4FNRA

Crystal structure of gh36 alpha-galactosidase agaa from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
718
structure length
718
Chain Sequence
b'KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTAAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELMYAGVALPYRSSDFISMMWRLKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 230
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnrA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnrA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnrA02
2FGZA 1ZS2A 4H2CA 1VCFA 1VJSA 3DAQA 5LSMA 2X2HA 1GYLA 3LRMA 1QX1A 3AO0A 1SSDA 1O60A 3HPXA 2NX3A 4EF9A 1OF8A 3BVWA 4XBSA 1VAHA 4PTNA 1ICSA 2ZRZA 5D2TA 1G4TA 2QMJA 5HWNA 4DQWA 2BY1A 3VGFA 3A24A 2V81A 3ABRA 2ZX8A 1QMLA 5CPMA 3B0VC 3L2MA 1FDZA 4JS3A 3LI0A 2VFFA 3WY2A 1RP8A 2PWEA 2C18A 3A5VA 2CLKA 2FPTA 2Z2UA 7CGTA 4IGHA 2EADA 1DQWA 4A22A 5I3JA 4J3VA 3DI1A 3ZFHA 2QAPA 4GIAA 3NAVA 3GAKA 5D2VA 1R33A 4UQEA 5G1TA 1TV7A 3JS3A 3JR2A 2FH8A 1FWNA 1GOXA 2R14A 1HXKA 1XUUA 1UH4A 3W2NA 3MHUA 1J0HA 1DEDA 1G5AA 3MI6A 3E0IA 3G1FA 8CGTA 5LHEA 2BY0A 4GC4A 1ZJBA 1YPIA 2B0MA 3NL2A 1XH2A 3HIJA 3L66A 1JD7A 3NQVA 1VYSX 2ZX6A 2VFEA 1AL7A 3DXIA 1QPKA 4UMAA 3RILA 1Y7VA 4FO4A 1E43A 1QHPA 1B2YA 5D32A 2A1YA 5K3VA 1ZJIA 3BMWA 2XN2A 4JEQA 4DF1A 1VLWA 3TSBA 2D3NA 4RXFA 2ZX9A 1G69A 4HNUA 3P8JA 4R33A 3DHUA 1UBSA 1U30A 2GVJA 2RKXA 4UQBA 1W5QA 6ALDA 3W7CA 3W1UA 3NOEA 1UASA 3BW3A 3IIVA 1KCKA 3G1YA 1S5WA 1MEWA 4TVUA 1JI2A 2ALWA 3WDIA 2Y7EA 1OYCA 1CDGA 1HO4A 3CM4A 5GVJA 2IQTA 3EWWA 1OABA 1I4NA 4O13A 2Q8ZA 2J9YA 1G1YA 3SSJA 2XIIA 1F74A 1MO0A 3NQAA 4NX0A 1VS1A 4K8HA 3ABQA 2FJKA 4CGTA 4HT3A 3W87A 4JX6A 4AMWA 3B0UX 1S3HA 1UOKA 5U4NA 1GJPA 4XKYB 1FCBA 3B06A 3SGUA 4PFMA 3EWZA 3W7QA 1H3GA 4AIOA 3FS2A 4AB4A 2G97A 5AHMA 3C0JA 3NM3A 3GB6A 4JTIA 2Y89A 1L6SA 4NI3A 2J24A 4U33A 1K8ZA 4I7UA 5LKYA 1MEHA 3Q58A 3G8EA 3R8RA 2FPVA 2YJQA 2Y61A 1FY6A 3BW4A 1YXCA 1VIWA 3BUQA 2VUYA 4PCTA 2YCEA 3NEVA 2YW3A 3B05A 1WE5A 1XD0A 4IMEA 2ZX5A 1GVFA 1WZAA 4JTTA 1HWWA 2QPSA 4OJYA 1JGIA 3QFEA 3QMTA 1XSKA 1J0KA 4KWWA 4M56A 1Q6OA 5DLCA 3VGBA 4XUGA 3KRUA 3PUEA 5I23A 3NR0A 1KBBA 1NOFA 1K8YA 5HUOA 2JKAA 4JFSA 4UTWA 2E6DA 3Q94A 5AYXA 1FWWA 4M5PA 3TJLA 4LU0A 2WCGA 3NQEA 3G1XA 1WBHA 3LV6A 2XFWA 2UV8G 3EEGA 1P6WA 1B9BA 1GEQA 3LCIA 1QWNA 1D9EA 1ZAIA 3N2XA 3IVUA 2PURA 3DX4A 3NM1A 1WO2A 2XWEA 2E5DA 4Y8FA 2CFFA 3TQVA 3DFSA 1V3MA 4TR9A 4IXXA 3ZQ9A 1BG9A 3K1DA 3EWXA 2CLFA 3W7GA 1ZCOA 1QHOA 4MY9A 4NJIA 1A5BA 3IVTA 3N19B 2PWDA 2E6AA 3GXIA 1QPOA 3NZRA 4UNLA 3LV5A 4XBKA 2OYMA 3D51A 5AFDA 4RJEA 4BZYA 3BLEA 1MWOA 3NQGA 5HULA 2QCMA 4WSJA 5KMYA 1MEIA 4Y9AA 3DFNA 2ZUUA 3UNDA 1A5CA 1VGAA 3HGRA 5F2GA 3AMKA 5AHNA 2F7PA 2AAAA 3LI1A 3QYQA 2YFOA 4FLOA 3SFKA 3N9SA 4J7RA 2WSQA 1E3XA 1H1YA 1KFBA 1HTIA 3VSTA 1YADA 5C5YA 4JL1A 1DOSA 4UR8A 4IWWA 3S1VA 3FKKA 3KVJA 4O4WA 1KM6A 1LBMA 2FPYA 3BK0A 2ZRXA 3QMSA 2BZNA 1JUEA 4EF8A 2VFGA 3PBWA 3WN6A 2WSYA 1EP1A 1KFJA 4MY8A 2FIQA 5G2IA 1TPDA 3MUXA 4DEFA 2YFNA 1MW0A 2E8ZA 2V0TA 3T40A 5DN1A 3FYOA 2Z1BA 2JK2A 3D4YA 4Z1CA 2BXYA 2F1AA 3HPZA 3EDFA 2YYUA 3STGA 2QUTA 4GO9A 5E0FA 1ZHAA 3NO5A 3N3MA 1KFKA 1ZJAA 1CXIA 5EMYA 3VM5A 4H8VA 2EKCA 4RZ4A 4GXMA 2F7RA 5DCDA 4M6QA 3W1RA 3HJEA 2VFDA 4UFMA 1QOPA 1YTKA 1FCUA 2OSYA 3GBEA 1YDVA 2QJHA 4U4MA 4RKAA 5HPOA 5E70A 2FHBA 2QCLA 3NQ7A 2RDWA 3UERA 1KTCA 3GKFA 3R5EA 2OYLA 3M5ZA 4O16A 3TV8A 1VFUA 1PHQA 3WY1A 1BWLA 3BVVA 3L5LA 1SO3A 1A5SA 2ZWZA 3DI0A 1LYXA 4KFOA 1WXJA 5DY3A 4NJGA 3WFAA 5IM51 1JDAA 1H7NA 3PUOA 4X22A 3R12A 1A53A 1ZAHA 3W38A 1BEUA 1TTPA 1YXYA 3G18A 1LOSA 3LPPA 4O4VA 1LWJA 3DFQA 2F1BA 3D4ZA 2CU0A 3WK3A 2VKZG 4YWIA 1CGUA 1B0IA 4ICNA 5LNSA 3DKJA 3K8MA 5LHFA 4MFEA 3GDLA 3PC0A 4Q32A 1X7FA 4UUIA 2B7NA 4ATWA 2PRMA 2OX1A 1EUAA 1XCFA 2E6FA 3HGSA 3HG3A 2OCZA 3EJSA 4UQAA 2C19A 2WOQA 5I5RA 1WPCA 1XV8A 2PWHA 3TXZA 1SQ7A 4LXFA 3BPWA 3FA5A 1FCQA 2G95A 4GRSA 3W9ZA 2DH2A 3Q2DA 4AWUA 4MJZA 1TPVA 3W2KA 2YIHA 4LOCA 3HOJA 1TIMA 1V3JA 5AC6A 5KTLA 5EA9A 1W3IA 3TK7A 3CZSA 7TAAA 5A6MA 4QQ3A 1Q6LA 3E49A 3TH6A 1TQTA 3HJZA 4IMFA 4AHOA 1KBIA 1FUYA 3USBA 3LOTA 1KM1A 1NSJA 5J5DA 3LHTA 1GTHA 3T78A 3LX9A 2DORA 1R34A 1LM1A 5HQEA 3KL0A 4QITA 5EL1A 3V1PA 1I2PA 4IQLA 1JFHA 4EWND 3TOPA 2E4TA 4GI9A 3FKRA 5C54A 3PB0A 2BY3A 4HOWA 4J9JA 4MJMA 2VEIA 5DO8A 1H7PA 2OYKA 1YYAA 3BGGA 2E1DA 3QZEA 4H4IA 5LNVA 3WK0A 3TW6A 3CWOX 4CN4A 1I45A 3G0UA 4Z1BA 4J3UA 3LHUA 5F4XA 3FFSA 3D52A 1MZHA 4PEEA 3RIKA 4OV9A 2EPHA 3BAXA 2C3ZA 2WJZA 1PPIA 2AQWA 2HS6A 3ZT5A 3NQ8A 4UQCA 1H50A 1D3HA 5LGXA 4TMCA 3CU2A 3NPWA 2EAEA 2A7PA 2I9EA 4WJEA 2XVKA 4QNWA 1EPXA 4FNTA 2EAWA 4GI8A 4DPQA 5MHBA 2FQIA 1QAPA 3C56A 1VLIA 2FFCA 3P62A 1IXOA 1QWGA 4HA1A 1H7RA 2GJNA 1GJUA 3GK0A 3UG5A 3L0NA 4O1CA 3CZNA 2C6QA 3NA8A 1B57A 1J2WA 1DJQA 1TQXA 3DC0A 4UQDA 4JY9A 1WDWA 2TSYA 3TU9A 1H61A 3IEBA 1TQVA 2YR1A 3AMLA 1F6PA 4JFTA 4AEFA 1PS9A 1EO7A 1MW3A 5AHFA 3T44A 3W74A 4DO4A 4O17A 4JX4A 4NVTA 4XTDA 4DO5A 1QPQA 3EDKA 3C8FA 4CNOA 3CV5A 1PCKA 2JKPA 1H62A 3EX2A 1LOQA 2C16A 2G3MA 2A4AA 1H7XA 3PWAA 3PULA 4DBDA 1UH2A 1SSGA 2P1FA 2WSRA 4NX5A 4ZZ9A 