7 from Lactobacillus acidophilus at the resolution 1.9A. Northeast Structural Genomics consortium target LaR33. (CASP Target)
rcsb
total genus 68
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3dcdA00
3VD9A 1F1SA 1NSSA 1NSUA 1RWFA 3IAPA 2WZSA 1JZ5A 1HN0A 1RWCA 1OJOA 2CIRA 1JZ3A 3MV01 2WVXA 1NSZA 1X1HA 3T2QA 1C82A 3T0DA 1F9GA 2BRWA 1JZ8A 3DCDA 1NS2A 1HMWA 2WW0A 3I3BA 3BGAA 1PX3A 3J7HA 1LURA 2JKAA 3VD7A 1JZ4A 3ECQA 3MWXA 1JZ6A 1YGAA 1J0MA 1L7KA 2CISA 3SEPA 1LXKA 1NSVA 1HN1A 1W3YA 1UG9A 1NS0A 1I8QA 3VDCA 1JZ2A 3T08A 1DP0A 1RWGA 2Q1FA 3Q1NA 3VD3A 1NS7A 3I3EA 1NS4A 4BZEA 1EGUA 1F4AA 1NSMA 1RWHA 3CZJA 3VD4A 1OJNA 2X03A 1JYXA 2WW1A 3MV11 2CIQA 1MMZA 1RW9A 1MN0A 2BRVX 1YQ2A 1OJPA 2WDAA 1JYWA 3WFAA 2JKEA 3MUY1 1MMUA 2HTBA 3NJXA 1SNZA 1JYNA 4DUVA 4RNLA 1NSXA 1L7JA 1OJMA 1X1IA 3T2PA 1HMUA 2D73A 3NREA 1LOHA 3T2OA 2JKPA 4BZGA 1K1YA 3NJVA 1TXKA 1N7NA 3T09A 3A24A 1RWAA 4TTGA 3IMHA 1X1JA 3T0AA 3MUZ1 1JOVA 1SO0A 2WVZA 1F4HA 1N7RA 2BRPA 3E1F1 1HM3A 2HTAA 3VDAA 2WVXB 4BZHA 1CB8A 1K1XA 2WW2A 2ZQ0A 5E1QA 5A1AA 1LF6A 3IAQA 3VDBA 1HM2A 3I3DA 2WVYA 1JYVA 1MMXA 1LXMA 1LF9A 1PX4A 3OS7A 3DYPA 1NSRA 2E22A 3T0BA 2XHNA 3DECA 1NKGA 2ZXQA 2WW3A 1NS8A 1ULVA 1N7PA 4DUWA 4AQ0A 3K25A 1J0NA 2E24A 2WCOA 2XSGA 1Z45A 1JZ7A 3OB8A 4BZFA 3OBAA 1N7QA 1K1WA 3DYMA 3VD5A 4DUXA 3DYOA 1N7OA 1MMYA
chains in the Genus database with same CATH superfamily
3VD9A 2WYHA 1RWFA 2WZSA 3T0UA 5CA3A 3VSMA 3LOYA 1X1HA 1W7CA 3ALAA 2OQEC 3T0DA 1F9GA 1AVLA 3DDGA 1PX3A 3VD7A 1JZ4A 1IVVA 3VSNA 1J0MA 4FNUA 2CQTA 1LXKA 1TQVA 1HN1A 1W3YA 1UG9A 1DP0A 1RWGA 2OOVC 3I3EA 3W7UA 2CFKA 2EACA 3CZJA 3RSYA 3HIIA 3CZSA 3BLCA 2F7RA 1D6YA 1MMZA 1OJPA 2W0QA 4KFFA 3KN4A 2E2UA 4K35A 3X42A 3WFAA 2JKEA 2XN2A 2CFDA 2HTBA 3AMOB 3WA3A 1X1IA 1TU5A 4BZGA 1R33A 3RRSA 1W5ZA 2YX9A 3A24A 3W7XA 3IMHA 1X1JA 1F4HA 1N7RA 1TQWA 3TY1A 1CB8A 3DX2A 3DDFA 