4FNRA

Crystal structure of gh36 alpha-galactosidase agaa from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTAAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELMYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 230
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnrA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnrA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnrA02
3OA3A 3BAXA 2WCGA 3B06A 2GVLA 4FXSA 4HNNA 4M6PA 5KTLA 3CGTA 5U7SA 3W7OA 3VE9A 1QHPA 1TRIA 5LNRA 4FNSA 1XH1A 2X16A 2ZRXA 3TDFA 3FYOA 1SQ7A 2Z2UA 5EMUA 5FESA 4HHPA 2WANA 1QI5A 4AF0A 4AWSA 4ZMGA 2QCEA 4Y96A 2QEZA 1I2RA 4RZ6A 4S2CA 2ZRUA 3K8MA 1EP1A 3HF3A 1E3ZA 1EO5A 4JTEA 4TIMA 3EX4A 3EJSA 1OX5A 1Q6OA 1PS3A 1JUBA 3S2CA 4QNEA 1OG0A 1SW3A 1TPWA 3I65A 4AEEA 3ZT6A 1EWEA 5K2ZA 2ZUTA 1WOAA 4MAZA 2G3NA 2I9EA 1PIGA 1C29A 7TIMA 3K8LA 1JQXA 1KM4A 4O1AA 2FHFA 2OCZA 4XBKA 5E9AA 1CYGA 5F1VA 4G1KA 4OWGA 2NWRA 3EX2A 4HN4A 3R89A 1W3NA 1DEDA 3O6DA 2YPIA 3H55A 2Y2WA 2VFIA 8CGTA 1K02A 3STCA 3W9ZA 2YA1A 1OYCA 2J9ZA 3LBMA 3QPZA 4QAIA 3MBFA 4S2BA 1AW2A 1RV8A 3QJAA 2A7RA 3TE9A 3KL5A 1B9BA 4UQBA 2VEKA 4LUIA 2Y7EA 5CKSA 1E43A 1FQ0A 2AGKA 3TQ0A 1PHWA 1VCVA 1KV5A 3PS7A 3G8RA 3MO7A 4XTDA 3NL5A 2R8WA 4FNUA 1XXXA 1ZHAA 1UD8A 1KXQA 2V3FA 1TMQA 4MY1A 1ADOA 3LCXA 2PWHA 4LW7A 3VE7A 2ZXAA 3GBEA 2OT1A 2QCNA 3NOEA 3NNTA 5EMYA 4JTTA 1E51A 2F1BA 4H7VA 3EWWA 2A5HA 3CZSA 3PG9A 4UTTA 4O12A 1GJPA 1WZKA 4HA1A 4UTIA 1OT2A 2OX1A 1H61A 4MIMA 3W1PA 1FWTA 4MVAA 4GE8A 4N9EA 4AMXA 2YFNA 2Q3OA 4PL2A 2V3DA 2XN2A 3TXZA 3IIVA 5LHFA 1C8VA 1THFD 3WK0A 4LC8A 3TUUA 3BSHA 3CM4A 3KRSA 1DJQA 4AXKA 1MW2A 1SMAA 3BK0A 4UR8A 3HIJA 3KFTA 3G1VA 1KWKA 4UQ9A 1J5TA 2E4TA 1F7BA 1JQVA 5F2IA 3L0NA 4LY8A 4FLOA 5CG7A 3S0CA 1MZHA 2VT0A 1KFJA 5KINA 1VS1A 1YDOA 3NGJA 2WV8A 3P8JA 5TD4A 4M7SA 3D4YA 4AYGA 3PM6A 3WY2A 5DLCA 7TAAA 4H8HA 2WKGA 2WPBA 3HG5A 3NXFA 4JCMA 2Y7GA 3QGVA 4K8HA 3W1TA 3S1WA 5K9CA 1KM1A 2OZ0A 4DXVA 2WQPA 1UH4A 2DZWA 3VCRA 3QMRA 2WPGA 4OJYA 1HTYA 3A21A 5F4WA 3VU2A 2V81A 3RK8A 4O17A 4CN6A 3FLUA 1OFEA 3ZOAA 1U33A 3O1NA 3N2MA 1VAHA 2NT1A 2ZCGA 3BH4A 5D03A 5LNSA 1T0OA 4MPQA 3LRKA 3VSVA 3QEZA 1KGUA 2Y88A 3QW3A 4JEQA 4GQRA 1VIWA 4W93A 2FPTA 1XDMA 2ZFAA 4UTLA 3R5EA 3DZ1A 4ATWA 1YXCA 1J0KA 1MFVA 1JG9A 4ICNA 3QH2A 1KWGA 3I68A 3N2XA 4CNPA 1CXFA 3CZLA 4WXZA 3FYPA 3A9IA 2OSWA 1I75A 4Y90A 5SWUA 4UTWC 4BFAA 3NQGA 3RFAA 4AWTA 4CCCA 3M5VA 3VFLA 4DO5A 1AMYA 3EWXA 1NM9A 4WSJA 2XIBA 1EP2A 1KM0A 3S5NA 3Q58A 4O19A 5F2GA 2BY0A 4YCPA 1BPLB 1PIFA 2A0NA 3QSTA 5BW6A 3WFZA 1LROA 3WENA 4P61A 5BOOA 2VC6A 3P7YA 1VLWA 4M19A 2A1YA 3S1VA 1M7PA 1AW1A 1SSGA 4DBDA 2YIHA 2ABAA 1RQEA 1OVDA 1JUKA 2B7PA 3DHPA 4AB4A 1HVXA 4QAWA 2OW6A 1FCBA 4JXCA 2F7QA 2YGYA 5LHEA 5I0DA 1JF5A 4HIBA 5HQEA 4MUZA 1CDGA 1GT8A 1BSIA 2H3DA 2VKZG 3N73A 3W1MA 4OE7A 4UC5A 4PCFA 3O07A 1NOFA 4N2YA 2J88A 4BWLC 4TVUA 4NJIA 4O10A 3L4UA 4Y8FA 1X8FA 4UMBA 3W7HA 3L4YA 3ZO9A 1QO2A 5E93A 3LTSA 1N8FA 4OU1A 1LLWA 1H7NA 3NO5A 4JR5A 4D2JA 3LERA 4TMCA 1VR6A 5DELA 1RVGA 4KMQA 2C15A 3UWYA 4KWUA 1QW9A 2E77A 2YSWA 1XGZA 3A4AA 1A50A 2V82A 4CN4A 1F74A 1R30A 1YLVA 2NX9A 5G2HA 1XBYA 1T99A 3W1QA 3HPXA 1XSIA 4K36A 2WSKA 2WSRA 4FIQA 3OG3A 4C1LA 1VCFA 3WDJA 3WNNA 1JXJA 1U2YA 1V7YA 1TMHA 2ZZ6A 1KBIA 2ZRWA 1XBVA 3C2VA 2YW3A 3QMSA 2GQ8A 4NI3A 1KV8A 1JVNA 3W84A 1MXDA 4LS1A 4AHPA 1LYXA 3NQVA 3TROA 4M6QA 2NUYA 5BMXA 4JFUA 2ZRZA 2V30A 4N4PA 1UH3A 1ICPA 1VC4A 1LWJA 3WDIA 1LRTA 3S42A 1P4CA 2R94A 2E6AA 1ZAIA 3LTYA 3L21A 1KFCA 4CGTA 1GOXA 2ZWZA 5AC8A 1XBZA 4DF2A 1M6JA 3PAJA 5D33A 5F4SA 1CGTA 2ZQ0A 3DENA 3HB9A 3AXIA 3BLKA 2QJHA 2RHGA 4NX0A 2VELA 5F2MA 4E0CA 1WQ5A 3D0CA 3G1XA 3OBKA 4ZQRA 3MHFA 1GJWA 4JFVA 1E40A 1KFEA 1AMKA 1QR7A 1KTCA 2Y24A 3LI0A 4LRSA 1EHAA 1HNYA 4FXRA 1LWHA 3WNLA 5A2BA 2DORA 1DL3A 5EY5A 1BVZA 2ZZ4A 3GR7A 4NX5A 2D0HA 5CLWA 3M43A 4C1KA 1PJ9A 2FHCA 4S1FA 1CGWA 3BGGA 4PFMA 4LXFA 1TPH1 4HNUA 1YADA 1SUXA 3ZR4A 2WC7A 1VHNA 2ALWA 1TYGA 3F03K 4NNBA 3DX0A 1H51A 4UTMA 3WY3A 2EADA 2JBMA 1RPXA 1X7FA 1WV2A 3M7WA 4FNPA 3TMQA 4IXHA 3G3MA 4IMEA 3GIYA 1KFBA 1XM3A 1Z48A 1FWSA 1I4NA 1GTHA 2G5WA 3N19B 3I7RA 2BXZA 1XBXA 4EF8A 1OYAA 5HWNA 3PY2A 4UFMA 5C5YA 3HGRA 4A22A 3ABSA 4NUWA 1DHKA 4NNAA 4UFJA 2J24A 1ICQA 3UYCA 1TIMA 1P0KA 2ZBTA 3BG5A 3QF0A 5C55A 1D7FA 3IGUA 5LNUA 2LLEA 2F7PA 1CXHA 4DQWA 4CLMA 1TQXA 4MKNA 1UKTA 1WYIA 1A5SA 4H6KA 1XSKA 3I7SA 1IXNA 5CZ0A 2E6DA 3VGEA 2ZZ5A 5DY3A 3M1ZA 3OVRA 4JD4A 1RZMA 1LP6A 2C13A 1ZCOA 4U33A 1LLZA 4MY9A 3WEMA 1HUVA 6TIMA 4UTKA 2FH6A 4LVBA 1UASA 4ZQCA 1CX9A 3K1DA 4R33A 3Q37A 3VX0A 5AYYA 3JR2A 2F18A 4A2RA 1G4TA 1QPQA 3BMWA 2XFWA 1ZJAA 3BG9A 3UNDA 1CLVA 3BVVA 4FLQA 3VSTA 3OLDA 5EA9A 1SZNA 1LRQA 3I7QA 1SW0A 1B2YA 3GZ3A 4MZ8A 5K9XA 3DDGA 3DHFA 3PBWA 1I2OA 4O11A 3TMLA 1SO4A 2YA2A 2CLEA 1DQWA 5CPLA 3ZT5A 2NUWA 4DPQA 1W31A 3L5MA 4MOZA 1VFOA 3OVPA 3IGSA 3SI9A 3W7KA 4PEEA 4WQ6A 5LZLA 1D3HA 4H4IA 3M5XA 1XKYA 5HULA 1JCJA 1NFBA 3BUIA 1G7VA 3LV5A 2ZZ3A 2DZVA 5E0FA 1JDDA 1SO5A 3C2EA 1QMLA 3C6CA 3W1UA 3ATYA 3JS3A 1T96A 1G9HA 2FJKA 