3VX1A 4YXGA 1NAL1 2H3BA 1T0OA 3DKLA 4K37A 4HN4A 4QISA 1MFUA 3BCFA 1B4EA 1ZFJA 4LUJA 1P4CA 4JL2A 3LLDA 2Z1KA 3E96A 4NNAA 1KFCA 2GUUA 1KFLA 3CLMA 1G67A 1IGSA 3G1SA 1A47A 3BCDA 4OU1A 2VRKA 3BVJA 4N2YA 1WZMA 1VQTA 3CWNA 4ONVA 5IBXC 5CZ0A 4GE8A 1Q3NA 1ODUA 2ZUVA 2QF7A 3L2LA 1K7FA 3BARA 3L4XA 1X1OA 1XKYA 3LBCA 4LVGA 5J5RA 4A2SA 1WA3A 6TAAA 2D3LA 1M7OA 2E6YA 1L2UA 3C2VA 3LGEA 1MW1A 3A22A 3GDKA 3RLVA 1OSEA 3H55A 2WKGA 3P61A 3BSGA 3IVSA 2IGTA 3VNDA 1KM0A 4HPXA 1KCLA 3PY2A 3VFLA 3UXAA 3BLPX 1JRBA 3PM6A 3VE9A 3MO7A 1XL9A 2YYTA 3KX6A 1CGYA 4IPIA 4S1FA 5F4WA 1R75A 1LOLA 3EJTA 1KGWA 1KBKA 2WPBA 2GJPA 1UD5A 2E68A 3DHPA 4BR1A 3NPXA 2QCHA 4Z0SA 3YPIA 1NVMA 1QDSA 2WC7A 4O50A 4DF2A 3MI3A 3CC1A 1Y0EA 1Q4NX 2QJGA 5HINA 4U28A 5AOUA 4PCFA 1F73A 1OT2A 1SZNA 3BAJA 3TJXA 3CQ0A 1DKWA 3CB8A 3LCXA 3W2UA 5LGZA 2CLHA 3TFCA 5HNRA 2A6NA 3UPBA 4E2DA 2FH6A 2QV4A 4TU1A 2Z0IA 2ZZ3A 4GFSA 3LTPA 5BRPA 3U2OA 1OX4A 1KTNA 2V3DA 2CLLA 4G1KA 4UR7A 1TYGA 4YMZA 3LRKA 3N14A 4M7SA 3ZT6A 2C1HA 3E12A 4IOTA 3C2OA 2J9XA 3VI2A 1TO3A 2A7NA 3ZSTA 3LTSA 4BI6A 4A3UA 4HNTA 1QR7A 2BHYA 3A9IA 2DZPA 4O54A 2OSXA 3S9YA 2DU2A 1MW2A 1XCWA 1Z41A 1P5BA 1HFBA 4AYGA 1JI1A 4GUFA 2AMGA 3LCFA 3TROA 4ZQOA 4MZ8A 4UFKA 1OG0A 1KWGA 3ELFA 5KSWA 1LTDA 4UXDA 3EDDA 3FW6A 4CCDA 3QM3A 3L4YA 4E2BA 2Q8LA 3BUIA 1DV7A 1GZGA 3M6YA 2NUYA 3DH7A 2ZRYA 4KFPA 4JY8A 1TPUA 4RR4A 5I3GA 1OF6A 4H7VA 3NQMA 4Z0JA 2WKJA 2DZTA 2F7QA 4CQ9A 1P0KA 2D73A 1QOQA 3PB2A 3QGVA 4KKXA 3AJXA 2VENA 4PODA 2O7QA 3UCQA 5CZTA 3TTYA 4CNNA 4MLRA 1OHLA 1NF0A 2I1OA 1KTBA 1OX4B 5FESA 3MP3A 5AYZA 5T26A 2E9BA 5TQLA 1RQBA 2FYVA 2ZX7A 1CGVA 2ZTJA 4MPQA 4MFDA 3CPRA 3UZ5A 3W2LA 1JQXA 2PWFA 1E51A 4UFHA 5BMWA 4XKYA 5D09A 1UD2A 2CLIA 5BOOA 2OZ0A 2P0OA 3GR7A 4U3CA 4N4PA 3W1MA 3MYOA 3W7IA 1UKTA 1N7KA 4O11A 2OW7A 2Q3OA 4BI7A 1PS3A 4UNIA 1SO4A 2HSAA 3SZ8A 3GLCA 5CGMA 2YGYA 2V2DA 3GZ3A 3W1XA 2NWSA 3HPSA 3ZR5A 3M0ZA 2H90A 1JULA 1C9DA 4AWTA 4FNPA 3ABOA 3UWWA 1KB3A 3L4ZA 3K30A 4JTEA 1JCMP 2C7FA 3MWAA 2CLOA 1UUMA 4CCCA 4UQ9A 1HO1A 1HL9A 2W79A 1SW0A 2ISSA 1JG9A 1JVNA 4GQRA 3TFXA 3IRDA 4ZMGA 2QCNA 1EEPA 3KWXA 1N55A 2A7RA 3O1NA 3BUPA 3LHZA 1OK4A 4MVAA 4Y96A 2B4GA 3NGJA 2Y7GA 3DU0A 3W1PA 3L5AA 2GJRA 3W1AA 3VCRA 1VPXA 2ZRVA 1SMDA 3QW4B 2Y24A 1UD8A 5K9DA 4MYAA 4CQAA 3OLIA 5D37A 4UTIA 5CLWA 2PRHA 4GUIA 4Q33A 5AHEA 1F76A 4J3SA 4ZQRA 3ZR4A 2GQ9A 1W9XA 3SECA 4UCGA 1VZWA 3A4AA 4I7WA 2CZEA 3W76A 4AHQA 2DH3A 1KLYA 3W7NA 2DJXA 5SWUA 4DF0A 2OT0A 2C8NA 4Q4KA 1BF2A 4O0KA 4DBEA 4WF7A 1JCLA 1OK6A 5F2MA 4JFVA 1W3NA 3VE7A 2VT0A 1QW8A 2QCDB 1R2RA 1XSIA 3IIXA 1NEYA 1RQEA 2BX7A 3NG3A 3PG8A 3I7RA 1W5MA 4E0CA 1NM9A 3BAWA 1C8VA 4JTKA 4UMBA 4MZYA 3BLFA 1DJNA 5DFAA 4UIOA 5EY5A 1SPQA 1TPH1 2Z6JA 1CXKA 1L6YA 4MB1A 3C61A 3W84A 1SR9A 3VGEA 5DXYA 3W7LA 1GTEA 3UQNA 1OFAA 2GJLA 1GJWA 2QAFA 4J3WA 2CZFA 5HXMA 4UMCA 3QRHA 3U8GA 4UOQA 4N6FA 3WJZA 1ZNNA 3KL5A 3WEOA 4WX2A 1TPFA 1WQ5A 2VRQA 2VFIA 3DBPA 1OT1A 1KW1A 3OLGA 9CGTA 3M5XA 4HIBA 1VH7A 4JYDA 2TPSA 5E0KA 3RF9A 1TQWA 3EJUA 4N9DA 2Y63A 3TMQA 2JGYA 4UTUA 3I6RA 3GAYA 2AAMA 2X16A 4JTLA 3PSVA 5E1QA 2ZDRA 1M7XA 3KAOA 3G1AA 4HOZA 1EHAA 1RR2A 2NV2A 3W1LA 3LLFA 1UUOA 3ZS4A 4FX6M 3CT7A 1JAEA 4EIVA 4UTHA 3OHIA 3WENA 3M44A 2ZUTA 2A5HA 3H54A 3MHFA 3QF0A 4O8RA 1SFJA 4JIPA 4PEKA 2YW4A 3UEQA 3QC3A 1T8XA 1ZALA 3VGDA 2YPIA 3M41A 5DELA 1GT8A 3PUDA 3BLIA 1JRCA 1VJIA 1OYAA 4JR5A 5C55A 3OVPA 3L4WA 1TV8A 1VC4A 3W2MA 1TJRA 4AWSA 4K38A 4M8UA 4FX7A 4C1KA 1XGZA 5DXXA 3W73A 1D7FA 4PH6A 1RD5A 2ISVA 3HMJG 3W7PA 5HR7A 1BSIA 4Y90A 4X2RA 5CZJA 3GXNA 1EH9A 3LXCA 2ZQ0A 4AEOA 4LNYA 4DPPA 1TREA 3C52A 3FLUA 2HMCA 1AVAA 1FXQA 2V3EA 4NNCA 4HP5A 3S6DA 1JUBA 5LNRA 3IJ7A 1J4EA 1SUXA 1W5NA 5CG7A 5AC8A 4JXCA 3GVGA 1FBAA 3SR7A 2D0GA 1CXHA 1GVSA 1LDCA 1H7WA 1QI3A 4WY0B 1EA9C 2C15A 3WK1A 1VFOA 1AQMA 3EWUA 5ABTA 1G6CA 1OX6A 5CSSA 1UD3A 5G1YA 2XIBA 4XWUA 3UXDA 1CGTA 5A2AA 3P80A 3TIMA 4A2RA 2FHCA 3KVLA 5CPLA 2GOUA 1FXPA 1M7PA 1TMHA 2PE4A 5H2ZA 4L4MA 2A6LA 3P8IA 3LXBA 1EUNA 4N02A 3WEMA 5I0DA 1JIBA 3WY3A 4E38A 2V5BA 4K39A 4QNEA 3W7RA 3CTTA 1XI3A 3EJRA 4EVZA 2EO7A 1K8XA 3DX3A 3IJ8A 2W0UA 1TPEA 5D2YA 3ABSA 4PSPA 3S5YA 4E2OA 5G4WA 2CPUA 2WNZA 3R89A 3S1XA 3SW6A 4LVBA 1IF2A 3DHDA 5DCEA 2GVGA 1UKSA 2G5WA 5CGTA 3TAKA 1K3UA 3P60A 3LCHA 2VEMA 5E9AA 2B7OA 4O0ZA 3B03A 5A2CA 4QM1A 3WELA 5IBXA 2XN0A 4RZ5A 4M6PA 3P81A 1KXTA 3D50A 2NT0A 3RLUA 1UD6A 1YDOA 1U2YA 4O1BA 2A85A 3W7KA 5AHLA 3A47A 1RPKA 4Z1DA 1V7YA 3BW2A 3L0GA 3STFA 3LCWA 4XQ6A 2BLEA 1HNYA 4FNRA 3DFOA 3S1UA 3TONA 1ICPA 2C13A 3DENA 3INPA 4CN1A 4L4LA 1E40A 3OEXA 5F2LA 5AYYA 3F03K 2DZSA 5A2BA 1C29A 3KFTA 3RU6A 2RDUA 3ZOAA 1PL9A 4JYEA 1IV8A 3I68A 3TR2A 1TSIA 3TSDA 3W71A 3NPVA 4PL2A 1A5AA 3SGZA 1QPRA 2ZCGA 3M7WA 2WKLA 3STEA 2QDGA 1AK5A 1KV5A 1NFBA 3EWYA 4TO8A 4JICA 4AMAA 3BLKA 2WNWA 1PEZA 2WPGA 3BAYA 1NF7A 2ABBA 4AEEA 3QQ1A 2QEZA 1G9HA 3VX0A 4J3TA 4MZ1A 3W6YA 4CQ8A 4R34A 2BTMA 3ZWTA 5G4EA 3LM7A 5BRBA 1VR6A 1VHNA 1LRNA 1D3CA 1PV8A 3I65A 4UTJA 4ORMA 1K02A 4OKDA 3DX2A 4MAZA 3QJAA 3WJSA 5I3FA 3P5ZA 1F05A 4GNJA 2KZHA 1Z48A 4ADTA 4HOXA 4POCA 1GVIA 3O6YX 1ONRA 2PCQA 4ZQPA 