3DCDA

X-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
300
Chain Sequence
MDYTIENNMIKVVISDHGAEIQSVKSAHTDEEFMWQANPEIWGRHAPVLFPIVGRLKNDEYTYKGKTYHLGQHGFARNADFEVENHTKESITFLLKDNEETRKVYPFKFEFRVNYNLMNNLLEENFSVVNKSDETMIFGVGGHPGFNLPTDHGENKEDFYFDMHPSVTRVRIPLKDASLDWNNRSLAPTDSLIALSDDLFKDDALIYELRGNDNKVSLRTDKNKFHVNVWTRDAPFVGIWSQYPKTDNYVCIEPWWGIADRDDADGDLEHKYGMNHLKPGKEFQAGFSMTYHSTTDEVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose mutarotase related enzyme
publication title X-ray structure of the galactose mutarotase related enzyme Q5FKD7 from Lactobacillus acidophilus at the resolution 1.9A. Northeast Structural Genomics consortium target LaR33. (CASP Target)
rcsb
molecule tags Structural genomics, unknown function
total genus 68
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3dcdA00
1MMZA 1RWCA 1F4HA 1Z45A 3VDBA 2WVXB 1JOVA 3J7HA 1NS4A 1NSUA 2JKEA 3DYMA 3VDAA 1UG9A 3T2QA 3DCDA 3T2OA 1F4AA 3K25A 1SO0A 1HN0A 1N7NA 2WW3A 1LXMA 1OJOA 3I3EA 1YGAA 1JYWA 3MUY1 1W3YA 2E22A 3VDCA 1RWFA 1JYVA 1JZ5A 3IAQA 1K1WA 1NSMA 1K1YA 1NKGA 1N7OA 1PX3A 2XSGA 3VD5A 1HMUA 1MMYA 1NS7A 2HTAA 3I3DA 1LURA 3VD4A 3DECA 4DUWA 3MUZ1 1NS8A 1NS2A 1NSXA 1LF9A 1OJMA 1C82A 1JYXA 2HTBA 5E1QA 1OJNA 1NS0A 1MN0A 2JKAA 1CB8A 3T0BA 3T08A 4BZGA 3SEPA 3A24A 2WW0A 1N7QA 1JYNA 1X1JA 3VD3A 1NSZA 3BGAA 1L7KA 1JZ2A 1F9GA 2WW2A 4BZHA 2ZQ0A 3E1F1 1PX4A 1HMWA 3OB8A 1X1HA 1LF6A 1ULVA 1JZ3A 1NSSA 1X1IA 2WVYA 2JKPA 3NREA 1RWAA 3MV11 1HM3A 2WVZA 4TTGA 1J0MA 1RW9A 1OJPA 1I8QA 1K1XA 1LOHA 2WVXA 4AQ0A 3T2PA 1NSRA 3DYPA 1L7JA 3MWXA 1HN1A 1TXKA 3ECQA 1EGUA 2Q1FA 2BRPA 4BZEA 3Q1NA 5A1AA 3CZJA 1RWHA 3T09A 1N7PA 2BRVX 3T0DA 1JZ7A 3NJVA 1MMUA 4DUVA 1N7RA 4DUXA 1DP0A 1HM2A 4RNLA 4BZFA 2CIRA 3DYOA 1J0NA 2BRWA 2E24A 3VD9A 2CIQA 2WCOA 3NJXA 2XHNA 3OS7A 2X03A 1LXKA 2WDAA 3I3BA 2WZSA 2CISA 1RWGA 1JZ8A 3OBAA 1SNZA 1MMXA 2WW1A 3WFAA 1F1SA 1JZ6A 3IAPA 3MV01 1JZ4A 2D73A 1NSVA 3IMHA 3VD7A 3T0AA 2ZXQA 1YQ2A