1LF6A 3EJPA 3DX3A 2CG0A 2WYIA 2WGQA 1MMXA 4MMIA 3OS7A 2ZL8A 2CG1A 1NSRA 2E2VA 3T0BA 2XHNA 1N9EA 1NKGA 2F1AA 1SIHA 2OW6A 3BVTA 1W4NA 4FNRA 3VD5A 2CFGA 3DYOA 1F1SA 3HIGA 1TQTA 2F7PA 3A0OA 1IQXA 1RWCA 1R34A 1LVNA 1OJOA 3MV01 1QALA 1HXKA 3S4AA 4KTPA 2BRWA 1TQUA 3DCDA 1HMWA 2WW0A 2JKAA 3QFZA 4EV2A 2CFWA 2CISA 1W6CA 3WIQA 3D52A 1I8QA 3VDCA 4NEIA 2Q1FA 3Q1NA 3VD3A 2RDYA 2F1BA 2WO0A 3D51A 3ACTA 3VD4A 4FNVA 2WW1A 3E7JA 1MN0A 2BRVX 3KIIA 3BUPA 3W7SA 1IQYA 2XN0A 1MMUA 1V7WA 2BT3A 1SNZA 1W6GA 3E80A 3NREA 1IU7A 2F18A 1K1YA 3NJVA 1TXKA 1N7NA 2Y74A 1SIIA 2CWTA 4TTGA 3EJRA 3CZNA 3E1F1 2BRPA 4BZHA 2HTAA 1W2ZA 3DX4A 5A1AA 3AFJA 1O7DD 3VDBA 3X3XA 2WVYA 1JYVA 1LXMA 1LF9A 2YFNA 3HI7A 2E22A 3MI6A 3DECA 2WW3A 3BUQA 1NS8A 4DUWA 2WCOA 2XSGA 3X3ZA 1PU4A 4BZFA 3S4BA 1EKMA 2EAEA 1N7QA 1K1WA 1SPUA 3WA2X 1MMYA 1H54A 3D4YA 1JZ5A 3BVUA 1JZ3A 3K5TA 2WVXA 3SXXA 3T2QA 3QDEA 1C82A 1JZ8A 3I3BA 3BGAA 3J7HA 1LURA 3ECQA 3MWXA 1JZ6A 3X40A 1YGAA 3DX0A 3NBBA 1AV4A 1D6UA 1NSVA 2OW7A 1NS0A 3NBJA 1HTYA 1QWUA 1NS7A 4BTWA 2FUQA 1US1A 1NS4A 1OACA 4OK2A 2E2TA 1QAKA 2Y73A 4KFDA 2EABA 3D4ZA 1OJNA 2X03A 1QAFA 2CFLA 2FUTA 2FYVA 3EJTA 4K3AA 1YQ2A 2WDAA 3D3IA 1HWWA 3MUY1 1JYNA 3BUDA 4DUVA 3DX1A 1NSXA 3BVXA 4FNQA 1LOHA 3T2OA 2JKPA 3D50A 1D6ZA 2D1WA 4BTXA 1JOVA 1SO0A 1WMOA 2WW2A 1DYUA 3IAQA 3LVTA 1KSIA 4FNSA 3MPHA 1HM2A 4DUXA 4EV5A 1PX4A 2XN1A 3DYPA 2F7OA 1RJOA 3BUIA 1PS3A 3S4DA 3W7TA 1ULVA 3AMOA 3SX1A 1WMPA 4AQ0A 4OJZA 1J0NA 1Z45A 3OB8A 3OBAA 3N9HA 1N7OA 4BTYA 3CV5A 1NSUA 1NSSA 4MMHA 4KFEA 3IAPA 1QX1A 1HN0A 1UI7A 2CIRA 1NSZA 2WOHA 3BVWA 2C10A 3AFLA 1RKYA 2F7QA 2CWUA 1NS2A 3BVVA 3QFYA 4FNTA 1IVXA 1L7KA 2PNCA 3X41A 3PGBA 1A2VA 3S4CA 3SEPA 1V7VA 1JZ2A 3T08A 4UFCA 5GW7A 1JRQA 3EJQA 4BZEA 1IVWA 1EGUA 2WOFA 1F4AA 1NSMA 3WVFA 5JMDA 1RWHA 3BS6A 3ACSA 1JYXA 4KTRA 3MV11 2CIQA 1RW9A 1JYWA 3NJXA 4RNLA 1L7JA 1OJMA 3T2PA 1HMUA 