3DCDA

X-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
300
Chain Sequence
b'MDYTIENNMIKVVISDHGAEIQSVKSAHTDEEFMWQANPEIWGRHAPVLFPIVGRLKNDEYTYKGKTYHLGQHGFARNADFEVENHTKESITFLLKDNEETRKVYPFKFEFRVNYNLMNNLLEENFSVVNKSDETMIFGVGGHPGFNLPTDHGENKEDFYFDMHPSVTRVRIPLKDASLDWNNRSLAPTDSLIALSDDLFKDDALIYELRGNDNKVSLRTDKNKFHVNVWTRDAPFVGIWSQYPKTDNYVCIEPWWGIADRDDADGDLEHKYGMNHLKPGKEFQAGFSMTYHSTTDEVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose mutarotase related enzyme
publication title X-ray structure of the galactose mutarotase related enzyme Q5FKD7 from Lactobacillus acidophilus at the resolution 1.9A. Northeast Structural Genomics consortium target LaR33. (CASP Target)
rcsb
molecule tags Structural genomics, unknown function
total genus 68
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3dcdA00
3T0DA 1NSRA 2WVYA 1RW9A 2E22A 3I3EA 1JZ7A 3VD3A 3K25A 3MUZ1 1JZ3A 3T0AA 1X1JA 3MUY1 3Q1NA 1F4HA 1HMWA 1RWAA 2X03A 4BZGA 1RWGA 1L7JA 2WW2A 2JKEA 2WVXB 1K1WA 2WW0A 2WDAA 1K1YA 2ZQ0A 1SO0A 2E24A 3ECQA 1JZ2A 1JYVA 2XSGA 1HM2A 3IAPA 4DUWA 3CZJA 3A24A 2Q1FA 3OB8A 1MMXA 3DYOA 1LOHA 3VD7A 1OJPA 3T09A 1OJMA 1NS7A 1YQ2A 2WW3A 1Z45A 1K1XA 3DYPA 1EGUA 5A1AA 1I8QA 3DCDA 1W3YA 1MMUA 1MMZA 2WZSA 1JYNA 2D73A 2CIRA 1JZ6A 1MMYA 1UG9A 3T2QA 1ULVA 2WVXA 3I3DA 1NSMA 2JKAA 1YGAA 2XHNA 4BZFA 1RWHA 3SEPA 1F9GA 1NSZA 4AQ0A 1RWCA 2WCOA 1F4AA 1PX4A 1JOVA 1NS8A 4RNLA 1JZ5A 1JYWA 1LF6A 3T08A 2WVZA 3MWXA 3T0BA 3NJXA 2ZXQA 3BGAA 1OJNA 3MV11 4BZHA 1HN1A 3OS7A 3OBAA 1N7PA 2WW1A 3VDCA 1DP0A 3WFAA 4BZEA 3NJVA 3DECA 1TXKA 1OJOA 3IMHA 1NS0A 1N7OA 3VDBA 1NSXA 1JZ4A 1NSUA 1CB8A 1RWFA 3J7HA 3T2PA 1LXKA 2CISA 5E1QA 3VD4A 1SNZA 3NREA 3DYMA 3IAQA 1N7RA 4DUXA 3VD5A 1J0MA 1L7KA 1PX3A 1HN0A 1X1HA 2BRVX 1NS2A 4DUVA 4TTGA 1NSSA 3MV01 1LF9A 3T2OA 2BRPA 1JYXA 1NS4A 3I3BA 1LURA 2JKPA 1C82A 1N7NA 1LXMA 1MN0A 1NSVA 3E1F1 1HM3A 1X1IA 1HMUA 1J0NA 1NKGA 3VD9A 2BRWA 2HTAA 2CIQA 1N7QA 2HTBA 3VDAA 1JZ8A 1F1SA