4BI5A 4QAIA 5BW6A 4AIEA 2CLMA 2R94A 4JTGA 4YCOA 5E93A 2GPTA 3KRZA 1C8QA 3P84A 4HNVA 2E09A 1TRDA 1TPB1 3QEZA 2OSWA 3BMVA 4H3DA 1W5PA 4M6VA 2Y62A 3EX6A 3QSRA 2DIEA 3DZ1A 4FHAA 4AVFA 1EA0A 2CZ5A 5K4ZA 2Y6ZA 4AW7A 3E9AA 3IIOA 4UTTA 4RK8A 4UFLA 1FWRA 3VMPA 1CXLA 4FIQA 2WSPA 4B9ZA 3QMRA 4RZ6A 1MSSA 1G94A 3HB9A 3BVTA 1HT6A 1PJ9A 3WNNA 4GUHA 4S2CA 5KZEA 3THQA 4UTWC 4HPHA 1P0NA 4H8HA 2YOCA 1DHPA 3SI9A 4CVWA 2BWGA 4WY0F 1JCXA 4WXYA 1QWUA 1ME9A 2YA0A 1KGXA 1WZKA 3IIZA 1TTIA 1EWEA 3WFZA 1GVOA 2ZFAA 2QKFA 4LVAA 2EACA 1BVZA 1DL3A 2VEKA 2F61A 1RPXA 2V8ZA 3C3NA 4OQVA 3BSHA 2B7QA 2J6XA 5HJLA 3TCEA 1WBJA 2A21A 1VRDA 4DELA 3W22A 3E02A 3FJ6A 5CPOA 5D2WA 2PRLA 4N9BA 3TE9A 1B4KA 3GBDA 3LRLA 4MIMA 3CPUA 3HF3A 1S5TA 2E5BA 1WP6A 1YPFA 2DIJA 5TBOA 3W1QA 1I75A 1H5YA 3GDRA 3L4UA 4XZ9A 3BC9A 3LCLA 3W2JA 3STCA 1Q45A 3THAA 3W70A 3Q37A 3GR8A 2ZZ5A 1KWKA 1BAGA 3S8HA 1N8FA 3AXHA 4S2BA 3WNMA 4OT7A 1QO2A 2Z6IA 3BGJA 5DCBA 1W5OA 5F7UA 3ATYA 1QCWA 4IUOA 2RHGA 1Q6QA 5D30A 1WOAA 2J27A 4K7VA 4NT0A 1SMAA 4K7YA 4FLQA 3O6DA 1QO5A 2J88A 3GDTA 5E6YA 3VGHA 3BG3A 4GWEA 3TC6A 1IXNA 1CX9A 3TW7A 3HZ3A 3W7MA 5L9FA 3O6CA 3O16A 3FYPA 2Y4SA 4YCPA 4O10A 1LZOA 1BTMA 2Y7DA 4LRSA 1BLIA 3W72A 3VNYA 1S5VA 2ABAA 1XH1A 4IX2A 1JQVA 4IMDA 3M16A 4LUIA 4M7TA 2H6RA 5FF7A 3P74A 3M9YA 2VFHA 1QI4A 2QCEA 4JN6A 1K7EA 3DFPA 1XUZA 4QAWA 4IJBA 3LCGA 1VYRA 2RFGA 1R47A 1OB0A 3TTSA 4HSNA 4BFAA 4OV4A 3M07A 1XM3A 1TPWA 1RQHA 2WSKA 2ALDA 2ZWYA 3DGRA 2JGQA 4B5NA 4LWWA 5G2WA 3IV3A 1UH3A 2FDSA 3BVUA 2WANA 3VKJA 3K8LA 3VMOA 3D0CA 3PVFA 1XCXA 4Y6GA 4WXZA 4UFJA 1EP3A 1OFOA 1R2SA 2BHZA 1X6UA 1IXPA 2ZUWA 4XTIA 2GVYA 4PSRA 2XN1A 4GUGA 4FNUA 1CGWA 1XC4A 3TAOA 1GYNA 8TIMA 1JCNA 1WZLA 1MXDA 5E6ZA 4KMQA 1HL2A 2YA2A 3GYEA 4WOZA 5TD4A 4UZUA 4A21A 3OIXA 1KLZA 2Y88A 4BWLC 1W56A 2FB3A 5EPDA 2NT1A 4MUZA 3P82A 3M5VA 2QMKA 3IGSA 3CLWA 2QDHA 1HUVA 4X9SA 3O63A 3BH4A 1MXSA 5DBUA 3NL5A 5HWJA 2YSWA 1TQJA 4NXSA 1LCOA 4O57A 3M5YA 3KL3A 3C6CA 3MP4A 3ECQA 4EOUA 3M1ZA 2OW6A 1H7OA 2OJPA 3G3MA 3W3OA 5CGQA 1ME7A 1CXEA 3HG5A 2HS8A 1JDDA 5KZMA 3W7HA 5HUPA 3BG5A 3RK8A 4H6KA 3SY5A 4CLMA 1Z42A 1SW3A 3PS7A 1VFMA 2VXNA 3LHWA 4UNKA 4NZFA 4O52A 3C4UA 3UWVA 3CGTA 2EEXA 1UJPA 1X8FA 4O14A 4K6AA 4KWVA 3G8RA 1DTUA 1UD4A 4JCMA 3ANYA 3BVXA 2WVVB 3T7VA 5FF0A 2GUYA 3UY7A 1M6JA 4FNQA 1YTDA 1U5JA 2WNQA 4RCXA 5G2HA 4CCEA 3UPWA 5I3HA 4UTKA 1HVXA 3G24A 1EB3A 2V9DA 2E5CA 2NX1A 4JIQA 1PE1A 1SZFA 3LERA 1ZY9A 3N73A 5CZSA 1WX0A 2X2IA 1F2JA 4R7JA 3G22A 1AW2A 3GX9A 1JF5A 4BA0A 1D3GA 4JTSA 4ML9A 4N6EA 4NZJA 1FX6A 2E77A 3KE0A 1XBYA 3VSVA 3O06A 1H1ZA 4JX5A 4OWGA 4WQ6A 4WZHA 3WNLA 1WAUA 2OT1A 2QPUA 1UA3A 1MFVA 4X9YA 1KFEA 2QCDA 5DY2A 1S46A 3TMLA 3WDHA 3P5YA 4XB3A 2ATMA 1PIFA 3U6WA 3BUBA 4LS2A 2DJLA 1T96A 3UWUA 2DZWA 2DZXA 3LHYA 4ZQCA 3S5ZA 2X1UA 1V3KA 2C0AA 3B4UA 1W8SA 4JTUA 2NLIA 5LZLA 1UB3A 2NX9A 3EXSA 3UG4A 1VHCA 1WV2A 2CW6A 4AMXA 4PA8A 5F1UA 3RFAA 3UG3A 3HBLA 3UY8A 4FEZA 3N34A 3C2EA 3G0XA 1CLVA 3S2CA 2A2IA 5K7JA 1SFLA 3A6OA 4U2YA 2QJIA 3MBDA 3MP5A 3O05A 3FJLA 2ZUSA 1F6KA 4DO6A 3IIPA 3TX9A 1TV5A 2EHHA 3IGXA 3EDJA 4AF0B 2CHNA 4P2VA 1LORA 4JNMA 5CLTA 5HR6A 1Z44A 3CZGA 5K9XA 4GBUA 3GNDA 2E8YA 4AH7A 4W9TA 1YTEA 1K03A 3TQ0A 3GXFA 2WVSA 1KBJA 2O7SA 3SIZA 2AGKA 3LDVA 4FIRA 3TUUA 1JDCA 4NQ1A 2ZZ1A 1GVRA 1O7DC 4GI6A 3WNKA 3ZR6A 4U31A 3OVRA 3W85A 1O4UA 2XWDA 3WK2A 2BHUA 5LNWA 2V3FA 5FEPA 2WV8A 2Y7FA 2WVTA 4QSHA 1W31A 2X30A 2H8ZA 1QNVA 3EX1A 3I7SA 1F7BA 3MW7A 5F4SA 1G4SA 1LP6A 2TAAA 2EJ1A 4ALDA 1I2RA 1G7VA 4JD4A 4D2JA 2V82A 3BAIA 1TB3A 1YDNA 3I7QA 2JBMA 2ZTKA 3W7OA 5A5WA 2Y5EA 2D0FA 1BPLB 2BXZA 4GINA 3A21A 3EDEA 2NV1A 2X2GA 1KM5A 5BRQA 3QQ0A 1Z32X 2EGZA 3W86A 3F1QA 3WJXA 2NXHA 4UTMA 5CXPA 2PWGA 1ALDA 2VEPA 4ORIA 2W6RA 5KEZA 1OJXA 4X0NA 1YLVA 4OBTA 1FDYA 4JFUA 4WY0A 2VC6A 2TYSA 4HKPA 3C2FA 4IPJA 3HQ1A 5D02A 2Q3RA 3P7YA 4MY1A 2NUWA 2F18A 3II1A 1TPC1 1HTYA 3S42A 5TIMA 2V5LA 1BVNP 4NU7A 5D03A 1AMYA 4O53A 4LTSA 3HO8A 3CZKA 2FHFA 5D2XA 2GVLA 3LTYA 1OFPA 2FB2A 1TCMA 1BKSA 3TKFA 1L0PA 2Y70A 1AQHA 3W07A 2ZZ2A 4RXGA 3H53A 4UZSA 5H91A 2A0NA 1WOBA 4OE7A 1AW1A 4TX9A 1EWDA 3N2MA 2ZA1A 3EX4A 3TC7A 1O94A 4I7VA 3LPOA 1VB9A 2CWNA 3GIYA 3BAKA 1PAMA 4IMCA 4KWUA 3NQDA 5AHIA 4B9YA 5F2IA 1O5XA 3N9RA 3NZ1A 4OHQA 3WDJA 1DVJA 1OFRA 1LROA 2CLEA 1GWJA 2H8XA 2VOMA 2D0HA 2G96A 1I8JA 3R13A 4GKLA 3PAJA 3BO9A 1XSJA 1XBVA 3CZEA 5U7SA 3EB2A 4O1AA 4ZQMA 2ZXDA 2J25A 3V75A 5HWMA 2XVGA 1JCYA 2ATSA 3RMJA 2ZE0A 4C1LA 1CXFA 3NQ6A 4N4QA 1QW9A 3LXAA 3UWYA 5EMUA 4OGZA 3KLKA 1HG3A 2ZXQA 4HSOA 4FF7A 5K9CA 1GCYA 4N9CA 1RV8A 2YDAA 5CPNA 5I3KA 4W93A 3ZSSA 1YXDA 1JJKA 1U83A 2RDTA 3OVQA 3DX1A 3QPYA 3PR2A 3K8KA 3BUDA 4WLCA 3MJYA 1X1ZA 2QCCA 1HX0A 2NXGA 3G3DA 3EWBX 3NXFA 3AXIA 2F84A 3WJWA 2EQDA 4PCSA 3NPUA 4ADUA 2ZRUA 1MVYA 1OYBA 2ZXAA 1SU5A 2ZRWA 4K36A 3PBYA 3DFTA 3UWZA 4Z08A 1G4EA 3P67A 3DHFA 4O28A 4O12A 5AC7A 1JR1A 1CYGA 4I9AA 3PBVA 1LLZA 1FWTA 4CKQA 1SO6A 1XDMA 1LRTA 4JFWA 3LB0A 4LT9A 3GKAA 3W23A 1BWKA 5KINA 3EJQA 5FEWA 3ATZA 1AW5A 1FDJA 1QPNA 1TTQA 3PF3A 3WY4A 4X3ZA 4RLIA 4WOQA 3TA6A 1EX5A 5EKYA 1K7XA 2V2CA 1O5KA 4UCFA 4JTJA 