2D73A 2YFOA 1TQSA 3T09A 1QWNA 2OQEA 3EJSA 2CQSA 3WIRA 1RWAA 1V7XA 3T0AA 3MUZ1 2WVZA 2CWVA 1HM3A 3VDAA 2WVXB 3X3YA 1K1XA 2ZQ0A 5E1QA 3BLBA 5JMFA 4FNPA 3I3DA 4OK4A 1UI8A 3BUBA 2OOVA 3QG0A 3EJUA 3W7WA 1WMNA 2ZXQA 2C11A 1IVUA 1N7PA 4J5TA 3K25A 2E24A 5KBPA 1JZ7A 1AVKA 3DYMA 2EADA 2ALWA
chains in the Genus database with same CATH topology
3VD9A 1F1SA 1NSSA 1NSUA 4MMHA 1RWFA 3A0OA 3IAPA 2WZSA 1JZ5A 1HN0A 1RWCA 3VSMA 1OJOA 2CIRA 1JZ3A 3MV01 2WVXA 1NSZA 1X1HA 3T2QA 3AFLA 1C82A 3T0DA 1F9GA 2BRWA 1JZ8A 3DCDA 1NS2A 1HMWA 2WW0A 3I3BA 3BGAA 1PX3A 3J7HA 1LURA 2JKAA 3VD7A 1JZ4A 3ECQA 3MWXA 1JZ6A 1YGAA 3VSNA 1J0MA 1L7KA 2CISA 3SEPA 1LXKA 1NSVA 1HN1A 1W3YA 1UG9A 1NS0A 1I8QA 3VDCA 1JZ2A 3T08A 1DP0A 1RWGA 4NEIA 2Q1FA 3Q1NA 3VD3A 1NS7A 2FUQA 3I3EA 1NS4A 4BZEA 1EGUA 4OK2A 1F4AA 1NSMA 3WVFA 5JMDA 1RWHA 3CZJA 3VD4A 3BS6A 1OJNA 2X03A 1JYXA 3BLCA 4FNVA 2WW1A 2FUTA 3MV11 3E7JA 2CIQA 1MMZA 1RW9A 1MN0A 2BRVX 1YQ2A 1OJPA 2WDAA 1JYWA 3WFAA 2JKEA 3MUY1 1MMUA 2HTBA 3NJXA 1SNZA 1JYNA 4DUVA 4RNLA 1NSXA 1L7JA 1OJMA 1X1IA 3E80A 3T2PA 1HMUA 2D73A 3NREA 1LOHA 3T2OA 2JKPA 4BZGA 1K1YA 3NJVA 1TXKA 1N7NA 3T09A 3A24A 1RWAA 4TTGA 3IMHA 1X1JA 3T0AA 3MUZ1 1JOVA 1SO0A 2WVZA 1F4HA 1N7RA 2BRPA 3E1F1 1HM3A 2HTAA 3TY1A 2WVXB 3VDAA 4BZHA 1CB8A 1K1XA 2WW2A 2ZQ0A 5E1QA 5A1AA 1LF6A 3IAQA 3VDBA 5JMFA 1HM2A 3I3DA 2WVYA 1JYVA 1MMXA 4OK4A 1LXMA 1LF9A 1PX4A 3OS7A 4MMIA 3DYPA 1NSRA 2E22A 3T0BA 2XHNA 3DECA 1NKGA 2ZXQA 2WW3A 1NS8A 1ULVA 1N7PA 4DUWA 4J5TA 4AQ0A 4OJZA 3K25A 1J0NA 2E24A 2WCOA 2XSGA 1Z45A 1JZ7A 3OB8A 4BZFA 3OBAA 1N7QA 1K1WA 3DYMA 3VD5A 4DUXA 3DYOA 1N7OA 1MMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VD9 A;  1F1S A;  1NSS A;  1NSU A;  1RWF A;  3IAP A;  2WZS A;  1JZ5 A;  1HN0 A;  1RWC A;  1OJO A;  2CIR A;  1JZ3 A;  3MV0 1;  2WVX A;  1NSZ A;  1X1H A;  3T2Q A;  1C82 A;  3T0D A;  1F9G A;  2BRW A;  1JZ8 