chains in the Genus database with same CATH superfamily
1WMOA 1Z45A 3J7HA 1D6YA 1JOVA 3ACTA 3X42A 1IVUA 1NS4A 1PS3A 1W2ZA 3AFLA 1UG9A 1RKYA 1IQXA 1WMNA 2CWUA 1N7NA 3K25A 3T0UA 1LXMA 1YGAA 1QALA 2E2VA 4OJZA 2CQTA 1W3YA 3WA3A 1JRQA 2WOHA 4EV5A 2ZL8A 1TQWA 3ACSA 2YFOA 3VD4A 3DECA 3MUZ1 4MMIA 1RJOA 1NS2A 1OJMA 5E1QA 2CG1A 3W7SA 3T0BA 2JKAA 3X40A 1CB8A 1PU4A 3A24A 5JMFA 3KIIA 1X1JA 3VD3A 1NSZA 3CV5A 1A2VA 4BZHA 2ZQ0A 3QFYA 1PX4A 3OB8A 1LF6A 1US1A 2F18A 4FNRA 3SXXA 1W5ZA 2WOFA 3MV11 1J0MA 3W7XA 1N9EA 4AQ0A 1R33A 3CZSA 1DYUA 1TXKA 3ECQA 1IVXA 1QAKA 2Q1FA 3RSYA 2PNCA 3CZJA 2F1BA 3BVUA 3D50A 4FNTA 2BRVX 3NJVA 1MMUA 2EABA 3DYOA 1J0NA 3EJPA 4KTPA 3OS7A 1RWGA 1W7CA 2ALWA 1TQVA 3HIGA 3W7TA 3BS6A 2CFDA 1JZ4A 3CZNA 3T0AA 1YQ2A 1RWCA 1F4HA 1V7VA 3BVVA 1V7XA 2OOVA 1IVWA 4UFCA 3NBBA 3DX4A 2JKEA 3DCDA 1AV4A 2WYIA 3LOYA 3KN4A 2OOVC 3ALAA 1QAFA 3QDEA 2E22A 1RWFA 1JYVA 1JZ5A 3DX0A 1TQTA 2XSGA 3VD5A 3EJUA 2HTAA 4DUWA 3BLCA 1NS8A 3VSNA 4BTYA 1NSXA 2HTBA 1LVNA 3NBJA 1NS0A 2E2UA 4BZGA 4EV2A 3SEPA 3MI6A 3BGAA 3X41A 1L7KA 3TY1A 1F9GA 1UI7A 3BVTA 3E1F1 3EJQA 3VSMA 1NSSA 3X3YA 2CG0A 1AVLA 1LOHA 1NSRA 3DYPA 3S4DA 1HTYA 3BUDA 1RWHA 2F7RA 1QWUA 1JZ7A 2C11A 4DUVA 1N7RA 1IQYA 1DP0A 1HM2A 3D4ZA 3BLBA 2CFKA 4FNSA 1HXKA 2WZSA 3D4YA 1JZ8A 3WFAA 4FNPA 1D6UA 4MMHA 4KFEA 3T0DA 2RDYA 3EJSA 3VDBA 2OW7A 3DYMA 3VDAA 2WW3A 3MPHA 2YX9A 3MUY1 4KFFA 3QFZA 3W7WA 1SIIA 3A0OA 3EJTA 2BT3A 3DDFA 1K1YA 1PX3A 1AVKA 1HMUA 1R34A 3I3DA 2CFGA 4FNUA 1O7DD 2F7QA 3K5TA 1C82A 3WIQA 5GW7A 3S4AA 1OJNA 1MN0A 3DX2A 4K35A 2WW0A 1N7QA 2W0QA 3S4BA 3PGBA 1WMPA 2CFWA 1JZ2A 1V7WA 1W6CA 2CQSA 3N9HA 3HI7A 3BUBA 5KBPA 4FNQA 1X1HA 3D51A 1ULVA 1X1IA 2WVYA 3NREA 1RWAA 1HM3A 2WVZA 1OJPA 2Y73A 3E80A 2WVXA 3T2PA 2EACA 1L7JA 3MWXA 1EGUA 4OK4A 3WVFA 2BRPA 4BZEA 4NEIA 4K3AA 1TQSA 3BVXA 3T09A 1N7PA 4DUXA 4RNLA 4BZFA 1TQUA 2CIRA 2CWVA 4FNVA 2BRWA 3QG0A 4OK2A 1TU5A 3BUPA 2XN2A 3NJXA 1UI8A 1LXKA 2WDAA 3I3BA 2CISA 2F7PA 2D1WA 2EAEA 