chains in the Genus database with same CATH superfamily
3T0DA 1NSRA 2E22A 3T0UA 3QG0A 4K35A 1IU7A 3MUY1 1QX1A 3Q1NA 1WMNA 1D6UA 2CQTA 3K5TA 1L7JA 2WW2A 3RRSA 1K1WA 2WW0A 3BVWA 2WOHA 4KTRA 3DX2A 3CZJA 3A24A 2FUQA 4BTWA 1W7CA 1SPUA 1YQ2A 3N9HA 1K1XA 3DYPA 1AVLA 1EGUA 2EADA 1R33A 2BT3A 3KIIA 1NSMA 1HXKA 3EJTA 4BZFA 3QFZA 1NSZA 4AQ0A 2WCOA 3MI6A 4FNVA 2ZL8A 3T08A 4BTXA 2WVZA 3MWXA 3X3XA 2FUTA 2ZXQA 1PU4A 3BVTA 1HN1A 3OBAA 3D3IA 3NJVA 4OJZA 3DX1A 1NS0A 3BUDA 1IVVA 1QWUA 1CB8A 2XN2A 1RWFA 3HIGA 4OK4A 1RKYA 2E2TA 2CG1A 2EACA 3NREA 3DYMA 3QDEA 1L7KA 1EKMA 2C10A 1X1HA 4BTYA 2YX9A 1OACA 3S4CA 2ALWA 1V7WA 4MMHA 1MN0A 4NEIA 1HMUA 4KFEA 3VD9A 2BRWA 3EJQA 1F1SA 2WVYA 1RW9A 3BLCA 1IQYA 3VD3A 3K25A 1RWAA 4BZGA 1UI8A 1IQXA 1JYVA 2XSGA 3QFYA 3IAPA 1QAFA 2CQSA 3AMOB 4KFFA 1OJMA 1NS7A 1IVWA 3BUQA 3BUIA 3A0OA 2CFWA 3X3ZA 1HWWA 1RJOA 3DCDA 1W3YA 2F7QA 2D73A 1UG9A 1O7DD 2EABA 1D6ZA 1W6GA 4OK2A 2JKAA 1YGAA 2WYIA 3SEPA 1D6YA 4RNLA 3AFJA 4FNSA 2FYVA 4J5TA 2CWTA 1QAKA 1QWNA 3E80A 3DX4A 1N7PA 3DECA 2PNCA 1TXKA 1OJOA 1IVXA 3BVUA 2OW7A 1PS3A 2OQEC 3VSMA 3AMOA 2WOFA 2CISA 1SNZA 3ALAA 4FNPA 2XN1A 3D51A 4FNUA 4DUXA 3W7WA 1PX3A 2BRVX 1NS2A 4DUVA 1AV4A 1NSSA 4TTGA 3X3YA 1LF9A 1JYXA 1LURA 3BUPA 3WA3A 1LXMA 1TQUA 1LVNA 2F7PA 1HM3A 1V7VA 2YFOA 1J0NA 2E2UA 4KTPA 2CIQA 3S4BA 1UI7A 3I3EA 1JZ7A 3MUZ1 3T0AA 1X1JA 3WIQA 1QALA 1HMWA 2X03A 1RWGA 2JKEA 3ECQA 1SO0A 3WVFA 1HM2A 2OW6A 2Y74A 4DUWA 2Q1FA 2E2VA 3OB8A 1MMXA 1LOHA 2YFNA 3T09A 3D4YA 4MMIA 2WW3A 2F1AA 2RDYA 1JRQA 5A1AA 1MMUA 1MMZA 3RSYA 2WZSA 1JYNA 2CIRA 2CFLA 2F7RA 1ULVA 2WVXA 3BVXA 3NBBA 2CFKA 2XHNA 3EJPA 4UFCA 1F9GA 4FNQA 1F4AA 3SX1A 3TY1A 1PX4A 1JOVA 3S4AA 1NS8A 1LF6A 1JYWA 3T0BA 3NJXA 2WGQA 3BGAA 3DDFA 2D1WA 3BVVA 3MV11 2OQEA 2CWUA 1WMOA 4BZHA 1W6CA 4EV5A 3VDCA 3WFAA 4BZEA 3IMHA 1SIHA 1NSUA 1JZ4A 1TQWA 3EJUA 1TU5A 2F1BA 3D4ZA 2WO0A 3W7UA 1SIIA 3T2PA 1W4NA 1LXKA 5E1QA 3VD4A 1TQSA 3MPHA 3BLBA 3PGBA 3IAQA 3EJSA 3BUBA 3ACSA 