4UOZA 1J5TA 2DZUA 3L67A 1M53A 3L4TA 1FCVA 1TCDA 2P10A 3L65A 3W37A 1LBFA 1JXKA 3CEUA 2WVUA 3PG9A 4PC8A 4BK9A 2YX0A 1UCWA 4FXRA 4HNNA 3G1DA 2WNNA 3QSTA 1KGUA 3NVTA 1V5XA 4JGDA 1SZEA 3W7EA 4ZVJA 3WNOA 5CKSA 4ADSA 3VU2A 1W0MA 3EKZA 4O1DA 3NQ2A 2ZA3A 1W1ZA 4GUJA 2GQAA 3W1TA 3MYPA 1VCVA 2CXGA 4K8EA 3UWQA 3TDFA 3O07A 2EABA 1OGSA 3EXTA 4ZQNA 3GXTA 4GO8A 3WNPA 2YA1A 1H51A 1LLWA 4TIMA 4FMVA 1TTJA 2RH9A 1B3OA 3O15A 2WQPA 2C14A 4LS1A 1UA7A 4FNSA 3QPZA 1P1XA 3TXVA 3HG2A 4BWLA 5I24A 3GTNA 4Z1AA 1AL8A 2NWRA 2GQ8A 3W7JA 3B0PA 3G1HA 3UD6A 5BMXA 5C2XA 3CIWA 1AMKA 1EP2A 1JXJA 4NJKA 1MXGA 4HHPA 1U33A 3EX3A 4O15A 7TIMA 1XFBA 1KM2A 4JCLA 1AG1O 5I3IA 1OVDA 5FEZA 1THFD 4ZL1A 1XDLA 2ZZ7A 3OA3A 3WMSA 1XD1A 1LRQA 2ZZ4A 3S1WA 2BXVA 3NL3A 3GXDA 2BSLA 3NQFA 5D04C 1I2QA 1IIGA 3FAWA 1XBXA 2TRSA 4P61A 2R8WA 2V30A 3F4NA 2BY2A 2HTMA 1G7UA 3KVMA 2X1SA 3NQCA 2VELA 2X1RA 1KXQA 1KA9F 3IGUA 1E3ZA 2X1TA 1FQ0A 1TQUA 5D38A 4J28A 3MBFA 3VSUA 1KM3A 4AXKA 2YZRA 3KVKA 5KITA 1OFDA 4LW7A 4LV9A 4QIUA 4MYXA 3NDOA 1XBZA 3PSWA 4IX0A 1IXQA 1ML1A 4YLWA 5EYWA 3W88A 1IZKA 2PC4A 3FIGA 2WO5A 1GQNA 5D05A 2R91A 5FF2A 3M43A 3WJYA 4OIFA 1TMQA 1XH0A 1FWSA 1TRIA 1WYIA 4CN6A 3GNNA 3BG9A 2Y2WA 2JKEA 2ZICA 4LS0A 4JTFA 1L9WA 3W1NA 1DHKA 3O8AA 4MLJA 2VNCA 4AYSA 1OFBA 4LVFA 4LC8A 5D33A 5CSRA 2F2HA 5AN7A 4WUIA 5HMSA 3ZT7A 3AJ7A 3EXRA 4FX8A 3RNDA 1I2OA 1W3TA 1JCJA 1CIUA 3S5OA 4DXVA 5F1VA 5A6LA 1PIIA 3NNTA 4QJ1A 3TSMA 3KRSA 2ISWA 1H63A 5C6MA 3CZLA 4LQ1A 4NXKA 3W83A 3EJPA 4LY8A 4R53A 4UC5A 4UTLA 1W54A 4AAJA 2E0PA 3FEMA 5FF3A 4LV4A 1OFQA 1JL8A 3VGGA 3DDFA 3L2IA 2DZVA 1ZENA 1ICQA 1W37A 5K4XA 3KLLA 3MMTA 3SJ3A 1CW2A 3L5MA 2ZA2A 3L68A 1LWHA 3G1VA 2NSXA 3FOKA 1J0IA 3T55A 5K2ZA 1XXXA 3A5FA 1HL8A 3VNZA 3CEPA 4IXHA 3EKLA 2FE0A 3L21A 1EIXA 2ZYFA 3NL6A 1GG0A 1R30A 1KXVA 4IMGA 2V2HA 1PZ2A 2D2OA 1ZAJA 4M19A 1TQSA 3OLDA 3OBKA 3BLBA 2X2JA 5AB3A 5LNUA 1ADOA 2CZDA 4BF9A 2ZZ6A 5FF4A 1RP9A 1T99A 4FLSA 3VO0A 1KV8A 3QW3A 1PZ3A 3UYCA 3W7DA 3CHVA 1KXHA 1EO5A 2WVVA 4JDBA 1PCWA 5KZDA 4LC6A 4LVDA 1OX5A 3LBMA 4J3XA 4NJHA 3R2GA 3F4WA 4A29A 3S0CA 3KXQA 4GQQA 1GPWA 5G5IA 2FTPA 5BNKA 2ZXBA 2QUVA 2QUUA 4AHPA 5A8GA 3S5NA 2LLEA 3CTLA 4N9EA 1M5WA 4JTHA 2F7FA 1JUKA 1ME8A 4FLRA 1IZJA 1PVNA 3L9CA 3L0KA 3B04A 1PIGA 3C2RA 1Q6RA 2OMAA 1SW7A 3FAXA 2QCGA 3KHJA 3M47A 2J9ZA 4U2ZA 3MI2A 2QCFA 1G4PA 2QLYA 1DBTA 5L6UA 1KM4A 1PHWA 4O18A 4RX0A 4NNBA 1O95A 1DORA 2Y85A 1QFEA 3TNOA 2NXIA 3VM7A 3OLEA 4MOZA 4WSKA 3CIXA 4J27A 5DBTA 1VCGA 1H60A 3UZJA 3BV4A 1CPUA 3T4CA 3HGJA 3QH2A 3KEHA 1JF6A 1UKQA 3KOFA 3G0SA 1V3LA 4MKNA 4UFIA 2QR6A 1CI1A 3DDGA 2NZLA 4JDYA 1SZGA 1JD9A 4PL1A 2WCSA 4JYFA 1QI5A 2DP3A 3LHVA 1GVQA 2B7PA 3ZWSA 2VR5A 3JRKA 6CGTA 1TJPA 1L6WA 4LRTA 4O19A 1GG1A 1RVGA 4AF0A 2G3NA 2YKKA 2I14A 4YL2A 4UTTC 1R2TA 3NYZA 3L4VA 3HG4A 2ZIDA 4KFNA 3MHGA 4FXSA 3OG3A 4GJ1A 4RV8A 3DX0A 4TMBA 4CNPA 1RZMA 1CGXA 2F7OA 4FB7A 1IIHA 4LPCA 2NUXA 4H8UA 3TQKA 4NJJA 2ZBTA 1DQXA 3A23A 3HGOA 1VYPX 2YXGA 5FI8A 5HDRA 5FEXA 1SO5A 3GXPA 2XVLA 3VMNA 3B8DA 3IJ9A 3W75A 3GXMA 1R46A 2H3DA 3GDMA 1LBLA 3IK2A 1OFEA 1I2NA 3PBUA 2EF9A 4WD0A 1J0JA 1A50A 2TMDA 3ZO9A 2FLIA 4NUWA 6TIMA 4HPJA 1F5ZA 5EBUA
chains in the Genus database with same CATH superfamily
3GG7A 2WP3T 3MCMA 5FDWB 1RFDL 2IDFA 4LRIA 3KLQA 4W7WA 2G4JA 1IGCH 5I71C 1GOKA 1E9YB 1A5FL 2QMJA 4K3HA 4M62H 4JZOB 4CNTA 3DTXB 3SCNA 1CLCA 2YCIX 1PZ5B 3U7YL 5IKCB 1DCLA 5J57B 2ZOOA 1DEDA 5BNXD 3JWDH 1A6AB 3QDJB 3MHZA 1BD0A 4ZBJA 1RZIB 5LBSL 3H2EA 4GAJH 4L9YA 3LB6D 4DLMA 3EYSL 4M4PA 3TLRA 4G80A 1TJIH 4GI4A 2ZUXA 2IADA 4JEQA 4GRWE 1T4WA 6ALDA 3OODA 4CMMA 5BXPA 4XCEB 2AABH 3F2LA 5D1QD 1P4IL 4KW2A 2CLRA 5D7EA 2FJKA 4DO7A 3W87A 3MWCA 1MAJA 4J40A 1F1AA 3SGUA 4Z2GA 3QDGA 5DLLA 5L2JA 4ZNEE 5E08L 4IICA 2J24A 2UZIL 2YCEA 1XD0A 4XBJA 4BQ4A 1J0KA 3FB7A 2NCMA 3FKUS 4HU4A 5JIDA 4K3GA 1PVHA 1MIEL 3K6NA 3HUJB 4BUHA 4AMKH 4YBLB 4PBGA 2XIOA 1P6WA 1B9BA 2X44D 2J4WH 2PURA 2XM1A 2VTFA 3ZQ9A 3TCTA 4PYGA 4KRPB 1QBMH 2CJSA 4Q97A 2G75A 5L2KD 4CD6A 1ISWA 2VQTA 4PJHE 4I8YA 1XISA 3QYMA 5K9JL 2E59A 3BLEA 3UBPC 5HULA 4FLHA 3BPOC 1UM5L 2YUXA 2F8VA 4TVPL 4M81A 1QTWA 1SJMA 3SFKA 3UABA 1UI7A 5GZOA 2P44B 5SWSE 1K6WA 5C9JA 3WFDH 2X6UA 3HMXH 3OZPA 3KVJA 2ZONA 4JPQA 3U48A 4X2PA 1YC7A 3K2KA 2Y74A 3NOIA 1MW0A 4UIMB 1R4XA 4ESKA 4PTVA 4F37K 1R17A 4EVNA 5I7GA 5KSVB 1OEZW 2OMUA 4DHLA 2PDQA 2HJFB 4P5TC 4FMKA 2QJHA 5I8EB 4Z7WF 4NZRL 3UERA 1MWAB 1VFUA 3V5DB 3S5LB 4KFOA 3VDCA 3PDOA 4NJGA 3WLHA 1HEZA 2OWCA 1Z5HA 1CFTA 4FXGC 1YXYA 4U1NA 4Q74A 2AXGB 1E4XI 3LXUX 3RWJA 4L56A 3WBWA 5FM5O 4JFPA 3MR9A 3ILQC 3RO8A 3FA5A 2DH2A 3Q2DA 1M1XA 4RZCB 1NIUA 3H22A 3LKSA 2O6FA 3SURA 1TIMA 4YHEA 5CMAB 3CZSA 3C5ZD 2EDKA 5ABHA 3A3WA 1JHTA 1JEZA 4F8XA 2PP1A 4F8NA 4XVUD 3G7TA 3WEAA 4P46D 2DORA 2R27A 3KL0A 3FKRA 2BY3A 3N44B 2WMFA 2MQGA 1L5GB 3OAYH 4JPVH 3BAXA 1UWTA 2WJZA 2AQWA 35C8L 4S0TD 4BHYA 4FADA 3FO1B 3OKNB 2DLFL 3E7JA 1KRCC 4OZHA 4WRHA 2DKUA 2V0AA 2FQIA 2A83A 4JGMA 5ES4B 4PJCA 2OV0A 4DWHA 1H7RA 2P49B 5F7DA 4PY7A 3L0NA 4O1CA 4ZYKB 3NA8A 2VDPB 2IXQA 4KK5D 1H61A 4ZPVA 4ILDA 1CYXA 4WI2A 1TV4A 1NEZB 1V7MH 