A;  3DCD A;  1NS2 A;  1HMW A;  2WW0 A;  3I3B A;  3BGA A;  1PX3 A;  3J7H A;  1LUR A;  2JKA A;  3VD7 A;  1JZ4 A;  3ECQ A;  3MWX A;  1JZ6 A;  1YGA A;  1J0M A;  1L7K A;  2CIS A;  3SEP A;  1LXK A;  1NSV A;  1HN1 A;  1W3Y A;  1UG9 A;  1NS0 A;  1I8Q A;  3VDC A;  1JZ2 A;  3T08 A;  1DP0 A;  1RWG A;  2Q1F A;  3Q1N A;  3VD3 A;  1NS7 A;  3I3E A;  1NS4 A;  4BZE A;  1EGU A;  1F4A A;  1NSM A;  1RWH A;  3CZJ A;  3VD4 A;  1OJN A;  2X03 A;  1JYX A;  2WW1 A;  3MV1 1;  2CIQ A;  1MMZ A;  1RW9 A;  1MN0 A;  2BRV X;  1YQ2 A;  1OJP A;  2WDA A;  1JYW A;  3WFA A;  2JKE A;  3MUY 1;  1MMU A;  2HTB A;  3NJX A;  1SNZ A;  1JYN A;  4DUV A;  4RNL A;  1NSX A;  1L7J A;  1OJM A;  1X1I A;  3T2P A;  1HMU A;  2D73 A;  3NRE A;  1LOH A;  3T2O A;  2JKP A;  4BZG A;  1K1Y A;  3NJV A;  1TXK A;  1N7N A;  3T09 A;  3A24 A;  1RWA A;  4TTG A;  3IMH A;  1X1J A;  3T0A A;  3MUZ 1;  1JOV A;  1SO0 A;  2WVZ A;  1F4H A;  1N7R A;  2BRP A;  3E1F 1;  1HM3 A;  2HTA A;  3VDA A;  2WVX B;  4BZH A;  1CB8 A;  1K1X A;  2WW2 A;  2ZQ0 A;  5E1Q A;  5A1A A;  1LF6 A;  3IAQ A;  3VDB A;  1HM2 A;  3I3D A;  2WVY A;  1JYV A;  1MMX A;  1LXM A;  1LF9 A;  1PX4 A;  3OS7 A;  3DYP A;  1NSR A;  2E22 A;  3T0B A;  2XHN A;  3DEC A;  1NKG A;  2ZXQ A;  2WW3 A;  1NS8 A;  1ULV A;  1N7P A;  4DUW A;  4AQ0 A;  3K25 A;  1J0N A;  2E24 A;  2WCO A;  2XSG A;  1Z45 A;  1JZ7 A;  3OB8 A;  4BZF A;  3OBA A;  1N7Q A;  1K1W A;  3DYM A;  3VD5 A;  4DUX A;  3DYO A;  1N7O A;  1MMY A; 
#chains in the Genus database with same CATH topology
 3VD9 A;  2WYH A;  1RWF A;  2WZS A;  3T0U A;  5CA3 A;  3VSM A;  3LOY A;  1X1H A;  1W7C A;  3ALA A;  2OQE C;  3T0D A;  1F9G A;  1AVL A;  3DDG A;  1PX3 A;  3VD7 A;  1JZ4 A;  1IVV A;  3VSN A;  1J0M A;  4FNU A;  2CQT A;  1LXK A;  1TQV A;  1HN1 A;  1W3Y A;  1UG9 A;  1DP0 A;  1RWG A;  2OOV C;  3I3E A;  3W7U A;  2CFK A;  2EAC A;  3CZJ A;  