1KSIA 1HN0A 2CFGA 1NS4A 1C82A 3E1F1 1X1IA 1NKGA 2CG0A 1W5ZA 2HTAA 1N7QA 3CZSA 1JZ8A 3ACTA 2OOVA 3WA2X 3VSNA 1TQTA 1JZ3A 1F4HA 3AFLA 3X40A 2WVXB 1AVKA 2WDAA 1K1YA 1H54A 2ZQ0A 2E24A 1JZ2A 1R34A 1V7XA 3DYOA 3VD7A 1OJPA 3BS6A 3SXXA 2CWVA 1Z45A 1I8QA 1JZ6A 1MMYA 3D52A 4EV2A 3T2QA 1N9EA 3I3DA 3NBJA 5GW7A 2OOVC 1RWHA 5JMDA 1RWCA 1IVUA 1JZ5A 3DDGA 5JMFA 3LOYA 1OJNA 1US1A 3E7JA 1A2VA 2EAEA 3OS7A 3EJRA 2WW1A 5KBPA 3W7XA 1DP0A 4FNTA 3DX3A 2CFDA 3X41A 1N7OA 3VDBA 1NSXA 1WMPA 3DX0A 5CA3A 1W2ZA 3CZNA 3J7HA 2F7OA 2XN0A 3D50A 3HIIA 4K3AA 3LVTA 2C11A 3WIRA 1TQVA 1DYUA 1N7RA 3KN4A 3W7TA 3X42A 3VD5A 1J0MA 4FNRA 3S4DA 3MV01 2Y73A 3T2OA 2BRPA 4KFDA 2W0QA 3I3BA 2F18A 3CV5A 2JKPA 1N7NA 1NSVA 1HTYA 3HI7A 2HTBA 3W7SA 3VDAA 2WYHA
chains in the Genus database with same CATH topology
3VSNA 1NSRA 2WVYA 1RW9A 2E22A 3BLCA 3I3EA 3T0DA 1JZ7A 3VD3A 3K25A 3MUZ1 1JZ3A 3T0AA 1X1JA 3MUY1 3Q1NA 1F4HA 3AFLA 1HMWA 1RWAA 2X03A 4BZGA 1RWGA 1L7JA 2WW2A 2JKEA 2WVXB 1K1WA 2WW0A 2WDAA 1K1YA 2ZQ0A 1SO0A 2E24A 3ECQA 1JZ2A 1JYVA 2XSGA 3WVFA 1HM2A 3IAPA 4DUWA 3CZJA 3A24A 2FUQA 2Q1FA 3OB8A 1MMXA 3DYOA 1LOHA 3VD7A 1OJPA 3T09A 3BS6A 1OJMA 1NS7A 4MMIA 1YQ2A 2WW3A 1Z45A 3A0OA 1K1XA 3DYPA 1EGUA 5A1AA 1I8QA 3DCDA 1W3YA 1MMUA 1MMZA 2WZSA 1JYNA 2D73A 2CIRA 1JZ6A 1MMYA 1UG9A 3T2QA 1ULVA 2WVXA 3I3DA 4OK2A 1NSMA 2JKAA 1YGAA 2XHNA 4BZFA 1RWHA 3SEPA 5JMDA 1F9GA 1NSZA 4AQ0A 1RWCA 2WCOA 1F4AA 3TY1A 1PX4A 1JOVA 4FNVA 1NS8A 4RNLA 1JZ5A 1JYWA 1LF6A 3T08A 5JMFA 2WVZA 3MWXA 3T0BA 4J5TA 2FUTA 3NJXA 2ZXQA 3BGAA 1OJNA 3MV11 3E7JA 4BZHA 1HN1A 3E80A 3OS7A 3OBAA 1N7PA 2WW1A 3VDCA 1DP0A 3WFAA 4BZEA 3NJVA 3DECA 4OJZA 1TXKA 1OJOA 3IMHA 1NS0A 1N7OA 3VDBA 1NSXA 1JZ4A 1NSUA 1CB8A 1RWFA 3VSMA 4OK4A 3J7HA 3T2PA 1LXKA 2CISA 5E1QA 3VD4A 1SNZA 3NREA 3DYMA 3IAQA 1N7RA 4DUXA 3VD5A 1J0MA 1L7KA 1PX3A 1HN0A 1X1HA 2BRVX 1NS2A 4DUVA 4TTGA 1NSSA 3MV01 1LF9A 3T2OA 2BRPA 1JYXA 1NS4A 3I3BA 1LURA 2JKPA 1C82A 1N7NA 1LXMA 4MMHA 1MN0A 1NSVA 3E1F1 