3KLLA 3WDHA 1FX6A 4PTNA 1EA0A 4X9YA 3TONA 1Q4NX 3NM3A 2RDUA 1JD9A 4IGHA 4XZ9A 1Q45A 3O05A 1HTIA 2VFFA 3B8DA 4KKXA 1ME8A 1P0NA 1CGYA 1ZJBA 1F05A 3GNDA 3HPSA 6CGTA 1CIUA 2EQDA 1D3CA 3BLEA 1WOBA 3TU9A 4O1CA 4IJBA 4BA0A 2XIIA 2G3MA 3LHUA 6ALDA 3P5YA 4O4WA 3R8RA 3BW4A 4FLSA 2JGYA 3W2LA 3ECQA 3L4XA 1AVAA 1IIGA 2C19A 3O63A 3EKZA 1V3JA 2QLYA 3NQ8A 3LGEA 4H3DA 1W1ZA 2QUTA 4QISA 1FWWA 1W3TA 2C1HA 3PC0A 1R2SA 1TCMA 2HTMA 3UCQA 3DX4A 3MI3A 2BWGA 5D05A 3SJ3A 2ZZ7A 5D2WA 3DKJA 4YMZA 3CLWA 1W0MA 3DXIA 2X2JA 3ABRA 3G1DA 4ORMA 4UFHA 3OHIA 4DF0A 3PVFA 3CQ0A 2F7OA 4MJMA 3T7VA 1AQHA 2NUXA 4JL2A 5BRQA 3P8IA 1JCXA 4Q32A 4MY8A 3B05A 4O4VA 1I2PA 1U5JA 1IV8A 1A47A 5D2YA 1LTDA 4UTJA 3FS2A 4FLRA 2E5CA 3QQ1A 4GO9A 3HG2A 5G5IA 4GI6A 3TW7A 3S9YA 5A2AA 3MP4A 4ZQMA 2WCSA 2E6FA 2ZYFA 1LDCA 2YW4A 4LTSA 2I14A 3WK1A 2BX7A 3MJYA 3L65A 3KHJA 4LC6A 4BR1A 4WLCA 4NQ1A 1K8YA 4JTUA 1ME9A 1WX0A 1TQTA 2ZRYA 2TMDA 5DCEA 3T4CA 1TTJA 3IRDA 3W2JA 3PB0A 4JFSA 1A5CA 4UCFA 2Z6JA 4MZYA 4JICA 3BLPX 2FPVA 3KRZA 1JCLA 4X22A 3AO0A 4UNKA 1ZS2A 4NZFA 1X6UA 2NV1A 2QUUA 4I7VA 1OFRA 2BY3A 3PBYA 2ZUSA 3DC0A 3R2GA 2CLIA 3KX6A 3LCGA 5LGXA 3LCIA 1XH2A 3THQA 2XN0A 1KLYA 3KAOA 5G2IA 3UWVA 3R12A 1VGAA 2GVJA 3E0IA 3BGJA 2X1TA 1LCOA 1VZWA 1CGUA 3IK2A 3NEVA 1WDWA 3QZEA 3CWNA 4GFSA 4WY0B 5I3FA 4O53A 2CLLA 2FPYA 3LPOA 4JNMA 4B9ZA 5LNVA 1R33A 2A85A 4K8EA 1LBMA 2A2IA 3UG3A 3EDKA 2OYMA 3OIXA 3T55A 3FW6A 3BV4A 3WNPA 1Q6LA 2VRQA 2QJIA 3EXRA 3L5LA 2ZXQA 3D4ZA 2QJGA 3GXFA 1BF2A 4JTKA 1FBAA 1MW3A 5T26A 1GVFA 3GXTA 3NQEA 3G8EA 3W87A 4R7JA 4Z1AA 2DZPA 3PUOA 4Z1DA 4N6FA 1GPWA 4QNWA 1SFJA 1MVYA 3VNZA 2Y63A 1VYSX 1H3GA 1XFBA 3N9SA 2NXIA 2PRHA 1V3MA 1PZ3A 1EUNA 4A21A 3DFQA 3VMOA 3H54A 4RLIA 4H8UA 4LPCA 2X2HA 1JCMP 3BVTA 2BHYA 5D09A 4OIFA 5F2LA 3V75A 1JL8A 3L2LA 1LM1A 2VXNA 2EGZA 3DKLA 3GKAA 3VO0A 3LXAA 3KOFA 1OT1A 2H6RA 1M53A 2QAFA 3EWZA 1UKQA 3OLGA 5CZSA 4K6AA 5E6YA 5K3VA 1ME7A 3O15A 5CZJA 3TQVA 4EOUA 2OYKA 1JFHA 1HL9A 3IVTA 2F7FA 2W79A 1YDVA 5CGTA 3G0SA 3W74A 3DAQA 4E2DA 2VFGA 3MHUA 5CSRA 5MHBA 2H90A 2QKFA 4AMAA 2WVVB 2Y61A 1DKWA 3QRHA 3C56A 4E38A 2ZICA 3BC9A 2VUYA 5AC6A 3HZ3A 1OFDA 2TRSA 9CGTA 2FGZA 1B57A 5TQLA 2FFCA 2WSYA 3DX3A 1IIHA 2B7OA 2J27A 3NQ2A 1ZJIA 3T40A 1F6PA 4XBSA 3CPRA 3SSJA 3C2FA 5AFDA 1OFAA 3MMTA 5A6LA 1HG3A 3M07A 1ODUA 5AYZA 2YXGA 4M8UA 1PAMA 5LKYA 2ZWYA 2ATSA 3W7PA 3MI2A 4XQ6A 2DZUA 5IBXC 1HX0A 2NZLA 4LNYA 2EF9A 4LV4A 3HJEA 1QWGA 4U3CA 2ZUUA 2ZIDA 1SMDA 1V3KA 3MUXA 1B3OA 3FFSA 3O6CA 4FEZA 4N02A 4ZQNA 3MW7A 1XDLA 4GKLA 3JRKA 3FA5A 3ZFHA 3MI6A 5AC7A 3FIGA 3MYPA 3IJ9A 2PCQA 2WO5A 1VRDA 4UTTC 4IX0A 1S5WA 2BY1A 2EJ1A 3OLIA 3A22A 1IXPA 2G97A 1O4UA 3BW2A 1I2NA 3Q2DA 3THAA 4RXGA 4FHAA 3EJTA 2Y5EA 3EX1A 2EABA 3RILA 1IGSA 1YTKA 1LOQA 4OV4A 3UG5A 1S5TA 2WVVA 2P1FA 1WE5A 1RP8A 1MEHA 3PSVA 1UBSA 2ISVA 3W86A 1G69A 5F1UA 3II1A 2A21A 5HNRA 4NVTA 3IV3A 1LBLA 2WOQA 2ZX6A 3L68A 2H3BA 3TAKA 1JR1A 3CZEA 1O7DC 1ZY9A 2ZX7A 1MO0A 3IIXA 4GUGA 4LVFA 4O57A 1HFBA 4TX9A 2B4GA 1JGIA 4JFTA 4GWEA 3NPWA 4AHQA 2BHUA 4AIOA 2PRLA 3G1YA 2EAWA 3NR0A 3P84A 1RP9A 3P5ZA 3W7RA 1XH0A 3LHTA 1HWWA 1UCWA 1SO3A 1U83A 4GO8A 5EBUA 1TJPA 5KSWA 1OB0A 1WXJA 4TR9A 1R2TA 1G5AA 2VFEA 2GJLA 3TJXA 1CXIA 4GNJA 5A6MA 4E2BA 1Q3NA 1GZGA 2ZZ1A 1XCWA 5E6ZA 2CZ5A 1JI1A 5C2XA 4UTWA 3UZJA 2ZZ2A 4ZQPA 3TNOA 3LHYA 4PH6A 3H53A 3VGBA 3QYQA 1DTUA 1KB3A 5TIMA 3NQMA 3LBCA 1KCLA 5A5WA 4EWND 2G96A 4EF9A 1TQSA 4JGDA 5CZTA 4RV8A 2OYLA 3FAXA 2RDTA 3STFA 3TK7A 1H60A 4O0KA 2NV2A 1QPNA 3LPPA 4YLWA 4CKQA 5H2ZA 3HG4A 3ATZA 2AAAA 3M0ZA 1G6CA 3NG3A 5HXMA 2CZDA 3KRUA 3R13A 4O15A 4TO8A 3N3MA 2F7RA 1TPFA 3UXDA 3UWUA 1GJUA 1QNVA 4XTIA 3OLEA 2BZNA 3GK0A 3DI1A 3NQFA 4BWLA 1UD2A 4AYSA 3BCFA 1OX6A 1TTIA 1X1ZA 1GWJA 2DP3A 1UOKA 3M41A 4J28A 3T44A 1BG9A 4O50A 1S3HA 3SFKA 2Y7DA 1V3LA 4U31A 3SIZA 3NQ7A 3HGOA 3I6RA 2QUVA 3T78A 7CGTA 1ZFJA 3B04A 3BVUA 4J7RA 3E12A 1C8QA 2D3NA 1JUEA 4X2RA 2JK2A 4KWVA 4P2VA 4UTUA 2YX0A 3UPWA 2J6XA 1IZJA 4UZUA 5F7UA 2YOCA 2IQTA 1CGXA 2J25A 3GXIA 3ABOA 1OFQA 1R46A 1KXHA 1J0HA 5AHNA 5D2XA 4O28A 4OQVA 5BRBA 1M7XA 4GUJA 1SO6A 5HPOA 3O6YX 3V1PA 1OF6A 3CEUA 4JY8A 3Q94A 1D3GA 4GI8A 2E8ZA 3CZKA 4J3XA 3DI0A 5AB3A 5HR7A 3NAVA 1H7RA 2RKXA 4FB7A 1Z42A 5DBUA 1QI3A 3EDJA 3CU2A 1CPUA 2IGTA 5A2CA 1TTQA 2CHNA 4GI9A 1K8ZA 2VEIA 4O8RA 4LVGA 4MB1A 2FE0A 1DOSA 1KM5A 3LLDA 1OGSA 2GQ9A 4JTFA 3F1QA 4IUOA 1JDCA 3FJ6A 4PCTA 3WJXA 3CZNA 3VSUA 4J3SA 2C0AA 3PULA 4LOCA 5DBTA 3EXSA 1SU5A 1L6WA 3S5YA 2QCLA 2FYVA 1H7OA 3G24A 3VGDA 2Q8ZA 1I8JA 1IXQA 3G22A 1JI2A 1TV7A 5HR6A 3W2KA 1ZNNA 2C7FA 3BAYA 5AN7A 3HOJA 3NL6A 2FIQA 3PR2A 1OX4B 3W1XA 2YCEA 3C0JA 3W7DA 4AEOA 3TTYA 2FLIA 1M5WA 1UA3A 4OV9A 3DFTA 3AJXA 4O13A 5J5DA 1Q6QA 2D2OA 3GLCA 3STGA 1JJKA 2CZEA 4NJJA 3GDLA 2C6QA 2ZRVA 3W3OA 2TYSA 3W7QA 1YTEA 3W7LA 1TV8A 3KVMA 4GUFA 5D04C 5BNKA 4EVZA 1LBFA 2UV8G 2V5LA 3SGZA 1MWOA 2NLIA 3LLFA 3GDTA 2RFGA 1F2JA 2WNNA 4RKAA 3W1NA 4HKPA 1TREA 2PWGA 4HPXA 4MLJA 1VJSA 3RLVA 1MW1A 3W1RA 2YZRA 4PL1A 1W5OA 2V2HA 4NT0A 2QAPA 4ADSA 4DO6A 1CI1A 2D73A 1VQTA 4ZL1A 1JD7A 