2LAGB 1XF5A 4KKAD 4HGXA 4MQXD 1TEGA 1MREH 4LEFA 1FOBA 1B0RB 1EBPA 1MJUH 5GRJL 3C8KA 3DERA 4L1HA 4K5LA 2Z92A 5IBXC 4GE8A 1ZLWK 1L7IH 2ZUVA 4QHNB 5DO2D 2O0TA 4OZ4A 4NY2A 2R9HD 3P61A 2O55A 2YD7A 4DJFA 4YS1A 5K9KB 1UURA 4EN3D 2YYTA 1KPVA 4C56D 4J3ZA 4M1BA 3YPIA 2HTKC 3U9WA 1F73A 4PP2B 4L4TE 3TJXA 2L04A 2CIPA 5JMOC 2C7UB 4FKKA 2ZZ3A 2PMZA 3R1ZA 2X4RB 4LSRH 1Z9PA 2CLLA 4IP5A 1IM3A 4EPKA 1E4XL 1WAWA 4I13B 2VDOL 3PTDA 3FT4B 2PAJA 3NPSC 3OU8A 4YHMH 3SYQA 1TVNA 1TPXB 1X4ZA 4Y7MA 1FWFC 4ERAA 3Q44A 4LOUC 5HDQL 4ZEPA 3N04A 3SCPA 3QG6B 2X4OA 4POUB 6A3HA 5C2UB 1WTGT 3V4VB 4GUFA 1OSPH 3OYZA 2VAJA 5LBSA 4APQB 1A6TB 4DKTA 2WUBL 3SDCA 3FOMA 3GSWB 4E2BA 3GSOB 3VFGL 1FH2A 4P4RB 2J7BA 1N6VA 4AYDC 2YCLA 1O7DE 5FDYA 3KCPA 1B3YA 2R2CA 1BREA 3MBWA 5CLXA 4MD4B 5GGVY 1GQIA 4Q6KA 4PODA 2DDXA 4BWUA 2QSCL 1GSKA 5FJRA 1V54B 2KZ1B 4GH1A 3IFOA 1DUZA 3RYMA 2AZUA 3MYOA 1JZHA 3KWWB 5LIKX 1TZ9A 1FNAA 2FWUA 2C1OA 1UR4A 1AO7D 3M0ZA 4WO4A 1RIUL 4D0BB 2W79A 1HL9A 1PX3A 4LIQH 4GQRA 4BH7A 4KGLA 4HJFA 2YOAA 3FQTB 1AR1B 5HHOE 5ICZB 2KL6A 3IF1B 4AL8H 4LFHG 1S7VA 4PI2A 3WJMA 4FL4C 4X5QA 5JOPD 1F4WH 1OK6A 5F2MA 3EPMA 3WF1A 4I6VA 3V6FB 5IESL 2KC0A 7FABL 4WCYH 1CFMA 1JGMA 3SQSA 3ZJKA 4YU1A 4Y16B 4OZGB 3HI1B 1SR9A 3VGEA 5D9NA 5DXYA 3W7LA 2X1WL 5HXMA 1OY3B 2PGRA 4WDUA 1YG9A 3H23A 3QI9A 2H6PA 2RUSA 3OZYA 5HPMA 9CGTA 3ARDB 4UM9D 2IKHA 5FD0A 3CFKB 4TNFA 5E1QA 3L5JA 3UPRA 1JNNH 1JAEA 4C7FA 3OHMB 4JIPA 3HZVB 2F8QA 4MUPA 5FV2A 1E4JA 5KOVC 3T4WA 2BC4A 1VJIA 3FO2B 3MPGA 3UJIH 1JRHI 3EYPA 1CD0A 1WFNA 2GK1A 5FF6A 4QE4A 4R97C 2C3VB 1BSIA 5E51A 5C0JB 4UV4H 5EN2A 1T04B 4DPPA 2WZAA 3FHQA 3S6DA 2YN3A 5BZDA 1I8KB 1GZJA 5E94A 3DTUB 1H7WA 4BZ1L 1VFOA 1EJ7L 1AQMA 3T3PB 1G6CA 3OPUA 4EO5A 5DWPA 2KPWA 2O9RA 2FHCA 3MUIA 4NZ5A 1YEEH 3WFHA 5JHDE 1XICA 4HUVB 3WBYA 1J9CT 4XXCA 4Y1AE 1BQCA 2EO7A 4S10A 1KDJA 5JBDA 3HHSB 2DWDA 3ZN6A 3ILQD 3RYSA 2VDLH 1NDWA 4MCYA 1BM3L 1EANA 1R3SA 4QM1A 4OFPA 5M1TA 6REQB 3U2SB 2A85A 3BW2A 3S46A 3ULUC 1BD2B 3B0XA 3INPA 1GMEA 5I1CH 4YUEH 4NQDA 2AEPH 3ILPA 1XKJA 4XZBA 3RL1B 1HHIA 2EKJA 4R2GB 5LN8A 4X4YB 2NY4C 1O6IA 1G9HA 5REQB 4IDLA 2QQNL 1K1WA 3IK4A 3CSTA 3QJAA 3NSFA 1UACL 4WEBH 1J12A 4OFKA 5EGRA 3KZPA 4LARL 3K5XA 4FQJH 2E09A 1ZT1A 4P2RD 1DIOA 4PLNC 3G6AA 3TQPA 4KROC 1W5PA 3VWJD 3QIUB 1AE6L 4B50A 1R3JA 5D2LF 1P4UA 2VR2A 3MGAA 4PS8A 3X3XA 4FIQA 3GNML 1A3XA 2ON3A 5KZEA 1PG7W 4UTWC 4BFKA 3APDA 3EF7A 4KNTA 3NFPA 1B4JL 2X4TB 2Q8AL 4HGWA 3EFOB 4WV1A 3DBSA 2JF1A 4JFDB 2VWSA 1WBJA 2HYMA 5IB4B 3FJ6A 5C71A 3G5YB 1WFMA 5CAYB 4GJJA 2V67A 3LRLA 4IOIA 4BBWA 4XZ9A 2CXKA 3VB8A 3ESNA 3AXHA 3WNMA 4KTYA 1FWIC 3LVEA 3KS5A 2JE8A 1JRHL 3RWFA 4MASA 2AC0A 2J27A 1L0XA 4HK7A 3GBNH 3W72A 2UXGA 2C0HA 4MNGB 1IKNA 1D5XA 1B3JA 4QDMA 3F2CA 1AXIB 2PDBA 1TOXA 1G9MH 4P23A 4BFAA 5D7LB 3P9WB 3OX8B 1LEIB 5I17B 4TRPL 1P1MA 1F11A 3AISA 4MZRA 3D39A 4GNKB 1U58A 1GCFA 3QY6A 4UFJA 3ARXA 4HLJA 3V6OA 4NN5B 2XN1A 4GUCA 3O8XA 4MKTA 1TUPA 4RV3A 5TDPA 4WOZA 2BS8A 2BSRA 4H8WC 5D72H 1RJYA 3GK8L 3P40A 4PHZA 3HG1E 4D6GA 5CEZE 3AMDA 3CCHB 3PG2A 5HYIA 3BTNA 1TQJA 1DVSA 3DX6B 1RUAL 1WJ3A 1VBJA 1P9MC 1I8IA 4H6KA 4ZCWA 1NINA 3O6LH 3BZGA 3FQUA 1X8FA 4BKLB 1FAKT 1Q1JL 4D8OA 4BH8B 1YNKH 3OJ2C 4QJ5B 3WLJA 4IGBC 1RBOB 3E8UL 4XZNX 2OZ4L 2Y23A 3H7VA 4OWGA 4H9XA 1MFVA 4G70B 3TMLA 4JOMA 4LS2A 3AG4B 3KPRD 2DZWA 4JFZL 3NCXA 1A7OL 1A1MB 1B0GA 2NLIA 1VHCA 1HI6B 2CW6A 4NUJB 3UG3A 2A9NL 1KBPA 2B1AH 2OLHA 3MBDA 3IIPA 1TVBA 1NGYB 4OFYD 4OCNC 4ZQKA 4GKNA 4YFEA 2NMSA 1OJPA 2K4WA 3PQYE 1U3NA 3EBGA 3MCOA 2Z0UA 2F5AL 5HYQB 4GI6A 4RMVA 1ND0B 4MCZB 1MIMH 5HMEA 3GJFH 3QNXA 1YNTA 4AKQA 2CK0L 3F6IA 5JMDA 5I8KL 3SKNA 4UUJA 1QNVA 1WEJL 2BPBA 2WXPA 5A2JH 5F4SA 1IAOA 4HFWA 2BDNL 3P3BA 2JI2A 5A5WA 5IDZA 4L8SC 4JFEE 5BUGA 1TYRA 3TL5A 1DIKA 4UWMA 3F65A 2QPDB 1JNEA 4W9HC 1VZHA 3O0RH 3CO8A 4BZ1A 1HXJA 2BSED 1YYLL 5DJ0B 1ONWA 1BOGA 2FHFA 1OFPA 5C0ND 2P5PA 4L5FE 5DLML 5AAWC 3CQIA 3K91A 1MEXL 1SQMA 4G80B 4BKNA 4HCHA 2IADB 3ZZ1A 3O7UA 4ZG1A 3NCJH 4DEUA 4PMZA 2MKLC 2PTYA 4CMMB 2Y5JA 2CLEA 4G9FE 3MV8E 2RGMA 4XD3A 1EOKA 3V75A 5MEOA 4AQ0A 2CLRB 5HATA 3JUZA 4NP7A 4UQIM 3FFOA 4KO7A 4DFHA 2A0LC 1XF2B 5L2JB 3ULUD 2OQYA 3W81A 5F0JB 2YAQA 3TN4A 2ZNWA 3JWNC 4AC2A 3RGVA 1PKQE 4KI5C 4A55A 3FB5B 2C9RA 3ATEA 1JGVH 2PTUA 4M0XA 2WM0A 3FB7B 1T83C 4YTSA 3LZ3A 2NY4D 3ML8A 1MCOL 3BPCA 3IGAA 5CBAA 1KENH 4A6YH 2VDRB 2ZXWB 2VDIA 4KCVA 4XBGB 1FDJA 4LCIH 3H21A 1DBMH 1NARA 2P10A 4CNSA 1OCJA 1LLOA 2BZDA 4KROD 4JGDA 2G75B 1WITA 3KPSA 1TSRA 2JI1A 4ADSA 3KPPA 4G7YL 1YEIL 3BE1H 3CUPA 1ITQA 5FOOA 1ODAA 1H51A 4Q22A 2YN5A 3HR5A 4O58H 4QGCA 3OC8A 1QSFD 2BVEA 3LD5A 1J2BA 2GFBA 4KKLD 4O15A 1NZRA 2ICWJ 3TZVD 1N3NA 1JGLH 1CFBA 5BQ7A 3HURA 3DTDA 3CDFA 3KBVA 1OXYA 2CIIA 3FCSA 4EVNB 1I2QA 3HU7A 5D7IB 1XBXA 2OMUB 2PPAA 4NPYA 5A2FA 4IFRA 4Y19D 1A22B 4AZ7A 3GSNA 1J93A 3GTTA 1KCUL 1POJA 1UZDA 2Y0SA 4RNHA 2PU0A 5EYWA 3P77A 3DJTA 5EZOL 3PDOB 2AOSA 3E6EA 1CFTB 1L9WA 4U1NB 3RWJB 2PPDA 5HMSA 1N2VA 1C12B 3QEGH 4JFPB 3S8GB 3QV8A 3LNDA 2UZPA 5H35B 4NZ8A 4X6FA 3M45A 1V4YA 1PIIA 2IIJA 1M1XB 3KRSA 1LEGA 3LKSB 4POZC 3TWCH 4LY8A 