2WW1A 5CA3A 1F1SA 3HIIA 3EJRA 1NSVA 4BTWA 1EKMA 1MMZA 2E2TA 2F1AA 2XN0A 2WVXB 1NSUA 3E7JA 1OACA 1W4NA 3T2QA 3T2OA 3DDGA 1F4AA 1SO0A 1HN0A 1OJOA 3I3EA 1D6ZA 1JYWA 2FYVA 3LVTA 5JMDA 2FUTA 2F7OA 2C10A 3VDCA 3BVWA 3IAQA 3X3XA 1K1WA 1NSMA 1NKGA 1N7OA 1MMYA 1NS7A 1LURA 1QX1A 1KSIA 3DX3A 1LF9A 3W7UA 2FUQA 1JYXA 3T08A 3BUQA 1JYNA 1SIHA 3BUIA 3SX1A 2WW2A 3AMOA 4J5TA 1HMWA 2WGQA 3RRSA 1JZ3A 1IVVA 2JKPA 3WIRA 4TTGA 1RW9A 1I8QA 1K1XA 1QWNA 4BTXA 1SPUA 1HN1A 3S4CA 3Q1NA 5A1AA 3D52A 2EADA 3X3ZA 2WYHA 3AFJA 3D3IA 2OQEA 1HWWA 2CFLA 3WA2X 2XN1A 1W6GA 4KFDA 4KTRA 2E24A 1H54A 2CIQA 2WCOA 2X03A 2OQEC 2XHNA 3VD9A 1IU7A 2CWTA 3OBAA 1SNZA 1MMXA 3AMOB 2OW6A 2YFNA 1JZ6A 3DX1A 3MV01 2WO0A 2D73A 3IMHA 2Y74A 3VD7A 2ZXQA 3IAPA
chains in the Genus database with same CATH topology
1MMZA 1RWCA 1F4HA 1Z45A 3VDBA 2WVXB 1JOVA 3J7HA 1NS4A 1NSUA 3AFLA 3E7JA 2JKEA 3DYMA 3VDAA 1UG9A 3T2QA 3DCDA 3T2OA 1F4AA 3K25A 1SO0A 1HN0A 1N7NA 2WW3A 1LXMA 1OJOA 3I3EA 1YGAA 1JYWA 3MUY1 4OJZA 1W3YA 5JMDA 2FUTA 2E22A 3A0OA 3VDCA 1RWFA 1JYVA 1JZ5A 3IAQA 1K1WA 1NSMA 1K1YA 1NKGA 1N7OA 1PX3A 2XSGA 3VD5A 1HMUA 1MMYA 1NS7A 2HTAA 3I3DA 1LURA 3VD4A 3DECA 4DUWA 3BLCA 3MUZ1 4MMIA 1NS8A 3VSNA 1NS2A 1NSXA 1LF9A 1OJMA 1C82A 2FUQA 2HTBA 5E1QA 1JYXA 1OJNA 1NS0A 1MN0A 2JKAA 1CB8A 3T0BA 3T08A 4BZGA 3SEPA 3A24A 5JMFA 2WW0A 1N7QA 1JYNA 1X1JA 3VD3A 1NSZA 3BGAA 1L7KA 3TY1A 1JZ2A 1F9GA 2WW2A 4BZHA 2ZQ0A 3E1F1 1PX4A 4J5TA 1HMWA 3OB8A 1X1HA 1LF6A 1ULVA 3VSMA 1JZ3A 1NSSA 1X1IA 2WVYA 2JKPA 3NREA 1RWAA 3MV11 1HM3A 2WVZA 4TTGA 1J0MA 1RW9A 1OJPA 1I8QA 3E80A 1K1XA 1LOHA 2WVXA 4AQ0A 3T2PA 1NSRA 3DYPA 1L7JA 3MWXA 1HN1A 1TXKA 3ECQA 1EGUA 2Q1FA 4OK4A 2BRPA 3WVFA 4BZEA 3Q1NA 5A1AA 4NEIA 3CZJA 1RWHA 3T09A 1N7PA 2BRVX 3T0DA 1JZ7A 3NJVA 1MMUA 4DUVA 1N7RA 4DUXA 1DP0A 1HM2A 4RNLA 4BZFA 2CIRA 3DYOA 4FNVA 1J0NA 2BRWA 4OK2A 2E24A 3VD9A 2CIQA 2WCOA 3NJXA 2XHNA 3OS7A 2X03A 1LXKA 2WDAA 3I3BA 2WZSA 2CISA 1RWGA 1JZ8A 3OBAA 1SNZA 1MMXA 2WW1A 