1WP6A 2YYTA 3OEXA 4UTHA 2FH8A 1HO1A 3TSDA 1YTDA 4U4MA 1D9EA 4O1DA 2E09A 4CQ9A 2ZXBA 4E2OA 3W7NA 4Z0JA 3FEMA 2DU2A 4CN1A 3LXCA 3B0VC 4GQQA 4NZJA 4JN6A 1FWRA 5D02A 2DIEA 3E49A 1K3UA 4DBEA 2VNCA 4NXSA 3O8AA 4O16A 3W1LA 1FXPA 4OT7A 4PSRA 3MHGA 3VM7A 1JXKA 1AG1O 4RZ4A 3DFPA 2X1UA 3BUPA 2VRKA 4OKDA 4UIOA 1DHPA 1EPXA 1HO4A 2GJPA 2QCCA 5DN1A 3A47A 3CZGA 1FCVA 3BMVA 1K7EA 3MP5A 4AEFA 4K39A 2RDWA 3VNYA 1H1ZA 4J3VA 3SW6A 1EA9C 2CXGA 5J5RA 3GAKA 3ZR6A 3IIZA 5F4XA 3PBUA 4JTIA 3EJPA 5FEXA 3B0PA 3EX3A 4YWIA 4FIRA 2XVKA 4X9SA 2ZA3A 4HNVA 1UUOA 1W5MA 4DELA 1QFEA 1XCXA 4HOWA 5K4ZA 5AHFA 3LTPA 4CQ8A 3BO9A 4N9BA 5E70A 4K38A 1KFLA 4ONVA 1EUAA 1W5PA 5DCBA 1H7XA 1T8XA 3W7EA 3BUDA 3UD6A 1GVRA 3CWOX 1RQHA 1BWLA 3TW6A 1B4KA 2P0OA 2QMJA 2CWNA 4QM1A 5BRPA 2J9XA 3TOPA 2A4AA 4JCLA 1KA9F 1BAGA 4B9YA 1JIBA 3S6DA 4UOQA 4JTLA 4NJKA 3PUEA 5U4NA 4K37A 1WAUA 2WVSA 3EEGA 1EEPA 4N6EA 1N7KA 3GKFA 4I7WA 3VGHA 1JRBA 5TBOA 3BVJA 2WNZA 3IGXA 1PE1A 1H5YA 1QHOA 3BLFA 1EH9A 4YCOA 4RR4A 5HWMA 4O52A 2PWFA 1S46A 2QPUA 1UD5A 1Y7VA 3L0KA 2EKCA 3L66A 4PC8A 3G3DA 4AW7A 1GVSA 3E9AA 3EWBX 5KZDA 4WX2A 1Z32X 3HG3A 4J9JA 1HT6A 3EWYA 4QJ1A 1EX5A 3VX1A 5EKYA 1GG1A 1L9WA 1TV5A 2VR5A 5AYXA 2RH9A 3DFSA 1QOQA 3WFAA 1JULA 1WZMA 1WBJA 2GJRA 3W76A 2WJZA 4NJHA 3RLUA 3PUDA 2GQAA 4OGZA 2VFDA 2C8NA 1LZOA 3S1XA 3W7JA 2QF7A 3TAOA 3LHWA 4FX6M 1QO5A 4GJ1A 4JYEA 1KGXA 2DH2A 3ABQA 1NF0A 3PBVA 2ISSA 1O5XA 2WNQA 5IM51 1KLZA 1J2WA 3K30A 1QCWA 2B0MA 2JKEA 1DQXA 3U8GA 1G94A 1HL2A 3PB2A 4LRTA 2FB3A 4UUIA 2DH3A 1PIIA 3CEPA 3QC3A 5EL1A 5FF2A 3A5VA 5I3KA 2NXGA 2A6NA 1WZAA 3MP3A 5D30A 1RQBA 3FJLA 3GB6A 3A6OA 1QAPA 4KFPA 2EO7A 2JKAA 4GRSA 4H2CA 3N34A 1BVNP 4JFWA 3WN6A 3M9YA 1MXSA 1L6YA 3MYOA 3BLIA 2EHHA 4ADUA 4ALDA 1OK6A 1PL9A 2Y7FA 2WKJA 2D0GA 1XUUA 3VI2A 2V9DA 3KL3A 2QCMA 3G1AA 1WA3A 3G1FA 1EB3A 3GAYA 5DY2A 1TJRA 5G4WA 1P5BA 5AOUA 2NWSA 3U6WA 1VHCA 2F61A 4J3WA 2FTPA 1KFKA 1MW0A 2QCFA 4XKYB 3E02A 2E6YA 4HNTA 4Z0SA 3NPVA 1G7UA 5HUPA 3GDKA 1CW2A 4QQ3A 3L4VA 3W71A 1PHQA 1UJPA 3W75A 2BSLA 2WNWA 4JTHA 3BVWA 4FO4A 4HT3A 3KEHA 4JIQA 1XSJA 4GINA 4CCDA 4AF0B 3BUBA 3AXHA 1U30A 5FEZA 3PWAA 3UY8A 4U28A 1W9XA 4RX0A 1TQUA 4HSNA 3VM5A 2KZHA 3NL3A 4MLRA 4NJGA 2Z1BA 3UWWA 1VFMA 5G2WA 2JKPA 2XWDA 2WVUA 1KM2A 1MEIA 2YR1A 4LU0A 4WZHA 5ABTA 1SR9A 3WK2A 1OHLA 2W0UA 4RK8A 3VMPA 1JRCA 2Y70A 3SECA 1QPRA 3W70A 3P60A 3CT7A 1UKSA 5KZMA 4UQDA 2ZUWA 1G4EA 4PA8A 1FCQA 4GUIA 2CLOA 3GTNA 4J3UA 4FNTA 2J9YA 4PCSA 1VCGA 1W5NA 1PVNA 3CHVA 4ML9A 2C18A 3SGUA 2CFFA 3LX9A 1YDNA 2PC4A 2A7NA 3EDFA 1TPVA 5D2VA 4HOZA 3DFOA 4O1BA 2GVYA 3GXMA 3M6YA 2TAAA 1JCYA 2QDGA 5AHMA 4XKYA 1EIXA 2F1AA 3HBLA 3G18A 4UFLA 2X2IA 3M47A 3LRMA 3M44A 4O0ZA 3NZ1A 2BY2A 4DO4A 3B4UA 4OHQA 2ZX5A 3W2UA 1SPQA 1TPUA 2OW7A 3DFNA 4JDBA 4WOQA 3UG4A 4ZQOA 4NXKA 1W3IA 3TA6A 4JS3A 1LRNA 3WNMA 2GJNA 4Y9AA 2D0FA 1HXKA 4JTSA 4O14A 4WY0A 2QR6A 3IIOA 1GYLA 2BHZA 3WJYA 1NSJA 3IJ7A 4A3UA 4IPIA 1XL9A 4KFOA 4JYDA 3LXBA 4IQLA 3VNDA 2QDHA 1VPXA 3QQ0A 1I45A 3ZWSA 4BK9A 3GBDA 4GUHA 2E5DA 5FF0A 3W7MA 1TQVA 3INPA 1VLIA 1K7XA 2ZUVA 4MJZA 3TQKA 1G4SA 3IVSA 1JAEA 4M7TA 3TSMA 1MFUA 3C52A 1DV7A 3TV8A 3W37A 3IEBA 3W85A 2GPTA 2ISWA 2NXHA 5DXXA 3SR7A 2C14A 5IBXA 2GOUA 3S8HA 1OFOA 2Z6IA 3QM3A 2VFHA 2H8XA 1JDAA 3TIMA 2NX1A 3WK3A 1CXKA 3P62A 2YJQA 3L4ZA 1EP3A 3EJUA 3TFXA 3A5FA 4IXXA 1UA7A 1E3XA 1SSDA 5KITA 1GVOA 1QPOA 4UQAA 1KCKA 3EKLA 3BAJA 5CPMA 4WXYA 1GEQA 1UUMA 4BF9A 1S5VA 3QW4B 2PWEA 4YL2A 3BUQA 1FY6A 3P80A 3UY7A 1NF7A 1TPC1 1V5XA 3W6YA 1RPKA 1F6KA 3VKJA 3W73A 3DX2A 3PSWA 4CCEA 3FOKA 5KMYA 4YXGA 1GG0A 6TAAA 5G1YA 2V2CA 2OMAA 3W38A 3VGGA 8TIMA 2EACA 2WVTA 4M5PA 3UPBA 4ADTA 4HPHA 1XCFA 5D2TA 5G4EA 3TR2A 3W7CA 3UZ5A 1PZ2A 3LB0A 1O60A 1F76A 4Z08A 5LGZA 3OVQA 4WY0F 1ALDA 1ZAHA 5FI8A 5I3JA 1J0JA 4LQ1A 1OK4A 2FHBA 2H8ZA 2F2HA 2X1SA 1BTMA 4A29A 3TC7A 4UZSA 4WUIA 5FEPA 2E1DA 4K7VA 3S5ZA 3G1SA 1QPKA 1KBJA 4JL1A 1TQWA 3UXAA 2QV4A 4N9CA 2AAMA 1FWNA 3W72A 3A24A 1J4EA 4Y6GA 3AJ7A 3STEA 4MFEA 4IMCA 3UWZA 1W54A 3GYEA 3NA8A 4IX2A 3TKFA 3CPUA 5AHIA 4N9DA 4XUGA 5HINA 5K7JA 3EJQA 3KWXA 1MSSA 1ZAJA 4JX5A 3VMNA 4O18A 2B7QA 2D3LA 3AMLA 3E96A 4CNNA 2OT0A 3D51A 3VGFA 4POCA 4HPJA 4UFKA 3SZ8A 5KEZA 1O5KA 3CLMA 4IMFA 2OSXA 2YA0A 4RJEA 3U2OA 4WOZA 1VYRA 5EPDA 4IWWA 3O16A 1OABA 4GBUA 1CGVA 1W8SA 2E5BA 3M5ZA 4JY9A 2QMKA 2X2GA 3ZT7A 2Z1KA 2WSQA 3LRLA 1L2UA 4X3ZA 3TFCA 3FAWA 2O7SA 4LV9A 3ELFA 4LUJA 3TCEA 5LSMA 2CLHA 4IPJA 3WY4A 5I3HA 3FKRA 1F5ZA 3GDMA 4BI7A 3NQ6A 2ZTJA 4Q33A 1FDYA 3KLKA 1PPIA 3WMSA 2QCHA 3FKKA 3SY5A 2DZSA 3WNKA 2Q3RA 3ANYA 3N14A 4GIAA 1XC4A 2E9BA 3RIKA 3P61A 1G67A 2NT0A 4X0NA 1QWNA 3WJWA 1TPEA 5I3GA 2DJXA 3L9CA 4TU1A 2O7QA 1SFLA 3W07A 4ZZ9A 5LNWA 2BXYA 3BG3A 3L2IA 4W9TA 1JF6A 1VJIA 2HS8A 2XWEA 1VB9A 4OBTA 1DORA 1R75A 3TJLA 1GCYA 2GUUA 3NZRA 5L9FA 4AVFA 3UWQA 3NDOA 1BWKA 2XVGA 4JTGA 3WJSA 3CIXA 1J0IA 2QPSA 1TCDA 1L6SA 4Z1CA 3EX6A 5A8GA 5CPOA 3HPZA 3NQAA 2ZTKA 3DDFA 2Y6ZA 2VOMA 3KVJA 1A5BA 1FDJA 5HWJA 3IVUA 1O94A 3NPXA 5D32A 1OFBA 3IJ8A 3DBPA 1AW5A 1H7PA 5I24A 1XD1A 2WSPA 1TQJA 