1HM3A 4NEIA 1X1IA 1HMUA 1J0NA 1NKGA 3VD9A 2BRWA 2HTAA 2CIQA 1N7QA 2HTBA 3VDAA 1JZ8A 1F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0D A;  1NSR A;  2WVY A;  1RW9 A;  2E22 A;  3I3E A;  1JZ7 A;  3VD3 A;  3K25 A;  3MUZ 1;  1JZ3 A;  3T0A A;  1X1J A;  3MUY 1;  3Q1N A;  1F4H A;  1HMW A;  1RWA A;  2X03 A;  4BZG A;  1RWG A;  1L7J A;  2WW2 A;  2JKE A;  2WVX B;  1K1W A;  2WW0 A;  2WDA A;  1K1Y A;  2ZQ0 A;  1SO0 A;  2E24 A;  3ECQ A;  1JZ2 A;  1JYV A;  2XSG A;  1HM2 A;  3IAP A;  4DUW A;  3CZJ A;  3A24 A;  2Q1F A;  3OB8 A;  1MMX A;  3DYO A;  1LOH A;  3VD7 A;  1OJP A;  3T09 A;  1OJM A;  1NS7 A;  1YQ2 A;  2WW3 A;  1Z45 A;  1K1X A;  3DYP A;  1EGU A;  5A1A A;  1I8Q A;  3DCD A;  1W3Y A;  1MMU A;  1MMZ A;  2WZS A;  1JYN A;  2D73 A;  2CIR A;  1JZ6 A;  1MMY A;  1UG9 A;  3T2Q A;  1ULV A;  2WVX A;  3I3D A;  1NSM A;  2JKA A;  1YGA A;  2XHN A;  4BZF A;  1RWH A;  3SEP A;  1F9G A;  1NSZ A;  4AQ0 A;  1RWC A;  2WCO A;  1F4A A;  1PX4 A;  1JOV A;  1NS8 A;  4RNL A;  1JZ5 A;  1JYW A;  1LF6 A;  3T08 A;  2WVZ A;  3MWX A;  3T0B A;  3NJX A;  2ZXQ A;  3BGA A;  1OJN A;  3MV1 1;  4BZH A;  1HN1 A;  3OS7 A;  3OBA A;  1N7P A;  2WW1 A;  3VDC A;  1DP0 A;  3WFA A;  4BZE A;  3NJV A;  3DEC A;  1TXK A;  1OJO A;  3IMH A;  1NS0 A;  1N7O A;  3VDB A;  1NSX A;  1JZ4 A;  1NSU A;  1CB8 A;  1RWF A;  3J7H A;  3T2P A;  1LXK A;  2CIS A;  5E1Q A;  3VD4 A;  1SNZ A;  3NRE A;  3DYM A;  3IAQ A;  1N7R A;  4DUX A;  3VD5 A;  1J0M A;  1L7K A;  1PX3 A;  1HN0 A;  1X1H A;  2BRV X;  1NS2 A;  4DUV A;  4TTG A;  1NSS A;  3MV0 1;  1LF9 A;  3T2O A;  2BRP A;  1JYX A;  1NS4 A;  3I3B A;  1LUR A;  2JKP A;  1C82 A;  1N7N A;  1LXM A;  1MN0 A;  1NSV A;  3E1F 1;  1HM3 A;  1X1I A;  1HMU A;  1J0N A;  1NKG A;  3VD9 A;  2BRW A;  2HTA A;  2CIQ A;  1N7Q A;  2HTB A;  3VDA A;  1JZ8 A;  1F1S A; 
#chains in the Genus database with same CATH topology