3RSY A;  3HII A;  3CZS A;  3BLC A;  2F7R A;  1D6Y A;  1MMZ A;  1OJP A;  2W0Q A;  4KFF A;  3KN4 A;  2E2U A;  4K35 A;  3X42 A;  3WFA A;  2JKE A;  2XN2 A;  2CFD A;  2HTB A;  3AMO B;  3WA3 A;  1X1I A;  1TU5 A;  4BZG A;  1R33 A;  3RRS A;  1W5Z A;  2YX9 A;  3A24 A;  3W7X A;  3IMH A;  1X1J A;  1F4H A;  1N7R A;  1TQW A;  3TY1 A;  1CB8 A;  3DX2 A;  3DDF A;  1LF6 A;  3EJP A;  3DX3 A;  2CG0 A;  2WYI A;  2WGQ A;  1MMX A;  4MMI A;  3OS7 A;  2ZL8 A;  2CG1 A;  1NSR A;  2E2V A;  3T0B A;  2XHN A;  1N9E A;  1NKG A;  2F1A A;  1SIH A;  2OW6 A;  3BVT A;  1W4N A;  4FNR A;  3VD5 A;  2CFG A;  3DYO A;  1F1S A;  3HIG A;  1TQT A;  2F7P A;  3A0O A;  1IQX A;  1RWC A;  1R34 A;  1LVN A;  1OJO A;  3MV0 1;  1QAL A;  1HXK A;  3S4A A;  4KTP A;  2BRW A;  1TQU A;  3DCD A;  1HMW A;  2WW0 A;  2JKA A;  3QFZ A;  4EV2 A;  2CFW A;  2CIS A;  1W6C A;  3WIQ A;  3D52 A;  1I8Q A;  3VDC A;  4NEI A;  2Q1F A;  3Q1N A;  3VD3 A;  2RDY A;  2F1B A;  2WO0 A;  3D51 A;  3ACT A;  3VD4 A;  4FNV A;  2WW1 A;  3E7J A;  1MN0 A;  2BRV X;  3KII A;  3BUP A;  3W7S A;  1IQY A;  2XN0 A;  1MMU A;  1V7W A;  2BT3 A;  1SNZ A;  1W6G A;  3E80 A;  3NRE A;  1IU7 A;  2F18 A;  1K1Y A;  3NJV A;  1TXK A;  1N7N A;  2Y74 A;  1SII A;  2CWT A;  4TTG A;  3EJR A;  3CZN A;  3E1F 1;  2BRP A;  4BZH A;  2HTA A;  1W2Z A;  3DX4 A;  5A1A A;  3AFJ A;  1O7D D;  3VDB A;  3X3X A;  2WVY A;  1JYV A;  1LXM A;  1LF9 A;  2YFN A;  3HI7 A;  2E22 A;  3MI6 A;  3DEC A;  2WW3 A;  3BUQ A;  1NS8 A;  4DUW A;  2WCO A;  2XSG A;  3X3Z A;  1PU4 A;  4BZF A;  3S4B A;  1EKM A;  2EAE A;  1N7Q A;  1K1W A;  1SPU A;  3WA2 X;  1MMY A;  1H54 A;  3D4Y A;  1JZ5 A;  3BVU A;  1JZ3 A;  3K5T A;  2WVX A;  3SXX A;  3T2Q A;  3QDE A;  1C82 A;  1JZ8 A;  3I3B A;  3BGA A;  3J7H A;  1LUR A;  3ECQ A;  3MWX A;  1JZ6 A;  3X40 A;  1YGA A;  3DX0 A;  3NBB A;  1AV4 A;  1D6U A;  1NSV A;  2OW7 A;  1NS0 