4UNIA 3P81A 2ZA2A 3GXPA 3ZS4A 1QW8A 1ICSA 4UR7A 4JIPA 3GR8A 4R34A 4FF7A 3G0XA 1R2RA 1GVIA 3USBA 1A5AA 3L4WA 3G1HA 3S5OA 4UNLA 1EWDA 2FQIA 5FF3A 4IOTA 2CZFA 1PS9A 3CV5A 2HSAA 5AHEA 4O54A 1EO7A 4UXDA 3W7GA 5K9DA 1Z41A 2R91A 4L4LA 3W2MA 5H91A 2CLKA 3L4TA 1RR2A 2DZXA 1UD3A 3L2MA 3LDVA 3HMJG 4DF1A 1AL8A 1XD0A 2CLFA 3BARA 5CGQA 1UH2A 1OF8A 4BI5A 3P82A 1XI3A 3W83A 1KXVA 3D52A 5I23A 4RXFA 1HL8A 1CXLA 1DBTA 4BZYA 1SZEA 4WSKA 3BPWA 3LHVA 1YPIA 1TSIA 2VENA 1B0IA 3NYZA 1VH7A 3EB2A 2ZXDA 3DH7A 3UERA 1CXEA 4HP5A 2V2DA 2ZX8A 5I5RA 5D38A 3CTTA 1UD4A 2YDAA 1KXTA 4AAJA 3NVTA 1AK5A 2Y85A 2C3ZA 4UQCA 2ABBA 1DJNA 3CTLA 4LS0A 4KWWA 2Q8LA 1NVMA 3DU0A 5CSSA 1WO2A 1IF2A 2E0PA 1L0PA 1Q6RA 3BAIA 4UMCA 1XUZA 4JX6A 2V8ZA 3LCLA 1G1YA 1JCNA 2V0TA 3DGRA 5DO8A 1GTEA 1YXYA 3MBDA 3LI1A 3K8KA 1OSEA 3RF9A 1OX4A 4EIVA 2ALDA 3C3NA 5CGMA 1P6WA 4PEKA 3KVKA 1RD5A 3A23A 1ZENA 3F4NA 2C16A 1F73A 4FNQA 1LOSA 2VEPA 5K4XA 5C54A 4UCGA 2QCGA 4UMAA 1Y0EA 4JX4A 3MWAA 4ZVJA 4A2SA 1NAL1 4CNOA 3P74A 2WKLA 3DHDA 1A53A 3BSGA 5FEWA 3TXVA 2PRMA 5C6MA 3HGSA 2NX3A 3RMJA 3F4WA 1MXGA 4J3TA 4QSHA 4B5NA 2EAEA 1XV8A 5FF7A 2Y89A 3GNNA 2DZTA 5E0KA 3NQCA 3B0UX 2CPUA 4QIUA 1PCKA 1ZALA 1SW7A 2X1RA 3W22A 4NU7A 3HGJA 3ZSTA 1Z44A 2E8YA 4FNRA 4LS2A 4NNCA 4UQEA 2ZE0A 1H1YA 4I9AA 3ZR5A 5L6UA 1TB3A 2B7NA 3WELA 1TPDA 1QI4A 2QCDB 2XN1A 1KTBA 3QFEA 3D50A 3RNDA 4IMGA 3IIPA 4GC4A 1AQMA 1WPCA 4M56A 1TTPA 2A7PA 2ATMA 4IMDA 3LM7A 3GXNA 2Z0IA 5HJLA 4KFNA 3C2OA 4JYFA 3TH6A 3DX1A 2DJLA 3C8FA 5E1QA 2F84A 3EDEA 4RCXA 4CVWA 1WBHA 2EPHA 4R53A 1H63A 2CW6A 2V3EA 5BMWA 3EXTA 1W5QA 2VEMA 5EYWA 5GVJA 1K8XA 3KXQA 4Z1BA 3O06A 3TX9A 1O95A 5CXPA 3QPYA 3TSBA 1LOLA 4BI6A 2OJPA 3C61A 2Y4SA 1KBKA 1KTNA 4N4QA 1IZKA 4MZ1A 2FDSA 1YXDA 1GVQA 2OSYA 1UB3A 3BLBA 1C9DA 1ONRA 3PG8A 5G1TA 1SZFA 1QX1A 3L67A 2ZDRA 1PEZA 3LV6A 3GX9A 2TSYA 3B03A 3KL0A 4JTJA 3S1UA 2PURA 1PV8A 2E68A 1MEWA 4MYXA 1I2QA 3CB8A 1H50A 3UEQA 3BW3A 3NL2A 2P10A 1QWUA 4WJEA 3M5YA 5DCDA 1BLIA 3EDDA 3NQDA 4U2YA 5HUOA 3QSRA 3WY1A 4U2ZA 1G4PA 3CIWA 2W6RA 4LT9A 3EJRA 2NSXA 2QCDA 3ZWTA 3L5AA 2BLEA 4XWUA 1FXQA 3BVXA 2BTMA 2YFOA 1FDZA 3W1AA 2I1OA 1ML1A 1QDSA 2FB2A 3AMKA 3EWUA 4Q4KA 1UD6A 3PF3A 2GVGA 4FMVA 1YPFA 3TC6A 3DHUA 1P1XA 1H62A 3TTSA 3M16A 4AMWA 1DVJA 3W88A 4DPPA 2BXVA 5CPNA 3UQNA 2YKKA 5HMSA 2ZX9A 3BAWA 2R14A 4FX8A 4UFIA 3HO8A 4PSPA 1FCUA 4UOZA 1M7OA 2HMCA 1N55A 1KBBA 4AHOA 1VYPX 5I3IA 3WNOA 3W2NA 5KZEA 4ORIA 3GVGA 4GXMA 4RZ5A 1K7FA 3LHZA 2CLMA 2YYUA 3C4UA 1KGWA 1BKSA 3LCHA 4FX7A 3CC1A 4WF7A 4MYAA 2AQWA 1SZGA 1X1OA 2Y62A 4HSOA 4XB3A 1IXOA 1KM3A 3W7IA 4JDYA 2G95A 5CLTA 1GQNA 2CU0A 1FUYA 3ZQ9A 3ZSSA 2PWDA 1B4EA 1LORA 5D37A 3LCWA 4I7UA 1PCWA 3NM1A 3WJZA 3NPUA 1W37A 1W56A 3N9RA 2EEXA 4LVAA 3KVLA 4MFDA 2HS6A 1TO3A 2XVLA 5FF4A 1OYBA 4AH7A 1GYNA 1OJXA 2TPSA 2A6LA 4QITA 3C2RA 2DIJA 5AHLA 4H8VA 1WZLA 2X30A 4TMBA 1R34A 1TRDA 4HOXA 3L0GA 4M6VA 1YYAA 2AMGA 4L4MA 1QOPA 4PODA 3BAKA 1VFUA 2V5BA 3HQ1A 3LOTA 2ZA1A 1R47A 1NEYA 1OFPA 1AL7A 3YPIA 3QMTA 3P67A 3BCDA 1KM6A 4CQAA 1TPB1 4AWUA 3LCFA 2PE4A 1KW1A 2JGQA 1BEUA 4DEFA 1K03A 3RU6A 5HDRA 3HJZA 4J27A 3GXDA 3KE0A 4AIEA 4LWWA 1H7WA 2GUYA 5DFAA 3GDRA 4K7YA 3G0UA 4LVDA 3W23A 4WD0A 3WEOA 5DXYA
chains in the Genus database with same CATH superfamily
3VXSA 4FNSA 2OMZB 5DLMH 4JPQA 4MWFA 4HS6B 1KN2H 3KZPA 2VC2L 4BH8B 5JIQA 1Q6OA 1PS3A 1HDMA 5AW7B 2J6VA 3LN4B 4N5UA 2CG0A 1MY5A 1PIGA 4FXTA 1YYMH 3WLIA 1E9LA 2BGNE 3FT2B 3TF7C 5FUZH 4FERA 3ZE1F 2YWZA 1RIHL 3PIQA 3G08B 2WCAA 5C0ND 3CUFA 2V3FA 5CAYB 3BPNB 5IMKA 2XWJA 3OKOA 3JWDL 3H42L 3GHUA 3GBEA 4KX8A 5FLVA 2APVA 1A4KA 1DVSA 4AL8H 5FO9B 2FX8H 2ICEA 4ATDA 4Q7NA 1K1YA 3EA1A 4XUYA 2YFNA 12E8H 2XN2A 2PMQA 1NC2B 4RW5A 1THFD 3WK0A 4J3ZA 5BPPA 2XTSA 3DRQB 3RXZA 1GGCH 4G83A 4ODXB 3MCLL 4MA7H 4LY8A 2VT0A 2X4PB 3J7HA 1VS1A 2V37A 1U58A 5DJ6B 3RBGA 1NGQH 4ZMZA 3GZKA 4O4YL 2WPBA 4IOFD 5JLZB 4P5RA 3QGVA 3N11A 2GGEA 2YDSA 5E2UH 3REVB 2Y0FA 1H3PH 1G7QB 3Q8FA 3UJEA 3KPPA 4NAEA 3WIQA 3IDGA 4GQBA 1RJRA 3QEZA 1AZUA 4GQRA 3UAJC 1XDMA 4AVIA 3S96A 3DZ1A 3AS0A 3I68A 4QPEA 3CZLA 3QJSB 1EBHA 4YHNB 3KLHD 4FFTA 4F9LA 5CINL 1MJUL 4JY5L 3S37L 2HJPA 3I6GA 5FACA 3WFZA 3WENA 1KYFA 4W9HC 4CC4A 3VTMA 4DBDA 3ZM8A 1BVKB 4TUJA 2UZYA 5HQEA 2GABA 1CDGA 3W1MA 4P2CG 5DRNA 3SDXF 1QNZH 4AGOA 3U30B 2J88A 5GGSA 4BWLC 1S7UA 4KO6A 1QR1B 2FMNA 1IT7A 1KCRH 4TMCA 2A3BA 2DV0A 4CN4A 5GS1A 1OF2A 2DUZA 2WSRA 3WUGA 1WMNA 2Y2TA 2WIIB 1JXJA 1U2YA 4QHUA 3AUOA 3BISA 2GQ8A 1JVNA 4JNZA 2CBIA 3LEVL 5DSCB 4MHHG 4RLDA 2NZ1A 1TJXA 1P4CA 3KBNA 3S9IA 1FBIH 3DIFA 2XX1A 5KSVB 5B1BB 5EFDA 2CESA 1ACZA 3JSSA 4X98B 2PYEE 4OGXH 5A95A 3C8NA 3OGVA 5GIRA 1TQBB 4MQTB 2Q86A 2BIQA 5L4IA 1UWYA 4ZS7H 1E40A 4PGLA 5JQ9A 5CCZA 1MRFH 2PYEB 4TUUA 4P4RB 1BX2A 2N1KA 4J1UB 2Z92B 2YPVH 3MMWA 4I5BB 1HS6A 3GEFA 3CS2A 1SF5A 4XIAA 4XP1L 3AQYA 4HWBA 1WV2A 1SOKA 4G9DB 4I0PD 4MM1A 4NO3B 3O8XD 3ACTA 1N67A 2WW0A 3KTCA 2J24A 2FLMA 4D7PA 3E5PA 1CG9B 1VEPA 3QQ3A 4AX6A 4ISVA 5C07D 1OCRB 1WYIA 1NBZA 3KR3H 4PLJD 1IXNA 1HSBB 5J13C 5H2BB 3L3DA 4IJCA 4QGYA 