 3T0D A;  1NSR A;  2E22 A;  3T0U A;  3QG0 A;  4K35 A;  1IU7 A;  3MUY 1;  1QX1 A;  3Q1N A;  1WMN A;  1D6U A;  2CQT A;  3K5T A;  1L7J A;  2WW2 A;  3RRS A;  1K1W A;  2WW0 A;  3BVW A;  2WOH A;  4KTR A;  3DX2 A;  3CZJ A;  3A24 A;  2FUQ A;  4BTW A;  1W7C A;  1SPU A;  1YQ2 A;  3N9H A;  1K1X A;  3DYP A;  1AVL A;  1EGU A;  2EAD A;  1R33 A;  2BT3 A;  3KII A;  1NSM A;  1HXK A;  3EJT A;  4BZF A;  3QFZ A;  1NSZ A;  4AQ0 A;  2WCO A;  3MI6 A;  4FNV A;  2ZL8 A;  3T08 A;  4BTX A;  2WVZ A;  3MWX A;  3X3X A;  2FUT A;  2ZXQ A;  1PU4 A;  3BVT A;  1HN1 A;  3OBA A;  3D3I A;  3NJV A;  4OJZ A;  3DX1 A;  1NS0 A;  3BUD A;  1IVV A;  1QWU A;  1CB8 A;  2XN2 A;  1RWF A;  3HIG A;  4OK4 A;  1RKY A;  2E2T A;  2CG1 A;  2EAC A;  3NRE A;  3DYM A;  3QDE A;  1L7K A;  1EKM A;  2C10 A;  1X1H A;  4BTY A;  2YX9 A;  1OAC A;  3S4C A;  2ALW A;  1V7W A;  4MMH A;  1MN0 A;  4NEI A;  1HMU A;  4KFE A;  3VD9 A;  2BRW A;  3EJQ A;  1F1S A;  2WVY A;  1RW9 A;  3BLC A;  1IQY A;  3VD3 A;  3K25 A;  1RWA A;  4BZG A;  1UI8 A;  1IQX A;  1JYV A;  2XSG A;  3QFY A;  3IAP A;  1QAF A;  2CQS A;  3AMO B;  4KFF A;  1OJM A;  1NS7 A;  1IVW A;  3BUQ A;  3BUI A;  3A0O A;  2CFW A;  3X3Z A;  1HWW A;  1RJO A;  3DCD A;  1W3Y A;  2F7Q A;  2D73 A;  1UG9 A;  1O7D D;  2EAB A;  1D6Z A;  1W6G A;  4OK2 A;  2JKA A;  1YGA A;  2WYI A;  3SEP A;  1D6Y A;  4RNL A;  3AFJ A;  4FNS A;  2FYV A;  4J5T A;  2CWT A;  1QAK A;  1QWN A;  3E80 A;  3DX4 A;  1N7P A;  3DEC A;  2PNC A;  1TXK A;  1OJO A;  1IVX A;  3BVU A;  2OW7 A;  1PS3 A;  2OQE C;  3VSM A;  3AMO A;  2WOF A;  2CIS A;  1SNZ A;  3ALA A;  4FNP A;  2XN1 A;  3D51 A;  4FNU A;  4DUX A;  3W7W A;  1PX3 A;  2BRV X;  1NS2 A;  4DUV A;  1AV4 A;  1NSS A;  4TTG A;  3X3Y A;  1LF9 A;  1JYX A;  1LUR A;  3BUP A;  3WA3 A;  1LXM A;  1TQU A;  1LVN A;  2F7P A;  1HM3 A;  1V7V A;  2YFO A;  1J0N A;  2E2U A;  4KTP A;  2CIQ A;  3S4B A;  1UI7 A;  3I3E A;  1JZ7 A;  3MUZ 1;  3T0A A;  1X1J A;  3WIQ A;  1QAL A;  1HMW A;  2X03 A;  1RWG A;  2JKE A;  3ECQ A;  1SO0 A;  3WVF A;  1HM2 A;  2OW6 