A;  3NBJ A;  1HTY A;  1QWU A;  1NS7 A;  4BTW A;  2FUQ A;  1US1 A;  1NS4 A;  1OAC A;  4OK2 A;  2E2T A;  1QAK A;  2Y73 A;  4KFD A;  2EAB A;  3D4Z A;  1OJN A;  2X03 A;  1QAF A;  2CFL A;  2FUT A;  2FYV A;  3EJT A;  4K3A A;  1YQ2 A;  2WDA A;  3D3I A;  1HWW A;  3MUY 1;  1JYN A;  3BUD A;  4DUV A;  3DX1 A;  1NSX A;  3BVX A;  4FNQ A;  1LOH A;  3T2O A;  2JKP A;  3D50 A;  1D6Z A;  2D1W A;  4BTX A;  1JOV A;  1SO0 A;  1WMO A;  2WW2 A;  1DYU A;  3IAQ A;  3LVT A;  1KSI A;  4FNS A;  3MPH A;  1HM2 A;  4DUX A;  4EV5 A;  1PX4 A;  2XN1 A;  3DYP A;  2F7O A;  1RJO A;  3BUI A;  1PS3 A;  3S4D A;  3W7T A;  1ULV A;  3AMO A;  3SX1 A;  1WMP A;  4AQ0 A;  4OJZ A;  1J0N A;  1Z45 A;  3OB8 A;  3OBA A;  3N9H A;  1N7O A;  4BTY A;  3CV5 A;  1NSU A;  1NSS A;  4MMH A;  4KFE A;  3IAP A;  1QX1 A;  1HN0 A;  1UI7 A;  2CIR A;  1NSZ A;  2WOH A;  3BVW A;  2C10 A;  3AFL A;  1RKY A;  2F7Q A;  2CWU A;  1NS2 A;  3BVV A;  3QFY A;  4FNT A;  1IVX A;  1L7K A;  2PNC A;  3X41 A;  3PGB A;  1A2V A;  3S4C A;  3SEP A;  1V7V A;  1JZ2 A;  3T08 A;  4UFC A;  5GW7 A;  1JRQ A;  3EJQ A;  4BZE A;  1IVW A;  1EGU A;  2WOF A;  1F4A A;  1NSM A;  3WVF A;  5JMD A;  1RWH A;  3BS6 A;  3ACS A;  1JYX A;  4KTR A;  3MV1 1;  2CIQ A;  1RW9 A;  1JYW A;  3NJX A;  4RNL A;  1L7J A;  1OJM A;  3T2P A;  1HMU A;  2D73 A;  2YFO A;  1TQS A;  3T09 A;  1QWN A;  2OQE A;  3EJS A;  2CQS A;  3WIR A;  1RWA A;  1V7X A;  3T0A A;  3MUZ 1;  2WVZ A;  2CWV A;  1HM3 A;  3VDA A;  2WVX B;  3X3Y A;  1K1X A;  2ZQ0 A;  5E1Q A;  3BLB A;  5JMF A;  4FNP A;  3I3D A;  4OK4 A;  1UI8 A;  3BUB A;  2OOV A;  3QG0 A;  3EJU A;  3W7W A;  1WMN A;  2ZXQ A;  2C11 A;  1IVU A;  1N7P A;  4J5T A;  3K25 A;  2E24 A;  5KBP A;  1JZ7 A;  1AVK A;  3DYM A;  2EAD A;  2ALW A; 
#chains in the Genus database with same CATH homology