2WZHA 1PWLA 4FNLH 1JHTB 3WJJA 3SJ3A 3KYOA 4BE6A 4NCDA 4RMUA 1UXWA 1IAIH 4XMKH 5EIQA 3VNZA 3CEPA 3PYCA 3EKLA 2ICCA 3MV9D 1UXMA 5AB3A 2ENJA 4HWEL 2FB4L 3QW3A 4RW5A 1S9XA 4F7TA 3PFMA 1NKGA 2OCCB 4LHUA 1Y1UA 4YE4L 3O4OC 1PZUB 2LW3A 3Q67A 5JOEA 1CFNA 3K4AA 3U4KA 3QEHA 3UZEA 1ME8A 5FUZH 3UFIA 4PY7B 5KBDA 3C2RA 5DRXB 5AOKA 2MOQA 1OIMA 2OZ4A 2IXQB 2E47A 4OR1A 4ZPVB 3ULVL 1BGGA 3ABXA 4IGBD 1GYWA 1XF5B 2X28A 3QO0B 4HGKC 3QUXD 2PLMA 4MKNA 3DTXA 3FHEA 1G9NH 1JD9A 3CIAA 5TK4A 3KYAA 2CU9A 3W7XA 1NBZA 3AHZA 5IKCA 2Z92B 3UH8A 5ILTL 5F2FA 1WFUA 4JPSA 2E9MA 3KYKL 3MLTA 4NNPL 4UT6H 1EZVX 1H4PA 1OC7A 4B9PA 3V4VL 1KZYA 1RZIA 1DQIA 4N42A 5HDRA 5G4HC 3QPKA 4P8UA 3LZFL 2W0QA 1KPVB 5ACZB 3EOBA 1A50A 4QTFA 4MX7B 4AZCB 1Z69A 3FDWA 5BOFA 3CUIA 1LF1A 1UWQA 4IBZA 5IJBC 2VKXA 1ED3B 5HWNA 3VXME 4DH2A 1FDZA 2OR2A 4RMWA 1IM3B 3GINA 4I9WE 1YYMH 2CLKA 3B2UD 1M9WA 5DD0L 4GIAA 3NAVA 2CD0A 3IMSA 1ZKAA 3OBEA 4JG0H 3W2NA 3O11A 1N4XH 3E0IA 4RESB 3HNTL 1KDIA 3MWXA 5DJ2A 2B0MA 1F5WA 1JD7A 1OHQA 2X4OB 1DL7L 4HQVA 1UIOA 3SDCB 4HNUA 1PTGA 2D69A 4Z7QB 2BP3A 3MRCA 2YCLB 1UASA 3NIGE 4F9LC 3MBWB 5CAKA 5AAPA 1MEWA 5HD8C 4CMHB 4M00A 2I9TA 1QNZH 1VS1A 1UZ6E 3CQHA 4W70A 4XZUA 1LT7A 4E5XA 3IFOB 1DUZB 1M41A 3NM3A 4PMJA 2C1OB 2FVLA 4WO4B 4I3RH 2HPMA 4BH7B 2A0LD 1CR9H 3P4OA 2I27N 3AFJA 2PTVA 2I25N 2BP8B 4W7UA 1S7VB 1WO2A 3DECA 5DVKA 4UAOC 2MCG1 3WJMB 1A3ZA 5I8EA 3VFTA 3E2QA 4OF7A 4Y9PA 5ADPH 2OL3H 3S5LA 5JDSA 1WRFA 4PI0A 2P5WD 2VOTA 5HVWA 4YJZL 1V7VA 4OIAA 3U57A 5FIEA 1G7QA 3ZMEA 2H0EA 2H6PB 2NPLX 5C0CA 3GXUB 4CBZA 4EF8A 1ZA3A 4W84A 2MOVA 3SGEI 1I85A 2OM5A 5CMAA 1IX2A 5IJVA 1X7SA 4BSWB 4PJBA 1ZJAA 1PQZA 5TQ0L 1Q65A 4HIHA 3U1SH 1ZA6B 5D1XA 1E4KC 2A3CA 4PY8J 2BC4B 1BF5A 4C47A 2GK1B 3BKYH 5HHQA 5FF6B 3CSFA 4PJFF 5EN2B 2WXKA 4ACZA 4KKBC 3I9PA 4EDXA 1FFPB 5TNVA 3II2A 3ZXAC 2F1BA 5BZDB 4E41E 3QLDA 3OGRA 5LHFA 3OKNA 2PRMA 5E94B 2OXNA 2K9UA 3WIIH 3AS2A 1S2AA 2I57A 3VFUA 3UTTE 1FJ1A 3VI4E 2AJXL 3WFHB 3LNFA 5E8NA 4J39A 2W80C 3CQPA 4W85A 5ANHA 5AB2A 1VFTA 1YN6A 2OGJA 2DWDB 1NEZA 1E1EA 3BPNC 3EZ4A 3ANUA 4MCYB 5HQEA 3CVHH 3NESA 3AXLA 1B0RA 4P5SA 5IEHA 1H7PA 4LP4A 2DQMA 3G6JF 3SYOA 1LO3L 3LHUA 3BJSA 3ILPB 3OVGA 2C3ZA 4NI6A 4XX1G 4H83A 1HHIB 1NP2A 3EA3A 2ADFH 1IARB 5DMLA 4UTAL 1P48A 4QYAA 1EPXA 4DPQA 1RIVH 4LB3A 4XGZB 1WMPA 3QHFH 2GJNA 4J4PC 5AKSA 3BLDA 3J7HA 2GYSA 3LH8A 1DJQA 1WDWA 5JBEA 1ZT1B 4JFTA 2N59A 4AEFA 2HH0H 3G6AB 4JKLA 1TSHA 4E9YA 1R3JB 4ZB5A 4EZMA 2A4AA 3R43A 1H7XA 3PWAA 2X4RA 2WSRA 4NX5A 1XW8A 2H3BA 1A7RH 5JQIB 3A3XA 2DLHA 3CLMA 1X1NA 5DR5L 3V8OA 2VRKA 3EUUA 3UBGA 5FJTA 3NFPB 3IKCA 3P2DA 2B0SL 4IFOA 3BARA 3RLHA 2NUTA 2CM5A 4WV1B 1V6YA 3RCMA 1XLFA 3NRPA 4Q9RL 3QG6A 5FOJA 2OMBA 4GKTA 3V4VA 5KSAC 1KMGA 4IOIB 4XOBA 4APQA 5FECA 2AERT 1GYAA 1DLFL 4TSCL 3DHPA 4F33A 5HINA 4U28A 3CWGA 2JF7A 1NEPA 4P4RA 1CCZA 5KBLA 1NGQH 2FECI 4A68A 1OAZL 4PZVA 2Z0IA 3C6LC 3U2OA 4V1XA 1HWGB 5DJCA 3I6EA 3QUHA 3E2SA 2R1LA 3MZTA 1RZKL 4HKXA 2J9XA 3RZWA 3DRTB 3MLXH 5IMLA 2VDOB 2WN3A 2BHYA 4P23B 1MJ8H 2AJYH 3VFCA 1S3KL 2ZKXA 3UZWA 4BQ8A 5ABZA 2AMGA 3TROA 3K13A 3RNQA 1B4RA 3LG3A 5F7NC 3D39B 2WKOF 2VLJE 5K9OB 3MLVL 1EC9A 3VXGA 3DH7A 2E3VA 4FG2A 1OF6A 2H26B 4QJ4B 1NDZA 4RCAA 5TDPB 2F7QA 3VG9C 3PB2A 2BSRB 4PV8A 4A7GF 2V38A 3RVXC 4HAKA 2X6AA 1TZGL 2WQWA 2D9CA 1XGYL 2JJSC 4Z2LA 3OF6D 2ZKMX 2CE6A 5FUCC 4PAZA 2MWCA 2PDXA 1PS3A 3DI2B 3ITXA 3ROOB 2VZSA 1I8IB 4D72A 1OE1A 3UP1A 4AWTA 3ABOA 2E6QA 1UUMA 5B1JA 4H0LC 4Z7NB 3TYBA 3LHAA 2A7RA 4KWOA 3LEVL 1HM3A 2PSNA 3QDME 3NGJA 1S5MA 4URKA 4KTPA 2HUEA 4I8DA 3JTTB 1VPXA 1FG9C 3EFDH 4YNGA 3LSCA 1NPNA 5HDOA 4R5VA 2DJMA 2C8NA 5D6DA 1QW8A 2O5ZL 1R2RA 1XSIA 1NEYA 5EUOA 3VXSD 1NCUA 2ENYA 4S3EA 1C5CL 4JTKA 2C3VA 5CU9A 5C0JA 1B0GB 5DFAA 5EY5A 5AFAA 4RSVA 2ODOA 5GGVL 5C6PB 1Q0EA 5A6TC 3IFLH 5C6WH 3LB6C 1EZLA 1TVBB 4BXVA 4ZQKB 1R24B 3WEOA 3HI6L 3FH8A 3X1GA 1BXBA 2H1XA 2TPSA 4WI0A 2L0DA 4H20H 1KYOJ 3VTRA 1P0SE 4LAQL 3TURA 1DQTA 3IAQA 2CKNA 1RK5A 3M0MA 1MCJA 1X5AA 3CT7A 5B1AB 5D1QC 2M8XA 1EJRC 1YNTB 5HHMB 1XIDA 3VAEA 4K8RH 3SKNB 2ZAGA 4UUJB 2O4EA 5L2KE 5E2VH 1GMIA 5L8KB 1TKKA 3ZTNL 1IAOB 4HFWB 3U2SA 2DPKA 1JUFB 1EXGA 2GJ6E 2HN7A 4P57A 1CCWB 3B9VA 5BW7A 4H1LB 4U6HA 5A40E 4K94C 5AC8A 1SUXA 1W5NA 1F6LL 4LLUA 3HV9A 1W9VA 1FZKB 2G5RA 4V11A 3K4WA 1P7QA 3RLGA 5IBLD 5J1AA 4JG9A 15C8L 3OO2A 1Y0LA 3VFPA 4KKBD 3ZQWA 1BOGB 3EF4A 4B0MB 5DURD 3CTTA 5XINA 4BF7A 2E27H 3DX3A 5HJXA 1SR0A 1ZHLA 3PFUA 3T6VA 2CHRA 3HFML 3QIUA 3CMFA 1TJMA 2AHIA 3MYZA 4XZHA 3PZOA 4FXKB 1QI0A 3KH3A 1UD6A 1NMAL 2XGZA 2C11A 1VFAA 4C6KA 1NC4D 3S1UA 3S2JA 3MV01 3S2AA 3Q2VA 1AZRA 2BSBA 1IAIM 2E9LA 3JVGA 4PJDF 3KVDD 3VI3E 3LHPH 2QDGA 5IV2B 4K9JA 1CU4H 4JHVA 3G5YA 4K1WA 3ZWTA 4XUYA 4UTAA 4ORMA 1H19A 2QJJA 1MNUH 4Z2HA 3RGVB 1MCPH 1J87A 4DGIL 3KPLA 3GTHA 4QAMB 3Q01A 2YXMA 3P84A 3VKCA 2J47A 5JW4N 2YRBA 3BPCB 3QGAC 5CBAB 3DZ1A 2H0FA 4HTBA 4LMQE 1DZ0A 4MNGA 3LDBB 1OPGL 2A3LA 1P69B 5BO1H 4WY0F 4RSYA 1T2QL 3POHA 3HIGA 2BWQA 1DO6A 3KPSB 3PU7A 1ZTXE 1TCRA 3E2VA 1SPDA 3MU3A 1DL3A 3OX8A 5J6HA 3CUPB 2LABA 4XG1A 3B4YA 4WEEA 1XCQB 2PRLA 3GBDA 2AXJA 2GTZB 