A;  2Y74 A;  4DUW A;  2Q1F A;  2E2V A;  3OB8 A;  1MMX A;  1LOH A;  2YFN A;  3T09 A;  3D4Y A;  4MMI A;  2WW3 A;  2F1A A;  2RDY A;  1JRQ A;  5A1A A;  1MMU A;  1MMZ A;  3RSY A;  2WZS A;  1JYN A;  2CIR A;  2CFL A;  2F7R A;  1ULV A;  2WVX A;  3BVX A;  3NBB A;  2CFK A;  2XHN A;  3EJP A;  4UFC A;  1F9G A;  4FNQ A;  1F4A A;  3SX1 A;  3TY1 A;  1PX4 A;  1JOV A;  3S4A A;  1NS8 A;  1LF6 A;  1JYW A;  3T0B A;  3NJX A;  2WGQ A;  3BGA A;  3DDF A;  2D1W A;  3BVV A;  3MV1 1;  2OQE A;  2CWU A;  1WMO A;  4BZH A;  1W6C A;  4EV5 A;  3VDC A;  3WFA A;  4BZE A;  3IMH A;  1SIH A;  1NSU A;  1JZ4 A;  1TQW A;  3EJU A;  1TU5 A;  2F1B A;  3D4Z A;  2WO0 A;  3W7U A;  1SII A;  3T2P A;  1W4N A;  1LXK A;  5E1Q A;  3VD4 A;  1TQS A;  3MPH A;  3BLB A;  3PGB A;  3IAQ A;  3EJS A;  3BUB A;  3ACS A;  1KSI A;  1HN0 A;  2CFG A;  1NS4 A;  1C82 A;  3E1F 1;  1X1I A;  1NKG A;  2CG0 A;  1W5Z A;  2HTA A;  1N7Q A;  3CZS A;  1JZ8 A;  3ACT A;  2OOV A;  3WA2 X;  3VSN A;  1TQT A;  1JZ3 A;  1F4H A;  3AFL A;  3X40 A;  2WVX B;  1AVK A;  2WDA A;  1K1Y A;  1H54 A;  2ZQ0 A;  2E24 A;  1JZ2 A;  1R34 A;  1V7X A;  3DYO A;  3VD7 A;  1OJP A;  3BS6 A;  3SXX A;  2CWV A;  1Z45 A;  1I8Q A;  1JZ6 A;  1MMY A;  3D52 A;  4EV2 A;  3T2Q A;  1N9E A;  3I3D A;  3NBJ A;  5GW7 A;  2OOV C;  1RWH A;  5JMD A;  1RWC A;  1IVU A;  1JZ5 A;  3DDG A;  5JMF A;  3LOY A;  1OJN A;  1US1 A;  3E7J A;  1A2V A;  2EAE A;  3OS7 A;  3EJR A;  2WW1 A;  5KBP A;  3W7X A;  1DP0 A;  4FNT A;  3DX3 A;  2CFD A;  3X41 A;  1N7O A;  3VDB A;  1NSX A;  1WMP A;  3DX0 A;  5CA3 A;  1W2Z A;  3CZN A;  3J7H A;  2F7O A;  2XN0 A;  3D50 A;  3HII A;  4K3A A;  3LVT A;  2C11 A;  3WIR A;  1TQV A;  1DYU A;  1N7R A;  3KN4 A;  3W7T A;  3X42 A;  3VD5 A;  1J0M A;  4FNR A;  3S4D A;  3MV0 1;  2Y73 A;  3T2O A;  2BRP A;  4KFD A;  2W0Q A;  3I3B A;  2F18 A;  3CV5 A;  2JKP A;  1N7N A;  1NSV A;  1HTY A;  3HI7 A;  2HTB A;  3W7S A;  3VDA A;  2WYH A; 
#chains in the Genus database with same CATH homology