3WFAA 1F1SA 1JZ6A 3BS6A 3IAPA 3MV01 1JZ4A 4MMHA 2D73A 1NSVA 3IMHA 3VD7A 3T0AA 2ZXQA 1YQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMZ A;  1RWC A;  1F4H A;  1Z45 A;  3VDB A;  2WVX B;  1JOV A;  3J7H A;  1NS4 A;  1NSU A;  2JKE A;  3DYM A;  3VDA A;  1UG9 A;  3T2Q A;  3DCD A;  3T2O A;  1F4A A;  3K25 A;  1SO0 A;  1HN0 A;  1N7N A;  2WW3 A;  1LXM A;  1OJO A;  3I3E A;  1YGA A;  1JYW A;  3MUY 1;  1W3Y A;  2E22 A;  3VDC A;  1RWF A;  1JYV A;  1JZ5 A;  3IAQ A;  1K1W A;  1NSM A;  1K1Y A;  1NKG A;  1N7O A;  1PX3 A;  2XSG A;  3VD5 A;  1HMU A;  1MMY A;  1NS7 A;  2HTA A;  3I3D A;  1LUR A;  3VD4 A;  3DEC A;  4DUW A;  3MUZ 1;  1NS8 A;  1NS2 A;  1NSX A;  1LF9 A;  1OJM A;  1C82 A;  1JYX A;  2HTB A;  5E1Q A;  1OJN A;  1NS0 A;  1MN0 A;  2JKA A;  1CB8 A;  3T0B A;  3T08 A;  4BZG A;  3SEP A;  3A24 A;  2WW0 A;  1N7Q A;  1JYN A;  1X1J A;  3VD3 A;  1NSZ A;  3BGA A;  1L7K A;  1JZ2 A;  1F9G A;  2WW2 A;  4BZH A;  2ZQ0 A;  3E1F 1;  1PX4 A;  1HMW A;  3OB8 A;  1X1H A;  1LF6 A;  1ULV A;  1JZ3 A;  1NSS A;  1X1I A;  2WVY A;  2JKP A;  3NRE A;  1RWA A;  3MV1 1;  1HM3 A;  2WVZ A;  4TTG A;  1J0M A;  1RW9 A;  1OJP A;  1I8Q A;  1K1X A;  1LOH A;  2WVX A;  4AQ0 A;  3T2P A;  1NSR A;  3DYP A;  1L7J A;  3MWX A;  1HN1 A;  1TXK A;  3ECQ A;  1EGU A;  2Q1F A;  2BRP A;  4BZE A;  3Q1N A;  5A1A A;  3CZJ A;  1RWH A;  3T09 A;  1N7P A;  2BRV X;  3T0D A;  1JZ7 A;  3NJV A;  1MMU A;  4DUV A;  1N7R A;  4DUX A;  1DP0 A;  1HM2 A;  4RNL A;  4BZF A;  2CIR A;  3DYO A;  1J0N A;  2BRW A;  2E24 A;  3VD9 A;  2CIQ A;  2WCO A;  3NJX A;  2XHN A;  3OS7 A;  2X03 A;  1LXK A;  2WDA A;  3I3B A;  2WZS A;  2CIS A;  1RWG A;  1JZ8 A;  3OBA A;  1SNZ A;  1MMX A;  2WW1 A;  3WFA A;  1F1S A;  1JZ6 A;  3IAP A;  3MV0 1;  1JZ4 A;  2D73 A;  1NSV A;  3IMH A;  3VD7 A;  3T0A A;  2ZXQ A;  1YQ2 A; 
#chains in the Genus database with same CATH topology