1GZPB 3UEZA 3Q37A 4HIEB 5HYJD 1EC9A 4S1QH 2D69A 5K9XA 1FWAC 3DDGA 1K72A 4Y8EA 2IANA 1DBAL 1RUKH 5CPLA 2R9HD 3TA9A 2NQ3A 3UDWA 2WLKA 4MOZA 1TITA 4N0CC 3BUIA 2PXYA 4JDZA 3JTTA 1PKNA 4C7GA 2WW5A 2H32H 3WDHA 4PTNA 5DHEA 3VWJD 4DW2L 3KCJA 3MLZL 4M7KH 1FHUA 4AH2B 4U1GC 2YBUA 3WHXB 3S3SA 4H2AA 1W72H 5CJ5A 4BUQA 4Z7QB 1IIGA 1EEZA 1R3WA 4MKMA 3HE6A 3O63A 1N7ML 1G7PA 3ARED 2YD7A 2OJEB 3LGEA 1FH8A 4R7NA 4Z77A 3KG5A 3FVMA 3EAKA 3I84A 4MJMA 1E2ZA 2NUXA 2WQDA 2KI6A 1A47A 3QXWA 4MDJB 3VXTB 4Z7WB 4UIKH 4OV5B 3NZ8A 4AV0A 1Y5WA 4AUJA 3CAVA 3IJQA 2ZKWA 3MSPA 5D1QC 1RK0B 1LDCA 3HZYB 1N59B 2WLHA 2WUBL 3CHRA 2YWYA 3B2UD 1RKRA 4LC6A 1R5VA 1A5CA 4PY7B 3EJYC 1EJSC 3OR6B 3AO0A 1AH1A 5CEZD 4LE8A 3RVVC 4HMNA 4IU2A 4TLKA 3M0KA 1BYOA 4WKXA 4QD2E 3FMGH 2HX8A 2WGXA 2GVJA 4HPYL 5T3XE 1LCOA 4BKLB 1CGUA 1PZSA 3B4NA 1KBPA 4PG2C 5SX4H 1MDLA 3UG3A 3KPTA 1OAYL 4YR6A 4EIBA 4KNSA 3L5XH 5B7MA 3FW6A 3L5LA 2ZUQC 1M1BA 1GVFA 2FX7L 5F7KC 3FUEA 1NEZG 2HFGH 2QQNH 2PABA 3KPMB 4GQ9H 3DFQA 3QUYB 1YDPA 4JPVL 4D0DA 1OZQA 1GYWA 3RIAK 3NACH 3K71B 1EXUB 1QBLH 1ERNA 3KGTA 1ID5I 4IDJH 1PTAA 4OW6A 3IVTA 2F7FA 3APCA 3WDPP 1WQVT 3FO0L 2ARWA 2VFGA 1W9DM 1IC1A 1KB5A 2H90A 4F7PA 2WNGA 4PJIF 3BEVA 1NSUA 3QB7C 1HMWA 3CX5J 1W5ZA 7FABH 2G60H 4E68A 1WUFA 3T40A 3RVXD 4ZO7A 1HG3A 4AYMC 5AYZA 5DC2A 4LCCB 2PSNA 3BZEB 1IIIA 4FQCH 2D7OA 2QHLA 5BVJB 2ZIDA 4FS0A 3MW7A 2E1WA 2AJZB 5MKGB 1OZTG 1G87A 4C91A 1ZXKA 3OLIA 2FJFB 5I0WA 1WMOA 2X3CA 4WFFE 4OV4A 3HC3H 5A6JA 1KKRA 4CNTA 4NVTA 1I8AA 3PPCA 3BAEH 3IGFA 2OSLA 2B4GA 5HI5C 4I18B 1U92B 1K6QH 3BN9C 1HWWA 3DMMC 5MP6H 2HT3C 3SY0B 4AWJC 3PPHA 4I88A 2VQ1A 1VP5A 5IF0B 43CAB 2FB4L 3E0WA 4OFCA 2WZPD 1FIGL 4M6AA 2CDEB 4Q8MA 3Q6GH 3C2AL 1KTDA 5JXQA 3G5VB 4PH6A 3PABB 2GJ6D 2CO3A 2SEBB 4HK0B 4JZNB 4EF9A 1TQSA 4OFVA 3OWEA 1IAIL 2REQB 1SJDA 4UV4H 4HKXB 5LNEA 4ZMQA 1TPFA 2OX4A 2EH7H 9RUBA 2AQ1A 4K71C 4R6UA 2OLSA 3ARDC 2BSED 2WZEA 1BQRA 4X4KA 5DT7A 5B80A 1I3GH 4HXAH 2YBRA 3S5SA 1UOKA 4OQTL 3NFNA 4J28A 4AIZB 3HGOA 4LBEB 7CGTA 4L4VD 3OZ9H 1D6ZA 3ENLA 4R27A 1JUEA 3PZTA 1DANU 1VFFA 3CH1B 3GMNA 4UTUA 2C3HA 4R26H 3TZVC 3UNTA 2A3EA 2NV9A 3LMYA 5FA3A 3STLB 3ALWA 2XCMC 5CLYA 3AIWA 4IU3A 1EYEA 2JF6A 5I15L 1XSOA 3VCNA 1EEYA 4O8RA 3A4FA 2VLJB 3OGCA 3KWTA 3NEXA 1JDCA 1WV7T 1WKEA 3QXUA 4HD9A 4LSSL 5I18L 5K69A 1XL4A 1QNSA 5A43C 5J13B 3TJIA 1JI2A 1I82A 1IGWA 5HR6A 4WGVB 1OX4B 1UJQA 5D9SB 4JFOB 5C0CE 3TA3B 3BOLA 4U1KB 4KQ3H 5C0CB 3VOGA 3KH3A 2V9TA 4TSCH 4B5WA 3LLFA 4MNGE 1O5QA 3CVHB 2GIXA 2XSAA 2KPNA 1VFLA 2VW6A 3Q45A 1KUMA 4K5OA 4NQCA 1HI6A 5I1KL 4X8GA 3ZKSD 2V7NA 2OG9A 1JWUA 1XCQB 3VXMB 2QSCH 1LO3H 4BM7A 2X0UA 3TN0C 1XLLA 3OVUB 1E4WL 2R1YA 3A4DA 3AHTA 4HN8A 1WAEA 2CMRL 4U1GB 3UR8A 1FXPA 1XZWA 4MNHA 4PJBF 5CSUA 4M3KB 3BUPA 3LSOB 1EPXA 1HO4A 2GJPA 1FG9C 1FCVA 4WCJA 1K7EA 3FSAA 1NMAL 4XB8A 2PDIA 2QHRL 1NCTA 3UJJH 5CSYA 3IIZA 4WWOA 2F53B 1IGTA 3BGAA 1ZA6A 4Y2NA 5T1DL 4EZLA 1RAMA 3KNBB 1NPUA 1AI1L 3APFA 1B1YA 5EU6E 3EWCA 3K74B 3UTTE 1B4KA 4I9TA 5D1QB 1HGYA 2YD0A 3QRBA 4XXWA 3BD3A 4CNIA 4ZI8A 3MN8A 5A7BA 3G6LA 2OKMA 4A2GA 2VJXA 4KO9A 1H5YA 1DLFH 4FTVA 1GOMA 2DPKA 2VXSH 4JHAL 4P3DA 4RESB 4LGRB 4KRZA 15C8H 2V2WA 3ZVHB 3MRQB 3S1XA 3ARZA 4GMSH 1Q0XL 3GS7A 3WKYA 4DVBA 4PB4A 2Z9TA 1B2WH 2CHXA 5CP7B 5HYQB 1IBBA 4GRMA 3X1BA 4EE9A 1ESWA 4NJAH 1PIIA 5I1IL 3JV4B 2NXGA 4JW3A 2EZ0C 3AXLB 5DQDH 2WM0A 1AH4A 4L8CB 1UR0A 5F7FA 1Y5VA 5G4WA 3ZDXF 1Q94B 4YNYB 3V3WA 1UQSA 4TULH 1BV8A 3RCYA 1E6ZA 4FO4A 1TJMA 4WW1A 4ABUA 4JKPH 5FEZA 1RJPA 5EO0A 2EICA 2GZXA 4C4KT 5LCVA 3UWWA 4G2AA 2XWDA 3RL2B 4XO9A 3B83A 4PWKA 4O9HL 3W11C 1JF1A 3GU1A 3BP7B 1IT9H 2AABH 4GW5A 5EG6C 4QG9A 4NJ9L 1FNGB 3V4UH 5BOEA 2P5NA 3RCNA 4PCSA 3DX9B 2NX5E 4KGLA 3OKYA 4URKA 1FNLA 4P23D 1QFPA 5EBLA 2WLNA 5JHDD 2NX5B 3H6AA 5GGQH 5JXED 4M1DH 4NEHB 4IBQA 1ZVSB 2BFVH 4DYJA 3HW7A 3BX7C 3ULUL 1V3IA 5ESQA 2YX9A 3GKWL 3GVRA 3MVTA 1AGCB 3WNMA 4HUKB 3HZVB 2JWYA 4NM4H 2NY7H 3CZJA 5E9XA 1VKFA 4YBQD 5AW1B 1V7NH 1OD8A 2E7LC 4LPYA 5C92A 4FL4B 3N91A 4RE4A 4HXBL 4ZMVA 2GPTA 3DMMB 3DV4A 3FFDB 2B0SL 2V63A 2LAAA 1TKWA 1O9ZA 4JN1H 3TIMA 3QKZA 3P62A 1PSCA 1E3XA 1TV4A 2PTWA 7XIMA 1JPST 1GJIA 3OM3B 4ZOBA 4KUCD 5HYSB 4RGNE 4F2BA 4YL2A 1KJ2A 4J8QA 2QADC 1NF7A 3RX9A 5HJ3B 4BZGA 1H11A 5FJPA 1AXTL 2V5KA 4RGNB 2CHWA 5IVZB 2EACA 2VAAA 4GSRA 4N24A 1EJVC 3ABZA 4CD8A 2IPTL 1FHLA 3CU7A 4DUXA 1ITBB 3VGAC 1V08A 1ISYA 3RWFB 3ULUC 3NFPA 2K4WA 2HJFA 3BE1H 5KZCB 1NEZA 3ALFA 3KXFA 1XLBA 5BYWA 5I1LA 4YXLH 4WUUB 2CRZA 3AJ7A 4N2KA 3D2UA 3TZVB 4YHKH 3NA8A 3CHXA 4IX2A 1BD2A 1OD9A 3OX8A 4RE0A 4APQA 2CHRA 4XSMA 4Z2HA 5E2TL 5JXAH 5IHUH 3BRGC 4NO5A 5SWSA 3BKJH 2CQTA 3KYKL 3GG1A 4IWWA 3SE8L 3K0WA 3EG9B 5FKPA 2NQJA 4JY9A 3AAZB 3MSDA 1A0CA 2PTYA 3STBA 3ELFA 1W0WA 3N1PC 4OECA 3EA3A 4P46A 2XWBA 3WEBA 1TPEA 3SGJC 5E0QA 3IJLA 1S5HA 5FUCC 1D5RA 5J4MA 4LMQI 4R4ND 3HVNA 5DRWB 1EZ2A 4BK4A 2GHWB 1IU1A 1A1NA 5I1GL 3C60B 3F7PC 3CVBA 3J27A 2ZTKA 3EFDH 2VOMA 2JJTA 4WAFA 6PCYA 5K39B 2R69L 1HVQA 4FX5A 5I24A 5EUOF 1A4CA 5H94B 1WFNA 3B7SA 3GR8A 3K6SA 1Y1UA 3TL5A 4ZW5A 