 3VSN A;  1NSR A;  2WVY A;  1RW9 A;  2E22 A;  3BLC A;  3I3E A;  3T0D A;  1JZ7 A;  3VD3 A;  3K25 A;  3MUZ 1;  1JZ3 A;  3T0A A;  1X1J A;  3MUY 1;  3Q1N A;  1F4H A;  3AFL A;  1HMW A;  1RWA A;  2X03 A;  4BZG A;  1RWG A;  1L7J A;  2WW2 A;  2JKE A;  2WVX B;  1K1W A;  2WW0 A;  2WDA A;  1K1Y A;  2ZQ0 A;  1SO0 A;  2E24 A;  3ECQ A;  1JZ2 A;  1JYV A;  2XSG A;  3WVF A;  1HM2 A;  3IAP A;  4DUW A;  3CZJ A;  3A24 A;  2FUQ A;  2Q1F A;  3OB8 A;  1MMX A;  3DYO A;  1LOH A;  3VD7 A;  1OJP A;  3T09 A;  3BS6 A;  1OJM A;  1NS7 A;  4MMI A;  1YQ2 A;  2WW3 A;  1Z45 A;  3A0O A;  1K1X A;  3DYP A;  1EGU A;  5A1A A;  1I8Q A;  3DCD A;  1W3Y A;  1MMU A;  1MMZ A;  2WZS A;  1JYN A;  2D73 A;  2CIR A;  1JZ6 A;  1MMY A;  1UG9 A;  3T2Q A;  1ULV A;  2WVX A;  3I3D A;  4OK2 A;  1NSM A;  2JKA A;  1YGA A;  2XHN A;  4BZF A;  1RWH A;  3SEP A;  5JMD A;  1F9G A;  1NSZ A;  4AQ0 A;  1RWC A;  2WCO A;  1F4A A;  3TY1 A;  1PX4 A;  1JOV A;  4FNV A;  1NS8 A;  4RNL A;  1JZ5 A;  1JYW A;  1LF6 A;  3T08 A;  5JMF A;  2WVZ A;  3MWX A;  3T0B A;  4J5T A;  2FUT A;  3NJX A;  2ZXQ A;  3BGA A;  1OJN A;  3MV1 1;  3E7J A;  4BZH A;  1HN1 A;  3E80 A;  3OS7 A;  3OBA A;  1N7P A;  2WW1 A;  3VDC A;  1DP0 A;  3WFA A;  4BZE A;  3NJV A;  3DEC A;  4OJZ A;  1TXK A;  1OJO A;  3IMH A;  1NS0 A;  1N7O A;  3VDB A;  1NSX A;  1JZ4 A;  1NSU A;  1CB8 A;  1RWF A;  3VSM A;  4OK4 A;  3J7H A;  3T2P A;  1LXK A;  2CIS A;  5E1Q A;  3VD4 A;  1SNZ A;  3NRE A;  3DYM A;  3IAQ A;  1N7R A;  4DUX A;  3VD5 A;  1J0M A;  1L7K A;  1PX3 A;  1HN0 A;  1X1H A;  2BRV X;  1NS2 A;  4DUV A;  4TTG A;  1NSS A;  3MV0 1;  1LF9 A;  3T2O A;  2BRP A;  1JYX A;  1NS4 A;  3I3B A;  1LUR A;  2JKP A;  1C82 A;  1N7N A;  1LXM A;  4MMH A;  1MN0 A;  1NSV A;  3E1F 1;  1HM3 A;  4NEI A;  1X1I A;  1HMU A;  1J0N A;  1NKG A;  3VD9 A;  2BRW A;  2HTA A;  2CIQ A;  1N7Q A;  2HTB A;  3VDA A;  1JZ8 A;  1F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...