 1WMO A;  1Z45 A;  3J7H A;  1D6Y A;  1JOV A;  3ACT A;  3X42 A;  1IVU A;  1NS4 A;  1PS3 A;  1W2Z A;  3AFL A;  1UG9 A;  1RKY A;  1IQX A;  1WMN A;  2CWU A;  1N7N A;  3K25 A;  3T0U A;  1LXM A;  1YGA A;  1QAL A;  2E2V A;  4OJZ A;  2CQT A;  1W3Y A;  3WA3 A;  1JRQ A;  2WOH A;  4EV5 A;  2ZL8 A;  1TQW A;  3ACS A;  2YFO A;  3VD4 A;  3DEC A;  3MUZ 1;  4MMI A;  1RJO A;  1NS2 A;  1OJM A;  5E1Q A;  2CG1 A;  3W7S A;  3T0B A;  2JKA A;  3X40 A;  1CB8 A;  1PU4 A;  3A24 A;  5JMF A;  3KII A;  1X1J A;  3VD3 A;  1NSZ A;  3CV5 A;  1A2V A;  4BZH A;  2ZQ0 A;  3QFY A;  1PX4 A;  3OB8 A;  1LF6 A;  1US1 A;  2F18 A;  4FNR A;  3SXX A;  1W5Z A;  2WOF A;  3MV1 1;  1J0M A;  3W7X A;  1N9E A;  4AQ0 A;  1R33 A;  3CZS A;  1DYU A;  1TXK A;  3ECQ A;  1IVX A;  1QAK A;  2Q1F A;  3RSY A;  2PNC A;  3CZJ A;  2F1B A;  3BVU A;  3D50 A;  4FNT A;  2BRV X;  3NJV A;  1MMU A;  2EAB A;  3DYO A;  1J0N A;  3EJP A;  4KTP A;  3OS7 A;  1RWG A;  1W7C A;  2ALW A;  1TQV A;  3HIG A;  3W7T A;  3BS6 A;  2CFD A;  1JZ4 A;  3CZN A;  3T0A A;  1YQ2 A;  1RWC A;  1F4H A;  1V7V A;  3BVV A;  1V7X A;  2OOV A;  1IVW A;  4UFC A;  3NBB A;  3DX4 A;  2JKE A;  3DCD A;  1AV4 A;  2WYI A;  3LOY A;  3KN4 A;  2OOV C;  3ALA A;  1QAF A;  3QDE A;  2E22 A;  1RWF A;  1JYV A;  1JZ5 A;  3DX0 A;  1TQT A;  2XSG A;  3VD5 A;  3EJU A;  2HTA A;  4DUW A;  3BLC A;  1NS8 A;  3VSN A;  4BTY A;  1NSX A;  2HTB A;  1LVN A;  3NBJ A;  1NS0 A;  2E2U A;  4BZG A;  4EV2 A;  3SEP A;  3MI6 A;  3BGA A;  3X41 A;  1L7K A;  3TY1 A;  1F9G A;  1UI7 A;  3BVT A;  3E1F 1;  3EJQ A;  3VSM A;  1NSS A;  3X3Y A;  2CG0 A;  1AVL A;  1LOH A;  1NSR A;  3DYP A;  3S4D A;  1HTY A;  3BUD A;  1RWH A;  2F7R A;  1QWU A;  1JZ7 A;  2C11 A;  4DUV A;  1N7R A;  1IQY A;  1DP0 A;  1HM2 A;  3D4Z A;  3BLB A;  2CFK A;  4FNS A;  1HXK A;  2WZS A;  3D4Y A;  1JZ8 A;  3WFA A;  4FNP A;  1D6U A;  4MMH A;  4KFE A;  3T0D A;  2RDY A;  3EJS A;  3VDB A;  2OW7 A;  3DYM A;  3VDA A;  2WW3 A;  3MPH A;  2YX9 A;  3MUY 1;  4KFF A;  3QFZ A;  3W7W A;  1SII A;  3A0O A;  3EJT A;  2BT3 