1YPFA 1I75A 4G7EB 4QHMA 5FCZA 4KFEA 3IT8D 3OD3A 1M03A 5FCSH 1Q45A 3W70A 3EO9H 4XVUC 4X99A 3TYDA 2GKIA 1N8FA 4P46C 3BGJA 3HR5B 2RHGA 1WOAA 2XA8L 2GFBB 4DBWA 2FBJL 2KUTA 3QTGA 2Y7DA 4ABUA 5BQ7B 1IGWA 2WQSA 2FX7L 5ITFA 2CIIB 3FCSB 4NPYB 3GT6A 5L6YL 4JDEB 4F91B 3GSNB 4LEBA 4MMZC 4NUPA 3LS4L 1KBVA 3C6LD 3P77B 4WNQA 5CEYB 5IQ7L 4CADB 1NUFA 5IOPA 4PGZA 4LWWA 1J48A 1V03A 3N50A 5EO9A 2L7JA 3K8LA 2BWDA 4X6FB 4PJ7E 3C08H 1LO4L 2DQHL 1UQYA 2QZ5A 1LEGB 4OTXH 4JUSA 3C0QA 2MPAH 1BZQK 1FP8A 1W56A 1ET8A 2DQCH 5EFIA 1UEYA 4UB0H 3ZDXB 4KUZL 5C0BD 2QMKA 5B39A 3QJOA 5AZUA 1IC5L 4HCDA 2VO8A 4L3FA 4FR6A 3FTXA 2FEDC 4G72B 4LSTH 4O57A 5HAOA 1UXWB 3MP4A 4WUKH 2F08A 4GCXA 4DRSA 3G3MA 1IT7A 4R0LA 5CGQA 2R9HC 1KIPB 2Y1AA 4CLMA 4OB5H 4PUDA 1SDYA 3BQ5A 4D2NA 5GZNA 3CGTA 1U8NA 4JQXA 4MWAA 1UD4A 2BW5A 3VQ1C 1S9XB 5JVLA 2J71A 4F7TB 1BQLL 3H1ZA 4TNVF 4FNQA 3O2LA 3DG7A 2RH0A 3G24A 5BMFL 1EB3A 3RJYA 1CFNB 5AKRA 3ZYZA 1NGWB 3QEHB 3I50H 4KRZA 4ML9A 2VR7A 4N6EA 4MTVA 4NP9A 2QCDA 1YVLA 5BXSA 2PZNA 1PIFA 2Q8BH 1THAA 2IFGA 2OR9L 2WNKA 1C5BH 4JM2A 3WMBA 5KSUA 5EMLA 3HBLA 1AO7E 1WICA 1CLVA 2IALA 4AOFA 5F6HJ 1NBZB 3EDJA 1MNZA 4WWPA 2HNHA 3B2DC 1BYAA 4GBUA 3MLTB 3QIWC 4W9FC 3GXFA 4ZQTA 5DJ0A 1WWAX 3TUUA 2ZZ1A 1PD1A 4U31A 3AT9A 4S2SA 1EMTH 2YD5A 4NEHB 5KZCB 5JOPE 2BSDA 3ZVIA 3EOBB 3IJ6A 4MA3A 1V08A 2W5FA 1KN2L 5JIMA 3NZUA 3SKJH 1KACB 3V5HA 2ISDA 1FNLA 2JBMA 2NYYC 2BXZA 5EA0H 1EX0A 2GUBA 2NXHA 5CXPA 2Q6WA 1J8HE 3JVAA 1USZA 3U2IA 1XF2A 1WAAA 2A6JB 3O11B 1BVNP 2BK8A 2W63A 3V0JA 1C8PA 3PL6A 4NSBA 1SNRA 2POZA 5DJ2B 3TKFA 3FB5A 4DI9A 3KXFD 3SD5A 3ZX1A 2JIWA 3SCRA 3PDDA 2UXTA 1ET7A 2ZA1A 2B2XH 2Y9RT 4P59H 5ALCH 5JDJA 4PRHE 4XBGA 2QPFA 1WF5A 3MRCB 4ALAC 1WS8A 3A64A 1UQSB 3WNIA 3ARFD 3CZEA 4O1AA 2I9TB 2XVGA 2R0KL 1UT9A 3PPSA 1QW9A 4PTDA 4DM2A 1A3LH 4XZUB 3SGKC 4H9ZA 3BZ5A 3I6SA 4E5XB 1I9IL 4PCPA 2A3BA 4U6VL 2KLTA 3QPYA 2XX1A 4J2MA 4MB3A 2DQFA 1TQCB 3RJDA 4JUTA 3PP3H 2M26A 4HIQA 3THML 4XP4H 5T1LD 1A1NA 4HEPG 5DUPL 1LO0L 5KS9F 2ED6A 3P4OB 2FD6H 3GS7A 3FA3A 4KESA 1EX5A 3N4AA 5D7IA 1NTDA 1NMCB 2DZUA 2YX0A 1IAKA 1X5JA 3VFTB 1PYWA 4PGLA 1QNIA 4PN6A 4ZVJA 2X0YA 2BMBA 4PMRA 4HJ1A 5JDSB 4K8EA 1TR7A 3MS8A 2KS0A 2BS9A 2Z64C 4DZ8A 1G7QB 3GD1C 2OQLA 4HC1L 1C12A 5I24A 5H35A 4P2RE 5C0CB 4F57L 1XGUB 2GTWA 5JXQA 4JZJA 3SQLA 1ZA3B 4K5MA 2CITA 1RUMH 1E6QM 1DVTA 5FUOL 1OVDA 4WJ5B 4N8PA 5IJVB 4G8TA 4PJBB 4LVNC 2YMTA 1PQZB 4Z7UB 1WNOA 4HIHB 3KVMA 4PUNA 2VELA 5D1XB 5C07D 1ZRUA 1WIPA 3VSUA 2BVWA 4L18A 3O0FA 3H2OA 1ILSA 5HHQB 4FKEA 1MSPA 3WJYA 3REWB 5GJTL 2HK1A 3H4GA 4ACZB 4EDXB 5CH9A 4MLJA 2VNCA 4E3VA 1OFBA 3GH5A 4WUIA 3IDXH 2AQTA 3ZTEA 3G5VA 2G2NA 1JNJA 3VWJC 1REQA 1JYNA 3VFUB 1FJ1B 2HVBA 3FTVA 1RY0A 4PGJA 5E8NB 2W07A 5DRXA 2E0PA 3OAZH 3TBBA 3L2IA 2XINA 1YN6B 2XH2A 3L68A 1A14L 3CN4A 3QO0A 2VLRD 4CL7A 3ME3A 4G6AC 4ZMXA 3AXLB 1W4NA 1PZ2A 5IEHB 2W62A 3Q1SH 4WTZG 4WW2A 1V79A 1RP9A 1NL0L 4V1DE 1FC2D 4KZEH 1C93A 2FEDD 3UT0A 2NXYD 1LP9E 4J3XA 3WUWG 4AFYA 5E4EC 4HWBH 4GQQA 3BLLA 3MB9A 3W2DL 1P84J 2VD8A 5T91A 1M5WA 2WQVA 3AHXA 3MRIA 2L5HA 1RLWA 5ACZA 2YD1A 4YHLH 3VYOA 2OMAA 2NX5D 5DF0A 4MX7A 4AZCA 4ZS7L 4KJYA 4RX0A 4Y4FA 4FJ6A 2PN5A 3SY0A 3TLLA 3FUNA 3QYNA 1TENA 1OANA 4JFQB 1K72A 1ED3A 3ZXWA 4JDVA 3WMPA 3ZYOA 3G0SA 4XMVA 1W8OA 5ITBH 4H6QA 3PZQA 5BYWA 1L6WA 1JPFA 1KLUB 4XP5H 4O19A 1DSWA 1RVFH 3IKCB 3QBUA 4DK6A 2OPCA 3S83A 3RL2A 5I76A 2NUTB 2WZTA 1AJ0A 1F2XK 3S35L 1JCKA 1YEHH 2QPEB 3R7QA 1J05A 2QJMA 1H3PL 2O9PA 5FECB 5FYLL 2X0SA 3WTYA 4PJEE 4F33B 3LD8B 4FQ2H 3QIWD 5KN5B 1VKXB 1JFXA 1RCOB 3DHJA 2R8SL 3KPRE 1CZ8H 1DBJL 4P9HL 4XBSA 1OP4A 2XI9A 2Y1VA 1G4TA 1ZIAA 4QUOA 4YDJA 3GRBA 4BM7A 5DJCB 4DM1A 3H9SD 2DI9A 2Z2UA 2Y8UA 4HKXB 3DI1A 4PRPE 4HT1H 3TTEA 5IMLB 1K2DA 3VWKC 2NYYD 1UH4A 2GABA 4GC4A 1UUNA 4HCRH 1UA6H 3TH4T 1MCSA 1CLZL 3LMJL 2ZX6A 4KQNA 5BRZA 3NJVA 4HJGB 3RNQB 4FO4A 1B2YA 1E6PA 1ZJIA 1DBAH 4UM8A 2ZX9A 4P2QD 1WUEA 1W5QA 4J2PA 2BP8A 3W1UA 5IBTH 3ZE1F 4OLVL 3BW3A 2CBPA 2Y7EA 3OJDA 4PV8B 3AXMA 1I4NA 3TN6A 1MJ7L 2FJSA 1XLKA 3T1FA 5CSUA 5BZWB 3GUGA 3SDAA 4YN3A 1F1SA 1UR2A 1RW9A 4KMTL 4EIZC 5AVVB 2BFGA 3AYSA 2O6PA 4O4YL 1L7TH 2IQAA 3LRSA 2CHWA 2H32H 1FY6A 3NEVA 3O0LA 1GVFA 2ZXEB 2QPSA 5DLCA 2VMFA 4NM4L 2QGHA 4B4HA 1K8YA 1OO2A 2VXUH 2VGLM 4GYKA 4BSWA 1ZAIA 1VDGA 4LPVA 1UM4H 2VISA 1AXTH 4LVOC 1C92A 5EBWA 1ZA6A 3K1DA 1YDYA 3QR3A 1DXIA 5EUOB 5DSCA 1U91A 3F8UB 4ZO6A 2UUDK 1L0YA 2H1PH 4GJTB 5AFDA 1LVEA 1OP5K 3BOVA 3ULUE 3QFGA 1MRQA 1GZ1A 4CRPA 1OP3K 2PWUA 2QKSA 3WA3A 1YSOA 1FFPA 5C0NC 4W4OA 2YFOA 1J0NA 1E3XA 1HIZA 1NCWH 2AITA 3MRDB 1BFNA 3RM4A 2P5ED 4HC1A 4Y4KA 1F6YA 3QMSA 2BZNA 4WI0B 4OLWL 4LCWA 5IFTA 4HCIA 1J1OL 3D07A 1VFLA 3CC5A 4FQXC 3NO5A 4F24A 1CXIA 3FH5A 2PA6A 1KNWA 1FNEB 5AEAA 3AIWA 4K9EH 5TQ2H 1QOPA 1FCUA 5KVFH 4LQFL 3DVNA 1F2QA 4IK7A 3NZSA 2QCLA 4ZUTA 2VMEA 4O16A 1HKFA 4EAEA 3TV8A 4EANA 5E0CA 3A6BL 2HN7B 4P57B 3CZ8A 2L8AA 1R3VA 4ZTPL 3WFAA 5IM51 4MMXA 1TTFA 5FHAL 1LOSA 4U6HB 3IBEA 4LLUB 4PVMA 5HHVL 2PYED 3OHXB 4YFLI 1P7QB 4WUUD 5J1AB 2PWHA 1QSFE 1SQ7A 5FHBH 5BOJA 4FFZH 1TPVA 4XGZA 1NOUA 3W2KA 1Y0LB 1LDSA 3VFPB 1AD9A 