 3VD9 A;  1F1S A;  1NSS A;  1NSU A;  4MMH A;  1RWF A;  3A0O A;  3IAP A;  2WZS A;  1JZ5 A;  1HN0 A;  1RWC A;  3VSM A;  1OJO A;  2CIR A;  1JZ3 A;  3MV0 1;  2WVX A;  1NSZ A;  1X1H A;  3T2Q A;  3AFL A;  1C82 A;  3T0D A;  1F9G A;  2BRW A;  1JZ8 A;  3DCD A;  1NS2 A;  1HMW A;  2WW0 A;  3I3B A;  3BGA A;  1PX3 A;  3J7H A;  1LUR A;  2JKA A;  3VD7 A;  1JZ4 A;  3ECQ A;  3MWX A;  1JZ6 A;  1YGA A;  3VSN A;  1J0M A;  1L7K A;  2CIS A;  3SEP A;  1LXK A;  1NSV A;  1HN1 A;  1W3Y A;  1UG9 A;  1NS0 A;  1I8Q A;  3VDC A;  1JZ2 A;  3T08 A;  1DP0 A;  1RWG A;  4NEI A;  2Q1F A;  3Q1N A;  3VD3 A;  1NS7 A;  2FUQ A;  3I3E A;  1NS4 A;  4BZE A;  1EGU A;  4OK2 A;  1F4A A;  1NSM A;  3WVF A;  5JMD A;  1RWH A;  3CZJ A;  3VD4 A;  3BS6 A;  1OJN A;  2X03 A;  1JYX A;  3BLC A;  4FNV A;  2WW1 A;  2FUT A;  3MV1 1;  3E7J A;  2CIQ A;  1MMZ A;  1RW9 A;  1MN0 A;  2BRV X;  1YQ2 A;  1OJP A;  2WDA A;  1JYW A;  3WFA A;  2JKE A;  3MUY 1;  1MMU A;  2HTB A;  3NJX A;  1SNZ A;  1JYN A;  4DUV A;  4RNL A;  1NSX A;  1L7J A;  1OJM A;  1X1I A;  3E80 A;  3T2P A;  1HMU A;  2D73 A;  3NRE A;  1LOH A;  3T2O A;  2JKP A;  4BZG A;  1K1Y A;  3NJV A;  1TXK A;  1N7N A;  3T09 A;  3A24 A;  1RWA A;  4TTG A;  3IMH A;  1X1J A;  3T0A A;  3MUZ 1;  1JOV A;  1SO0 A;  2WVZ A;  1F4H A;  1N7R A;  2BRP A;  3E1F 1;  1HM3 A;  2HTA A;  3TY1 A;  2WVX B;  3VDA A;  4BZH A;  1CB8 A;  1K1X A;  2WW2 A;  2ZQ0 A;  5E1Q A;  5A1A A;  1LF6 A;  3IAQ A;  3VDB A;  5JMF A;  1HM2 A;  3I3D A;  2WVY A;  1JYV A;  1MMX A;  4OK4 A;  1LXM A;  1LF9 A;  1PX4 A;  3OS7 A;  4MMI A;  3DYP A;  1NSR A;  2E22 A;  3T0B A;  2XHN A;  3DEC A;  1NKG A;  2ZXQ A;  2WW3 A;  1NS8 A;  1ULV A;  1N7P A;  4DUW A;  4J5T A;  4AQ0 A;  4OJZ A;  3K25 A;  1J0N A;  2E24 A;  2WCO A;  2XSG A;  1Z45 A;  1JZ7 A;  3OB8 A;  4BZF A;  3OBA A;  1N7Q A;  1K1W A;  3DYM A;  3VD5 A;  4DUX A;  3DYO A;  1N7O A;  1MMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...