A;  3DDF A;  1K1Y A;  1PX3 A;  1AVK A;  1HMU A;  1R34 A;  3I3D A;  2CFG A;  4FNU A;  1O7D D;  2F7Q A;  3K5T A;  1C82 A;  3WIQ A;  5GW7 A;  3S4A A;  1OJN A;  1MN0 A;  3DX2 A;  4K35 A;  2WW0 A;  1N7Q A;  2W0Q A;  3S4B A;  3PGB A;  1WMP A;  2CFW A;  1JZ2 A;  1V7W A;  1W6C A;  2CQS A;  3N9H A;  3HI7 A;  3BUB A;  5KBP A;  4FNQ A;  1X1H A;  3D51 A;  1ULV A;  1X1I A;  2WVY A;  3NRE A;  1RWA A;  1HM3 A;  2WVZ A;  1OJP A;  2Y73 A;  3E80 A;  2WVX A;  3T2P A;  2EAC A;  1L7J A;  3MWX A;  1EGU A;  4OK4 A;  3WVF A;  2BRP A;  4BZE A;  4NEI A;  4K3A A;  1TQS A;  3BVX A;  3T09 A;  1N7P A;  4DUX A;  4RNL A;  4BZF A;  1TQU A;  2CIR A;  2CWV A;  4FNV A;  2BRW A;  3QG0 A;  4OK2 A;  1TU5 A;  3BUP A;  2XN2 A;  3NJX A;  1UI8 A;  1LXK A;  2WDA A;  3I3B A;  2CIS A;  2F7P A;  2D1W A;  2EAE A;  2WW1 A;  5CA3 A;  1F1S A;  3HII A;  3EJR A;  1NSV A;  4BTW A;  1EKM A;  1MMZ A;  2E2T A;  2F1A A;  2XN0 A;  2WVX B;  1NSU A;  3E7J A;  1OAC A;  1W4N A;  3T2Q A;  3T2O A;  3DDG A;  1F4A A;  1SO0 A;  1HN0 A;  1OJO A;  3I3E A;  1D6Z A;  1JYW A;  2FYV A;  3LVT A;  5JMD A;  2FUT A;  2F7O A;  2C10 A;  3VDC A;  3BVW A;  3IAQ A;  3X3X A;  1K1W A;  1NSM A;  1NKG A;  1N7O A;  1MMY A;  1NS7 A;  1LUR A;  1QX1 A;  1KSI A;  3DX3 A;  1LF9 A;  3W7U A;  2FUQ A;  1JYX A;  3T08 A;  3BUQ A;  1JYN A;  1SIH A;  3BUI A;  3SX1 A;  2WW2 A;  3AMO A;  4J5T A;  1HMW A;  2WGQ A;  3RRS A;  1JZ3 A;  1IVV A;  2JKP A;  3WIR A;  4TTG A;  1RW9 A;  1I8Q A;  1K1X A;  1QWN A;  4BTX A;  1SPU A;  1HN1 A;  3S4C A;  3Q1N A;  5A1A A;  3D52 A;  2EAD A;  3X3Z A;  2WYH A;  3AFJ A;  3D3I A;  2OQE A;  1HWW A;  2CFL A;  3WA2 X;  2XN1 A;  1W6G A;  4KFD A;  4KTR A;  2E24 A;  1H54 A;  2CIQ A;  2WCO A;  2X03 A;  2OQE C;  2XHN A;  3VD9 A;  1IU7 A;  2CWT A;  3OBA A;  1SNZ A;  1MMX A;  3AMO B;  2OW6 A;  2YFN A;  1JZ6 A;  3DX1 A;  3MV0 1;  2WO0 A;  2D73 A;  3IMH A;  2Y74 A;  3VD7 A;  2ZXQ A;  3IAP A; 
#chains in the Genus database with same CATH homology