4U4BA 4Y19E 1V8HA 1ZHLB 4M7LH 1HH9A 4ML4A 4YSQA 5I73C 2X4UA 4XPFL 5ESQB 3DYOA 5LAXA 3RY6A 3PB0A 2Z7WA 1CD1A 3MODH 1VFAB 3N4FA 3BGGA 1I1AD 1NBCA 3WF4A 4D0DA 4PEEA 5FJIA 1KCBA 2X2YA 1DVZA 2RJHA 5DANA 4TL4A 4WHYH 2XZAL 4G6AD 1HINL 3UR7A 3FZUC 3Q8EA 4KKLC 3IFNH 3TZVC 3KVQA 3JV0A 1XZWA 4JZNA 4FI6A 5MP6L 1EX1A 3KPLB 3D47A 3V0TA 4NWTH 1N7RA 4H26A 3T44A 3CAWA 3W74A 1H0DA 4W87A 4XO8A 3SGJC 1H62A 3SCVA 3MV9E 1MY7A 4QR7A 3KR3L 1B4EA 3GSNL 4FEIA 3UYOD 3DRTA 4WWKD 3F12A 4ZO8A 2VLMD 1F42A 2FQDA 4MJ2A 4LSSH 3W0KA 1DFBL 2E6YA 1TCRB 2UYLA 1A6VH 5J6HB 1DEEA 3BSGA 4N9OB 3KYNB 4J1UA 4QHMB 4C57C 3QFZA 2WCOA 5K9OA 1AKJA 4X99B 3K3QA 2H26A 5BS0B 3FT0A 1MAML 5EV7A 5LGZA 3QSKB 2AL1A 4LB8A 3UPBA 4KFZC 1DWIM 5E6IA 4OJCA 2VXSL 4PJGF 5ITFB 4YMZA 1X44A 4XB7A 3QZLA 2D24A 3MT1A 2Z6FA 3FUHA 3MC0A 4HNTA 4N0CD 1LWRA 3ROOA 3QA3A 5IK3A 1OZUA 3WQ8A 4WNQB 3JU2A 3MJGX 4XP6H 1Q72H 4IKIA 5IOPB 1Z41A 2WZPD 5B8CC 3CSGA 2WV3A 1ID5I 5BVPL 5KVDE 1ZEAL 1B6UA 1E67A 3MBXL 5EO9B 3KH4A 3VWKD 1MI3A 3JTTA 3GZOA 3LIZH 1YJDL 3U30B 2EXYC 4JY8A 1RZJC 2ORBL 1H5BC 3EH2A 2PLJA 1UC6A 4QEHA 3QUXC 1PKMA 4MAYD 3F2BA 5LNGA 5EFIB 2WYZA 2IC2A 4BY3A 1E4LA 1OX4B 3MP3A 5AYZA 3RLSA 2DJ4A 2PDMA 5B39B 1KJ2L 3TYZA 4LDCA 3W01A 4BSJA 5D09A 3ESMA 2H5UA 2CK2A 3PRZA 3O3DA 4YHYC 2MHAA 4BI7A 4R0LB 4GSDL 4XXDA 1FSKC 4OM0H 4GEIA 1ADQL 4O5LH 5EOQH 4KQ4L 3W9EA 3L4ZA 1U8NB 1R24A 3MLRL 3PXJA 4MWAB 1DBBH 3UADA 5J06A 2XCMC 3LHZA 1PTDA 3W1PA 1W17A 3A6CL 4QRNA 4M9OA 2CRMA 1EXUA 4LLVA 4P5UA 4CQAA 1K3ZA 1WH0A 1JPKA 2H47C 3I84A 5CCJA 1T6BX 3ELAT 2DJXA 5SWUA 2AEIT 4DUWA 2YCJA 3LEPA 3B2UC 4PR5A 3UJJH 2QCDB 4JHZA 1ZCCA 3A67H 5FW6A 5A1AA 1JUFA 5IQLA 1KTRL 2LU5A 1DJNA 4JM2B 4RMTA 2W9DL 5KSUB 1R5WB 2IWEA 4H1LA 5ANMA 2PBOA 4LCUA 1HESA 1W6WA 2IALB 5GGTH 4JBRA 1PZBA 2WIMA 1BAFL 3TGXA 2ZOWA 2OQEA 2AV7A 4AZGA 1FZKA 4QXGH 3CNYA 1LT8A 1HAWA 4WX2A 1OT1A 4HIBA 4Y5VA 3TMQA 4A3RA 2JGYA 3VSQA 3PSVA 3GQYA 3JWNE 1KGCD 1UWGL 5B80A 4U0RB 3NIFF 3TN0A 4KI5E 3S3JA 2ZCLL 1NJ9A 4S2SB 2XM2A 5DMIH 1S1RA 4LF1A 2DQGH 2ERJB 1TTUA 4MA3B 4GLEA 2FFIA 1JRCA 5DT1H 4FXKA 3EG9B 4GMTL 1TJRA 4AWSA 4M8UA 1XGZA 2LLLA 3V5HB 3MV7E 3DMMA 2D22A 3WLNA 2NR6A 4ZS6D 1A4KA 4FQXD 4WKFA 4XI5D 4AV5A 4IL2A 3NIDF 4JFOA 2WLMA 2W59A 1VGEL 7REQB 2Q6WB 2YXWA 4J23A 3SXXA 3OQRA 4LLYB 5IV2A 2D0GA 1TWZA 4GXVH 1IE5A 3EWUA 2OO6A 3CX2A 3ZMNA 2E1WA 1QD0A 3LRGA 3PL6B 1TMHA 1WDAA 2BRQA 5JQ6H 3WEMA 5DT7A 3GI9H 3WUZA 2ZD0A 5I6OA 3LM3A 5I8OH 3TT1L 4LUYA 3S1XA 3S37X 4DP0X 2GPZA 1ZGLB 1IC7H 3P81A 3D50A 5FR3A 3A47A 4XQ6A 2PPGA 5KVMC 3OEXA 5AYYA 1FPTL 4D9RE 1IV8A 3S2LA 1AYOA 2IANA 4DY1A 3DIFA 5DA0B 4NNXA 4ZUWB 1ZE3H 1XCQA 4CD7A 3WQPA 1FNSL 4G7FA 2GTZA 3I65A 2OZ8A 1H3VA 5EBLB 1UP0A 3CU7A 2HKAA 2EDRA 3F7VA 4G7EA 3N3EA 4HFUH 2DQFB 4OECA 4KUCD 3SCMB 1SXZA 2PCQA 3DYPA 4HPGA 1IGML 3QQNA 1NUNB 3IDJA 3FZUD 1F4XL 1KTJA 3QEZA 1A1NB 3QZ6A 4PJXF 3KBWA 2PDWA 1QWHA 1NP0A 4JG1L 1HEJC 5IHBA 3FT2A 2JIEA 3WNNA 4HPHA 5D7SL 4NGHH 3BRFA 1DHPA 4CVWA 2VSDA 4JDEA 2R82A 3VOCA 1IAKB 3KYMA 1FBIL 2DM3A 1PYWB 5MERB 1KT2A 1ME9A 1RULL 2ED7A 5GJPA 2AJSH 3I6LD 5IVXE 5CEYA 3BSHA 2B7QA 5FAAA 4CADA 5DHYA 3RX4A 2ZCHL 1TZZA 4DZ8B 2IG2L 4H88H 2AANA 3UGXA 5J8LA 3H2CA 4I9MA 1E0OB 1KWKA 4WEUD 5CP3A 5E9DA 1A9EA 1N0LA 2GTWB 3WTVA 4KETA 4JZJB 3O6DA 3MSDA 5E6YA 4GVGA 1SLUA 5DVPA 2Y5TA 2PP0A 2DL2A 1Q90A 1R38A 1EFXD 5D7JC 2BGQA 4N0UE 3GH4A 1BYNA 1NELA 4R7OA 3MRNB 4S3AA 4QRPE 1XSOA 1KIPA 3TTSA 2IXVA 2ROYA 1WDQA 1SUJA 2GC7C 2YPLD 5BXRA 3FFCE 1KB9J 1UBPC 5FACA 2H2SD 4NNYA 2Q7YB 4CILA 1RMFL 3D0CA 3PVFA 2XA3A 2XZCL 3G5VB 1XGEA 2VDQB 4JGJA 5IFJA 1JHKH 1REQB 5A3HA 2XBDA 2WLNA 1NGWA 5E6ZA 3DXAA 3H8NA 2W07B 1KKOA 4MUZA 3P82A 5F72S 3OGOE 3CN2A 3QUGA 3U9UA 5C7VA 2Y5SA 3SAZA 1X5KA 2EXYD 1BIHA 2A6DA 3LQLA 1EDGA 1KJ2A 3PY9A 4GPNA 4GS7B 1ME7A 2XFXA 2P42B 2HS8A 3NJGA 4UINL 2XWJB 3BG5A 2OZNA 4DOHB 4WW2B 4NJ9L 1ADQA 3VH8B 4M93C 3UR2A 3EKGA 1H3UA 3GUFA 5H8MA 1M6JA 1SHWA 5G2HA 3ARBA 3TVMA 1ZP3A 4HIXL 4BZEA 2X2IA 2QIWA 3MRIB 1ENUA 2J4GA 3EOOA 5BUPA 3B34A 3WAKA 1UR9A 4KJYB 2JF6A 4Y4FB 1OAXH 3QCTL 2GSEA 1JN6A 3SY0B 1JDEA 1WGVA 3X3GL 3QJVB 4JDVB 5GHWH 4PWKA 3R06B 1ZVNA 1F6KA 3MBEA 5K1VA 3HAEH 1JPFB 3D0VA 3TX9A 2EHHA 1CBJA 3F64A 8PAZA 3IEAA 2A6JA 4RDWA 3RL2B 5I76B 5KW9H 3CHFA 4HW6A 2VDNB 2GDQA 2Y3AA 1J05B 5FO8A 3WFBL 2ITCB 4M24A 3GSXA 3VXSE 3MW7A 2ZNXA 2D03H 4LPWA 1UQSA 4ZFQA 4X5PA 3RVUD 3WLRA 3T71A 4XVJL 3W7OA 3KJ6L 2LE9A 3L6FA 4N25A 4C6OA 4YDJB 3QQ0A 5C9UA 3F1QA 3NQIA 3RB5A 4RRPA 3HIIA 3CQKA 1Z3GL 1X3DA 2TYSA 3GY1A 1K2DB 3M4HA 4AQEA 2OG9A 2NUWA 1HTYA 5TDNA 2V7HA 2Y2TA 5D03A 1OGAB 1FWGC 3FU7A 2E22A 3H4HA 1ZLVH 1W9BM 2A9DA 4PV9A 5BV7C 3MUAA 2EDHA 5BRZB 5C7XL 1BMWA 5KANI 4AIUA 1DJYA 4JFFD 5C8BB 2I5YL 3RAJL 4Z5RB 4UM8B 4MDOA 2VSMB 2CR6A 5CR1A 1A25A 2EE9A 3I6KA 4DVRL 4XMWA 2QT6A 4Z77B 3RWGB 4MG4A 1TR9A 5C8JA 3OJDB 4KO5A 3AIRA 3EB2A 3W0WB 5J6GA 3CNKA 4IEFA 3T1FB 2HRHA 3SDAB 3SDOA 3IU4H 5EMUA 2V5DA 1SVZA 4QT5B 1GCYA 4W93A 3ZSSA 1LYQA 4OSUL 3C5JB 4QTIL 3PR2A 4RA3A 2IQAB 4DKFL 3QEQE 4F1ZA 3LRSB 3SUUA 2NXGA 3G3DA 3WJWA 2EDEA 4GVFA 4BK4A 4I0PA 1YEGH 4B6ZA 1IM9D 4PLOB 1XGUA