4GY1A 5I1EL 3USBA 4J2PA 1AOZA 2CLZB 5FF3A 3FQ1A 1DN0A 4PRPD 4KFDA 1H6EA 2A6KA 1Z41A 4XAZA 1N2RB 3DVFA 3PNUA 1UENA 4XVTH 4OI7A 1X44A 4NKDB 1YY8A 5I23A 4ONGH 3DH7A 2OQJA 1RURH 5D7JD 3UGXA 4IS6A 2EXTA 4UUJA 3N42F 4D1JA 5CSSA 3MV9D 1BYAA 4QHMA 4LLDA 1DVFA 4M7LT 1M05A 2H9AB 3QUGA 3ULVL 3GIZH 4KNQA 5DRCA 4AWEA 4MSWB 2DS4A 4PEKA 2Y5QA 2C16A 4IOIB 3ARQA 5C7XH 3O3UN 4KBPA 1SHMA 1MXGA 4KI5C 4QLJA 1IKNA 2AJUL 2CPUA 1JNLH 1CICC 3N6YA 3SRHA 3ZSTA 4G6FB 1V10A 4LSUH 4X42A 2R23B 1QI4A 1KTBA 1UB5A 3IXTA 4IMGA 2JIXA 1RXOB 4G70B 1IAIM 1VGEH 1TTPA 1KQYA 4PRBB 2J4WH 2A3CA 2VXTL 4FF9A 4G1MA 2P8LA 2ESVA 4RCXA 2CA4A 2DIBA 2CCWA 4X6DE 3GHEH 1DBJL 5H4ZA 4WJ5A 1XYMA 1D2KA 1JPMA 5ANHA 4NZRL 1LOLA 4LALA 3RJDA 2J7BA 2Y4SA 1XIWC 2FDSA 4JO2L 3VJ6A 3PG8A 2EXWD 4GKSA 3QHOA 2FZ8A 5HBFA 5BRZD 2FCBA 1T5KA 1IGMH 2JK5A 2XPZA 4CVXB 1H8NA 3EDDA 3NQDA 1H8OA 3ULVC 2W9EL 3N55A 1J7VR 5EPMB 4G9PA 1GTFA 1HXYB 3LYEA 2OQYA 4W6YB 4QR6A 4F9DA 1K3IA 3L3HB 1BQUA 4MBOA 2BK8A 2WAGA 2DJ4A 5I79A 4JM4L 3B1UA 4JG1H 4L1TA 4FRWA 2VCBA 5E8OA 4XN2A 4ZBCA 5AUMB 1RLDA 4UTBL 4HNCA 3LCWA 3DVGB 3K13A 1USQA 1OAQH 4X4YA 1W56A 1K6WA 4X7SL 1BQ5A 3DNKA 3C8KB 4S3EA 2HG5B 5TQ0L 4P57A 1ES0B 3L0GA 3O4LD 4L4MA 4AZ7A 4PODA 2V5BA 3GC2A 2A9AA 3T3ME 3PNWA 1OVZA 1LJYA 3QEQD 4MMZA 2FTYA 3LXUX 3ITTA 4C4BA 4MXQD 4XX5A 3EPOA 5I19H 5DJXB 3B06A 5U7SA 3FSWA 2BVYA 1PSKL 5EO9A 3XINA 5EU3A 3BP4B 3B34A 2QCEA 1MNSA 1MHEA 4RFOL 1EP1A 4JANB 5LIUX 1W3YA 3E8VA 4JMXA 2HTKD 2RB8A 1RZFH 4R96B 1KG0B 3LIZA 1JPTL 4AD4A 2E7HA 2PP7A 3ZTCC 4ZDHB 3K8LA 3WMQA 5D71L 1DEDA 2IUZA 2Y2WA 2QL1A 1K02A 2E9LA 1X5KA 2DWXA 3W3BA 1GR7A 2QVTA 1FQ0A 5J9PA 2JB6B 3F58L 3U2JA 2NY0D 1VCVA 1D5MB 4G8GE 3ESVF 2R8WA 2WQAA 3TBSB 4FAMA 4WGHA 4NWTH 4ZBJA 5DUPL 2OZ4H 2QCNA 4L4OA 2OR7A 1JRQA 2F1BA 3MNVA 4K07A 4F20A 2A79A 5ITBH 1QSFA 5CWSA 3AWEA 4EI6B 3N4EA 4ZMXA 2W27A 1NWSA 1QSEA 1MMYA 2BVOA 3T6QC 4GRWE 2DQJL 3V0DA 1EHLL 43C9B 3IFPA 1I0BA 2XNAB 5AYQA 4K3EH 1CB2A 3LD8B 5TPWL 3WY2A 1UWXK 4OIIL 1PCSA 1BZ7A 1SYSB 3PWPB 5CPSA 4E41E 2BW4A 5JMDA 35C8L 3V6FB 3QDJA 3QXTA 4P8WA 5LNSA 4QE5A 4MPQA 3OKKB 2ATPB 3WJJC 3MY9A 4JFZL 4UTWC 2W91A 3CK0H 4X4XB 3ZDWA 2D4FA 2O9RA 1XB8A 4Z18A 3Q2NA 1MMUA 4KKNA 2AJVH 3GW0A 4M19A 5E4OA 3G5XA 2I17A 3ZRSA 4G5DA 1MZYA 2DMGA 3JZ7A 4FEIA 3H7UA 4KPLA 1MHPH 3QFDA 4H9UA 3WQWA 4WWKC 4YK4B 3C5SA 3WN5C 1UXWB 3LKOA 4O10A 4Y8FA 1R3JB 1TZZA 4PLOB 3L4YA 4X6CF 2F19H 4JHVA 2BWQA 4IRZH 4L5FH 3TIDA 4JR5A 3AOFA 2W9DH 5BQ7A 4N6RB 2AV7B 4GIPD 3BDKA 4Y9NA 5FKAB 3CDFA 1T99A 4C6BA 3HPXA 1XSIA 4LSVL 4PJ8D 3WFHA 2W0KA 2XSKA 1A6ZA 4F0MA 4C6KA 2QZQA 3QMSA 3CPLA 3W84A 5AVUB 3EYSL 1J0NA 2IAAC 2GSGA 3ML8A 4PYGA 1ICPA 1LRTA 5C09D 3JWNG 1IGCH 1L3NA 3DHMA 1L2QA 4LB4A 1TG8A 4K55A 3HBPA 2CQSA 2IBZX 3SYAA 5D33A 1CGTA 1TWIA 1QAKA 3QJQB 4Q4EA 3CE1A 5SWQB 1U42A 1OCBA 3GMQA 3Q1SL 1TR1A 3VACA 2WBJC 1GYVA 2FJHA 4PZVA 3WNLA 5I7GA 4U1JA 2P49B 4HUUB 1CICB 1NOLA 4W6WB 5EF0A 3VD7A 1W2ZA 1K6AA 2WKOA 4KF1A 3TP4A 3MCG1 4YEEA 4DNMA 3MOQA 2POTA 2D7TL 2AJ3B 3M7WA 3MJGX 2CJUH 3TYAA 4IXHA 2V6AA 3KW8A 2DWEA 5HWNA 4Y9EA 4H2HA 1FFQA 1F4XH 1I1FA 1Q1JL 3ROOA 4HJJL 4AG4H 4ZO6A 4DQWA 1CEOA 4J6RL 1FI8C 2E6DA 1U8QB 4KUCF 2ZUMA 4D8AA 2ADGA 3DKHA 4GC3A 4U6VL 3OJ2C 5HHQA 3VI4A 3MA7B 1MIEL 3L45A 3BANA 3RY5A 3KRBA 2QVMA 5I1CH 2COVD 3FONB 3LOYA 2C1PA 4BWUA 2E40A 4G80A 3SI9A 3IFOA 1ADQA 5CN1A 5LIKX 3U57A 1JCJA 1NFBA 1G7VA 2ZZ3A 3EFOB 2O6FA 3W1UA 2MNJB 1GS7A 4TQTA 1ZSDB 5GZOD 1KJ3L 5LO7A 4KCUA 1ITUA 2ZOKB 1S7SB 3T5WA 3KPQA 1E15A 3AU6A 4X61A 2IKGA 3NN8A 4EBQH 3W81A 1S7VB 2NR6A 4FG6D 5E8NA 3N15A 1LGVA 3FUFA 3AQUA 3LKQB 4M00A 4XMKL 4H04A 1PYFA 4TXEA 2PD9A 5IMMB 5EZIL 1R85A 3LYRA 3HR5B 3L9RB 1B3JA 3B5HA 1U5JA 4APXA 1X1IA 3E9TA 1LTDA 3VXSE 2OL3A 4P06A 3GRGA 3GFYA 5IB5B 3HRZC 1QA9B 3NOYA 2OXHB 1J86A 5C97A 1XIEA 1RMFL 1PWLA 3DYOA 1K8YA 2HDJA 3HN8A 5IVXE 1G9NL 4LU5H 4ZFCA 3WQ8A 3T4CA 2Z0UA 3VTAA 1E4XL 4TUKL 5HGHA 5IVXB 2NV1A 4I7VA 1OFRA 4QXUL 2YXOA 1Q7MA 1OCJA 2ZUSA 2C1IA 1KEGL 2E6JA 1A5OC 1AGBB 3P2DA 1ZBKA 3NBJA 2RALA 1WZ1L 3H4XA 4EKXA 1J1OH 2FPYA 5D7LD 5LNVA 4K3DH 2YAQA 2CO7B 4UT7H 4K8EA 3N04A 3RWEA 3BV4A 2ZXQA 4JN7A 3D18B 5TJWK 1J10A 3UMNA 4KEUA 2GHZA 3TBYA 4QJ4B 4HF5L 2HK1A 1IVWA 1H15A 2A77L 5F9DC 4H1LG 3CN1A 1HWGB 1F58L 3X3YA 1O0VA 4H8UA 1MZRA 2UVFA 3OZLA 5LYRA 3T8LA 4HIIA 3NJKA 1M53A 5I74C 1KJMB 1B4JL 1LUCB 5PCYA 2O26U 2W9MA 3CO8A 3RY6C 3VFNB 5FJJA 4ODSL 2GBAA 3GZPA 3LM3A 1G9NC 3WXWL 3QRHA 1I1CA 4O1FA 1QR4A 4L1SA 2UY3A 1SQ2N 4HQQH 3ZQWA 3VFSB 1UM4L 3MRKB 1BBJB 4J8RB 3NTCL 1YG9A 1OALA 1VFAA 2VM9A 2Y5JA 2PF6A 4OJAA 2RCSL 4LBSA 5F7NC 4ZG1A 3MRFB 3ZFHA 3FV9A 4Y4HA 4GBXB 4YWGL 1VRDA 2BNRA 3NFUA 4ERGA 3US9A 1W9BM 1IXPA 4LYKA 1TJGH 5ERWA 3OAZK 3D9AH 1OTSD 2GK0A 4DUOA 4CSZA 3PSVA 4NN5B 3CV2A 2LE9A 4HK5A 4PJXA 1Q9WA 4WWKB 5DK2B 2BCKB 2BS8A 1KDJA 2BHUA 2PFHA 3GMOA 5L8KB 4YXHL 3B9NA 3P5ZA 2EYTB 4DGUA 3MJ8A 1SYVA 1T83A 5FYKD 3IS0X 2F6KA 4GNJA 4E2BA 3BPNC 4JIIX 3UGVA 1HOCA 1N7PA 2BVPB 4X80H 1LEGA 5FYJH 3WBYA 5BW7A 1KB3A 2J75A 3MV7E 4EWND 3STFA 1BF6A 3O81A 4CKQA 3HG4A 1CZ8H 