 1MMZ A;  1RWC A;  1F4H A;  1Z45 A;  3VDB A;  2WVX B;  1JOV A;  3J7H A;  1NS4 A;  1NSU A;  3AFL A;  3E7J A;  2JKE A;  3DYM A;  3VDA A;  1UG9 A;  3T2Q A;  3DCD A;  3T2O A;  1F4A A;  3K25 A;  1SO0 A;  1HN0 A;  1N7N A;  2WW3 A;  1LXM A;  1OJO A;  3I3E A;  1YGA A;  1JYW A;  3MUY 1;  4OJZ A;  1W3Y A;  5JMD A;  2FUT A;  2E22 A;  3A0O A;  3VDC A;  1RWF A;  1JYV A;  1JZ5 A;  3IAQ A;  1K1W A;  1NSM A;  1K1Y A;  1NKG A;  1N7O A;  1PX3 A;  2XSG A;  3VD5 A;  1HMU A;  1MMY A;  1NS7 A;  2HTA A;  3I3D A;  1LUR A;  3VD4 A;  3DEC A;  4DUW A;  3BLC A;  3MUZ 1;  4MMI A;  1NS8 A;  3VSN A;  1NS2 A;  1NSX A;  1LF9 A;  1OJM A;  1C82 A;  2FUQ A;  2HTB A;  5E1Q A;  1JYX A;  1OJN A;  1NS0 A;  1MN0 A;  2JKA A;  1CB8 A;  3T0B A;  3T08 A;  4BZG A;  3SEP A;  3A24 A;  5JMF A;  2WW0 A;  1N7Q A;  1JYN A;  1X1J A;  3VD3 A;  1NSZ A;  3BGA A;  1L7K A;  3TY1 A;  1JZ2 A;  1F9G A;  2WW2 A;  4BZH A;  2ZQ0 A;  3E1F 1;  1PX4 A;  4J5T A;  1HMW A;  3OB8 A;  1X1H A;  1LF6 A;  1ULV A;  3VSM A;  1JZ3 A;  1NSS A;  1X1I A;  2WVY A;  2JKP A;  3NRE A;  1RWA A;  3MV1 1;  1HM3 A;  2WVZ A;  4TTG A;  1J0M A;  1RW9 A;  1OJP A;  1I8Q A;  3E80 A;  1K1X A;  1LOH A;  2WVX A;  4AQ0 A;  3T2P A;  1NSR A;  3DYP A;  1L7J A;  3MWX A;  1HN1 A;  1TXK A;  3ECQ A;  1EGU A;  2Q1F A;  4OK4 A;  2BRP A;  3WVF A;  4BZE A;  3Q1N A;  5A1A A;  4NEI A;  3CZJ A;  1RWH A;  3T09 A;  1N7P A;  2BRV X;  3T0D A;  1JZ7 A;  3NJV A;  1MMU A;  4DUV A;  1N7R A;  4DUX A;  1DP0 A;  1HM2 A;  4RNL A;  4BZF A;  2CIR A;  3DYO A;  4FNV A;  1J0N A;  2BRW A;  4OK2 A;  2E24 A;  3VD9 A;  2CIQ A;  2WCO A;  3NJX A;  2XHN A;  3OS7 A;  2X03 A;  1LXK A;  2WDA A;  3I3B A;  2WZS A;  2CIS A;  1RWG A;  1JZ8 A;  3OBA A;  1SNZ A;  1MMX A;  2WW1 A;  3WFA A;  1F1S A;  1JZ6 A;  3BS6 A;  3IAP A;  3MV0 1;  1JZ4 A;  4MMH A;  2D73 A;  1NSV A;  3IMH A;  3VD7 A;  3T0A A;  2ZXQ A;  1YQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...