5DYOA 2IAMA 3N3MA 2F7RA 3UXDA 3UWUA 4Q4PA 3IMHA 3LMJH 1BVLA 2X0VA 2WZSA 3WJLA 1SFDA 4F27A 3I75B 3RBSA 2WW8A 1GWJA 3ATAA 4OUEA 5KZ6A 2X4UA 3UR7A 4QTIL 4URIA 4FS9A 2P5ED 5I1HL 4GVFA 2GUOB 3UCCA 1FRGL 2PLJA 4IKIA 3SQMA 3CFNA 2FZDA 4F37K 2WBJB 3SYQA 2MOGA 2X0HA 3JUGA 2ZWLT 5GJMA 2IFGA 1YUHA 5D2XA 2JEQA 4PTUB 1UT1A 3OKNB 2WXRA 1C3FA 1LK2B 4H9ZA 4JTAA 3VI3A 1WAAA 4Y7EA 1NGZB 3EDJA 2Z93B 1B4RA 4K5MA 1EX0A 3MV8A 3WH6A 3C2YA 4H8PA 3O2LA 2J7EA 3DOHA 5HHVL 4F3FA 5EC1B 3IMSA 2QCLA 4G6KH 2Y5TA 2BDQA 2HBXA 3U30C 5HDBF 1FVCB 4X7CC 5E2JA 2IANE 2D2OA 2JLPA 4DYEA 2GL5A 3S3JA 2FL5B 1UUNA 4HCDA 1O6TA 1PU4A 2JKSA 5PTDA 1ORSB 1TREA 4HPXA 4DBUA 2PTTB 3W1RA 3VWKD 2B1OA 3C08H 1J0MA 1PMYA 3PQYD 4PJ7E 1IO4C 1T3FB 1D9EA 4L23A 1OIFA 1H19A 4PJ7B 1B6DA 3QZ6A 1JTTA 1IRAY 4BA8A 1I9IH 5D7IB 4Q8OA 1ZE3H 1TQBC 5HD8D 1IEQA 1TVDA 1BWMA 3TNBA 4JQ3A 1JPSH 1B3WA 3K0YA 4IP5A 3WLSA 5DEZA 3CXHK 3S0PA 5DVPA 3K2IA 3VCLA 1AQKL 4EDXB 2HZGA 2EXYC 3N3EA 1Z0MA 1LO0L 3ROLA 2XN9E 4KDTC 1SLUA 1A7QL 4FOUA 3MNWA 4PJ5D 4RMUA 3S6DA 3HRZB 3W6LA 1MI3A 1KB9J 2XN9B 3HMXH 1N7KA 2XRAH 2WNZA 4O52A 2G30A 2X53A 2GJJA 4C54A 4TN9A 2X6VA 4WX2A 3HG3A 3BWAB 4NQSB 4HH9B 2QT3A 5ICXA 3U6RB 1AVKA 3S6OA 3RLUA 4OGZA 1CUOA 3X13B 3WFEH 4WEUD 5F96L 2EUVA 3U7AA 5FJUA 2WNQA 1O5XA 4WKFA 3AYSA 4I77L 4MG4A 4PPTA 4JAWA 2XTLA 4UUIA 4Q7BA 5TE4H 4XR8C 3BQVA 4B50A 3SKNA 3SKMB 3A6OA 4GRSA 1U8OA 1SY6H 4YHPB 2BNQE 3FHQA 4Q2ZA 5LJYH 4ALDA 3S98A 1XUUA 3G1AA 4GIOA 1AC0A 1KN4L 3UAFA 3UH8A 1U8NA 1VHCA 4U3HA 2XJ7A 3D07A 2O5ZH 5T3XL 4N2IA 2ZUYA 2B2XL 1U30A 5I74B 1WBYB 4B7IA 1MI5D 1I7ZB 3SSZA 2PDNA 3GS0A 1AGEA 5GS0L 4Z0XB 1DDHB 3CUPA 3MVIA 3SBQA 3AU2A 2HH0L 2FYMA 3D0VA 4FNTA 4J3UA 2JKLA 4RNHA 3G6AA 4HOZA 3DFOA 2KLTA 3HMCA 4KS0A 3A4XA 2X4SB 3WF4A 3QEHB 1P6BA 1P7BA 3FDGA 3IS1X 3O3DA 3QDGE 4OZIF 2LABA 4PUMA 4UBPC 4DO4A 1JHKH 2YAOA 1ORQA 4WNQB 3EOTL 4GI4A 1FWXA 3AQZA 1LRNA 2R2CA 1JOVA 4DJFD 4D0BB 4JYDA 4G42B 4M8QA 2CISA 2DYSB 1AGFA 4XPGL 1M6OB 4BK9A 2XVNA 4WGKA 4G6MH 4M7LH 3AXXA 1JAEA 4ZZKA 2HUHA 1P1MA 3IEBA 3MREA 4TRPL 5E5MB 5DXXA 3LZQA 5IBXA 2DQCH 2G2RA 4C6DA 2YCIX 5DEGA 2BBFA 4LUYA 4HWEH 1JDAA 4NP9A 5HJDA 4QLWA 5GS0C 3ZUCA 4ZFQA 3LZ5A 1GOIA 2IXUA 1RUAL 4QRUA 4PV1C 4XHJD 2VRJA 1ACYH 4BF9A 1S5VA 3CC5A 3QUYC 5FHBH 3VNIA 3L1GA 1SJHB 3W6YA 3W73A 4YU1A 4NQVB 3QDEA 3K2GA 1A4JB 5HQMA 4E9XA 4HPHA 1HXMA 3ZVVA 4NQXA 2HFEB 1O60A 2E28A 1HJXA 5EO1A 3NJHA 3C5JB 3QUKA 5DK0A 4WUIA 4NWUL 1NAMH 4H1LA 3A24A 5F9JA 1MRDL 3QUXB 5D1ZA 1JZGA 1X5YA 3NIDF 4LCCC 3EGXB 3GHRA 2MKLC 2CIQA 3QJHA 2XSXA 1ZAJA 3AMLA 3V9FA 3OGOE 3D51A 1BFVH 4POCA 3RPKA 3ZRFC 5IOPA 1KGYE 1W8SA 3F7QA 3M5ZA 2C1OA 5INDB 3QFJA 5FV2A 4QRQA 1R3LB 3IFLH 3QHFH 3S35L 4Q33A 4F66A 4MAYA 3V0GA 3P61A 5D8JL 2DJXA 1P7TA 4I18C 4FXJA 4RE3A 4W9TA 3TYEA 4LEXL 4NQDE 1DORA 3PWJA 1MWAL 3KGUA 3KDNA 4AVFA 4FOKA 2HAZA 5KTEL 4B5XA 1IGYB 5JIMA 2FEJA 4NQDB 1LQBC 1QW7A 5CPOA 3DDFA 3WLKX 4GPNA 1XXFC 1AW5A 1EK3A 4OJFH 1QTSA 3SCMB 1XC6A 2N0MA 3KPLB 1ICSA 1CYWA 5D96C 3PZMA 3S2JA 4H7CA 4JHWH 2OJZH 1GVIA 3SD2A 4L9LB 5KANI 2CZFA 1OY0A 1A6UL 3CVHL 4CD6A 3UYOD 2F6UA 5LIWX 2CLVA 1P2CB 1DBML 4BZYA 4WSKA 4UMGA 4HP5A 1N5YH 4S1RL 4NRYB 3HQOA 1KXTA 3KLAA 4J3OG 3ME0B 1XGRA 3MNZA 1HHJB 1G1YA 3VNMA 5EOQL 5ICZB 3WA3A 1P48A 5AAMC 1FH5L 3VQ2C 4EIVA 4US5A 4CD4A 3FN0L 1LD9A 3P0WA 2VEPA 2F5AL 2UWEA 4PCPA 2FATH 4YC2B 4H5SB 1F6AB 4GISA 5HMFA 3WLTA 3PWVA 3TA3C 3LZNA 1JZIA 3RKPA 3HKZA 3FJNA 1HJCA 1T7WA 2YLLA 3ZR5A 3S88H 3CCHA 2QTVA 1CF8H 2FDMA 3IIPA 1QBAA 4UDUA 2IBZY 4X9HA 4XP5H 3W7TA 2E3VA 3C8FA 4LP8A 4K0OA 1YAIA 5A16B 4QDWA 2FFIA 2AEIT 5K59E 4OD2A 1KYUA 4U1LA 5D6DC 3TX9A 1DCLA 3C61A 4DZ5A 1YXDA 2V9RA 2VMEA 3QULA 4BFKA 1OARL 4ZMOA 1MUMA 5HK4A 1ONEA 3ZL2A 4PJGF 2WW3A 4JZ5A 2GDUA 4ICWA 3O3AB 2W67A 3GTXA 3HI7A 2F68X 4WO4A 4ZUSB 1N82A 5EZJB 3RTLA 4DJDA 3PF3A 5LA1A 4TF4A 2YPVA 3QWOA 3BZ5A 4NB7A 1M7OA 3WE1A 5C3IA 1MQ8A 3WNOA 5E9NA 4IBYA 1T1ZB 4Y0GA 5LNDA 4AX7A 1MCEA 2FSEA 1KGWA 1JYNA 4FX7A 2XJLA 4MYAA 4DP9X 4XB3A 1KM3A 4ODUB 2R0LL 4NNPH 5CLTA 2BODX 3QAZC 3NZUA 2WDAA 1PCWA 3MRCB 1NCHA 4LVAA 4GHRA 4IHCA 2YD3A 3EOAB 3SDDB 1TO3A 3EJZD 1UZGA 3PFMA 4X5QA 1XH3A 5I2IB 2X30A 4P07A 3TTQA 2AMGA 2WQRA 1OEZW 4L48A 4ONHA 3CVIH 1VFUA 1XGYH 1TVBB 3YPIA 1NS2A 3RJXA 2GUBA 1ISZA 5B7EA 3UTPE 2XY1A 5DFAA 1Q8MA 4HEMA 3I3BA 3VFRB 3IAQA 3MLVL 3MRIB 2CNCA 1WCBB 2ZRXA 4G1NA 1UFUA 2ATKB 5FESA 3QG7H 1EJUC 4GSDH 5DMIH 1MQRA 4LKXB 3HF3A 1C5DB 4KTGA 1TA3A 4XBEL 4N86A 1OSPH 1TPWA 4IRJA 3QRLA 6REQB 4WV1C 1W72A 2OCZA 4A3QA 3M0XA 3VZZA 4OWGA 2EDTA 1L6XA 5EORH 3QJAA 2WWKO 3SPJA 4O2FB 2JV6A 1MAJA 3TO4A 2DYPB 1E43A 1ACXA 3PUUA 32C2A 4MUPA 4HKBA 1GHRA 3RWHB 4YJZL 2OQHA 1KXQA 1MVUA 3FUDA 4Z7NF 2P5WE 5L2KD 3CV7A 1YPZA 4M62H 4UTTA 3QCUH 4HK7A 4DGVL 4TKWA 3L5HA 3F5WB 3PF2A 4TVPE 2P5WB 2O6CA 3HC4L 1A3LL 1UOLA 5LHFA 2YAHA 1CD9B 4JRFA 1HP5A 2UZ9A 3KD4A 3BSHA 1BA9A 1DJQA 4PW4A 5ILTL 4ZA0A 2IPFA 2YPLE 1ZGLP 5IHLB 3WLNA 2PDWA 3WIHL 3KDOA 2E4TA 1JZ4A 2FGWL 2E7FA 1FL6B 4FXFA 3ARSA 3KWUA 1GQJA 2Z0BA 4FL4C 5K9CA 1SFTA 3IDMB 5A2LH 2VKXA 2IH9A 3CBKB 5C1MB 3GK8L 4ZX5A 1SZRA 2NT1A 2ZCGA 5D03A 3MUUA 5D2NA 5EEXA 4AQAB 5C6TH 1KM0A 3VFMB 3WLHA 1KCZA 4AGNA 4LYQA 1YMHB 2V5CA 5BOOA 3F7KA 1RHFA 2BRPA 1CBVH 3TT1H 2YSTA 1OQFA 5D96B 4RGNC 3W27A 5LGKA 5LGHL 5FSEC 1WA1X 3IE4A 5DMGC 4Q58C 1CDBA 2Q10A 4LNCA 4JM2D 4PCFA 4DP8X 5C9WA 4KK6C 2BSDA 3IRPX 3P30H 1RIUL 4DOHE 3CMJA 1IIKA 4GY0A 1H7NA 4KRLB 5LAPA 1QUPA 3GSWB 4U6HB 4DOHB 3CFDA 2W81C 2V2TB 3M8OH 5G2HA 3WUBA 4F58L 3C9NB 3P3UA 3QV8A 3WDJA 1B3XA 4Q4IA 4JFPB 4KKCC 1XBVA 3OJGA 4NI3A 4K94C 4LS1A 1V05A 4C6QA 4FP1A 1KLFA 3X2QB 5FYLD 5ESAB 1UH3A 4RDWA 2DSVA 5F97E 3FQTB 4GIEA 1MWAB 5E6RB 4JJ5B 1EUTA 4H0IA 4YYCA 4DF2A 1CU4L 1U22A 1DVZA 2PCFA 3WLOA 2RHGA 4IRSB 1MPAH 3AALA 1CWVA 3USZA 3QWRD 1EMTL 3WMCA 4PFHA 4W81A 3US0A 1P84K 3WGUB 3MOAH 4LHJB 4Z7UF 4JO4L 3GNMH 4X5RA 5A6BD 5ABEA 5IHZA 2ESVE 3C60C 4FNPA 4K1GA 2AK1H 1C12A 3HHSB 3WX7A 5AW2B 1XLCA 4MNGB 1TIMA 3QTPA 1QRND 4N3TA 4L29A 5LNUA 3OMZA 5E6IA 1IC5H 2VR6A 3TPUB 1QNOA 3VGEA 4Y4KC 5C9UA 1MFEH 1UJ3C 3M1ZA 5IW1B 4Y16D 4UTKA 2FH6A 1GQKA 1R5IA 5B8CA 1L9RA 3FZUD 3CQFA 3BH8B 3BIBX 1XIHA 3GVVA 3WD2A 2VDRB 4PBWD 4UINH 4HG4J 2AQRA 4QGCA 4RW3A 1F4YH 3GZ3A 1E9ZB 4O11A 2YBGA 4NP4H 5AAPA 2ON3A 1JK9A 4DPQA 5IB4A 1WHOA 4PJ9D 3MCOA 5HULA 2AHIA 1JDDA 1SO5A 3C2EA 3Q8EA 3WD4A 2CO6A 2BSSA 4HZLA 1FX6A 4ILSA 2DQHL 2GTWB 1TX0A 3IWUA 5EU6B 1U2CA 1CGYA 4O51A 3UTTB 5CEXA 3GNDA 2EO1A 2J57A 2CJSA 1KPRA 1B5TA 3QAZB 1ZTXE 4NKMB 2CBJA 2VDMH 1RPUA 5D4HA 2I60H 1W3TA 5JHMA 1TCMA 5FB8B 2R1NA 2J8HA 3DX4A 3K6IA 3PL6D 5DC9B 3ZKMD 2IFFL 2JELH 2KERA 3OHIA 1W91A 2F7OA 3CQ0A 4X5WA 4NKIL 4O4VA 4OZ4B 4PGEB 3AQDA 5CGBA 3ZKXB 3QQ1A 4IPLA 4GI6A 5T5NG 2V8MA 3S9YA 3IGAA 5E8EA 1R3IH 1FHDA 2BX7A 4U3XA 3SUSA 3W0KA 2CUAA 4R85A 4YDZA 4R5VA 3GSOB 2CHOA 4A7QA 2FZ3A 3W2JA 3PB0A 3DSFL 3VIJA 4AUUA 3H2WA 2AITA 1JCLA 2WYZA 3N2OA 4WV1B 3UWVA 2CXEA 5T8IA 5L9DH 4KVNH 5G5DB 4GEIA 3MRPB 1EZVY 2PDGA 1CTOA 5SX5K 4XXCA 3EDKA 4DZ8A 2PDJA 2GITA 2OYMA 5IB1B 5D4IA 1TCRB 4CVZB 4NQTA 3MBEB 1GAFH 2WYHA 3HFML 5EBMB 3T6WA 5LBSH 1R6VA 4PCKA 4OU3A 3CQKA 3PUOA 1QSFE 1RW9A 3F84A 3KHOA 3LRGA 1AANA 1BZ9A 3WF3A 4AISA 5MEQA 4N2CA 5M17A 1R24A 3UBXB 4A4AA 2NXYB 5FO7A 1WA0X 4DF9A 1D5IL 2JXMA 4NBYB 1X7IA 2R4SH 1I8KB 1PYWB 2JKIS 4QXGH 3FO2B 4YDIH 4M03A 3THUA 1FAKT 1YMYA 2YMXL 4F1SA 3FU7B 2EIBA 3STPA 1E42A 2ENYA 3HZ3A 3KCPB 2GW5A 2WHJA 4OF3A 4IGBD 1AXIB 4JMNA 4RA0C 3VRJB 1PAMA 4OZHE 3GSNA 3W7PA 2AXGB 1NCWH 4OZHB 1UZ6E 3FIGA 1M4KA 4JG0L 4CADA 4YSUA 5EUKB 2C4FU 1SVDA 4JTDA 5AVTB 2I7SA 3LG3A 3D8MA 5HYIA 5JW5B 4FPSA 2DJSA 3L68A 1YPXA 4H01A 2ZX7A 2ZOTA 2K7QA 1G0YR 4OLVH 4LVOB 2MQGA 5CAHA 4PE8A 2DMCA 1GZGA 4X2PA 2KZKA 3QYQA 4FQ2L 2BW5A 5CA3A 3H70A 3KGRA 3KZ8A 3BDBA 2RR3A 4JLRA 4K5NA 4GH7B 2V5RA 1PD1A 5ITFA 2H0JA 4MAVA 4GEJA 2D1WA 4FYSA 3P3YA 4NRZB 3LD8C 3WTUA 3VH8B 3U4KA 4G7EB 1HQRA 2ZOUA 4ODWB 3EYFB 1L6GA 3O7UA 2HNHA 4RAUA 4G7YH 5KSBF 3EF4A 2HCVA 1H41A 5DEFA 4UU9B 4P5MA 4E42B 4PBGA 4GRLD 1PKLA 3SKOB 2X3BA 2H6PB 3MWXA 1AO7D 3QHZH 4LAOA 3OB8A 4O28A 1M7XA 2J47A 5JUEL 4XB7A 1IBGH 3N0PB 3DX7B 4NT6A 4JBSA 1W1VA 2YS4A 3HAEB 4O5LL 2HPMA 4N8UA 2ED8A 4LFHG 4XTRC 1ZQ5A 3VI4E 4YVPA 4Y4KB 1UJ3B 5DHXB 3VGDA 4HQVA 1C08A 4M6OL 1UOZA 2Q7YA 4PW3A 5AN7A 5CBAA 3OTTA 4IQHA 4YK4C 2OLAA 1S3KH 1SGKA 5J6HA 1XYZA 4O13A 2AZAA 1E9OB 2CZEA 2WMPA 3AADB 2TYSA 4AZCA 2Q6WA 3HV8A 4FI4A 4K7PL 4PRHE 1F2JA 4PS3A 2RD0A 1VGKB 4HKPA 1C5CH 4MLJA 2YZRA 1W5OA 5K1NA 4PRHB 3T6ZA 3TN4A 4UOW1 3ITOA 3Q2CA 4Z2KA 1TQCC 4W9ZA 3FQNA 3W7NA 4P4KD 2JKWA 4P2RA 4JN6A 4IFRA 1K3UA 4ZXBD 1NCNA 3O8AA 4XC3H 3QEGH 1Z66A 4KFEA 4AE1A 2DI9A 3V2AR 1OCWH 3E6HB 1R7AA 3GINA 5IBLD 1EA9C 3CXDL 4FXLA 1F4HA 4B5SA 3DURA 1FZMA 4Q89A 4CVUA 1MG2C 3LTPA 5FA4B 5E70A 2W5PA 1W5PA 5B1KA 3B6SB 1HYSD 3W7EA 3BUDA 5E5UB 2ZCHL 2J9XA 3JUYA 1BAGA 3QIUA 1JIBA 2B77A 3BH9B 3FCTB 1U93B 1D2OA 2EDHA 7REQA 1Q5MA 1GVSA 1GHFL 4NRXB 4J9JA 4X6DB 2A6JA 4JJHA 1SVCP 1FWJC 3FH8A 1QOQA 2GJRA 2OZTA 1Q66A 4IKJA 1ZLVK 3TAOA 5DHYB 1QO5A 4GJ1A 1Z5HA 4JYEA 4ES4A 4JM2F 4QFUA 1IFRA 5HHOA 3P4LA 1G94A 1HL2A 2WW2A 4KI1A 4ZW6A 3CN4A 4NRSA 4MD0B 4ODTL 1WBZB 2AFNA 3W01A 4PJHF 3V8CA 1E0XA 3VA8A 2X10A 5KBNC 3BT2H 1R3HB 3FTSA 3MUJA 2EIJB 2OO0A 2VXVL 4ZW8A 4QCIB 5LG1A 1VPOL 3WUWA 1GQLA 1SJMA 3JTSB 1U8MA 4AF0B 2NTFB 1F45A 4WI3A 3QDME 3NL3A 4JQVC 2WXJA 3PCYA 2WN2A 4XNQB 5IBUG 3FTVA 3QDMB 1QPRA 4MPKA 3OZPA 1K3ZA 3MJ7B 4YBHA 4E36A 1KSIA 3QC5X 3BUYB 4GUIA 1TPVA 5D2VA 3T3MB 2Y9RT 4XVDA 4R0LB 3MCYA 3PAZA 3ALAA 1IX2A 5ISZA 4WJXA 3SQLA 4S0HA 3M47A 3M7SA 1XYBA 3HI5L 2BNRE 3SDCC 1NCJA 3RGTA 4EPEC 5A6AA 1JNHB 5IR1B 1TPUA 1OKEA 2WLZA 3TEVA 4EV5A 4NXKA 5IJVA 3E5BA 4FCHA 1PKQE 4JO3H 2MCG1 2EE3A 2OO6A 4LRNH 2C5DC 2YHGA 4MDOA 3VNDA 4PJXE 4HH8A 1PKQB 3MSGA 3QQ0A 4I5XA 3MTRA 3B0XA 2JB5H 1ZHNB 2P52A 5HGBB 3TSMA 4MQXD 5EB8A 3VQMA 4JEJA 1QNQA 3QVQA 3EAUA 3HNSH 3L7EB 3W85A 4G8AC 1X5GA 1HN1A 3F65A 4OUOA 3FFCD 1V7XA 2J3SA 3G6JF 2NX1A 3H2AA 4G8GB 4IXXA 3DETC 4FQJH 1SM3H 5CPMA 5AW3B 3SX1A 2EIKB 3D0AA 4NAMA 2Y07L 1IAKA 2XV6B 3QW4B 3U5YA 4O0QA 4TOYL 4F8NA 1AZ1A 1KT2B 2I85A 4NC1E 4JZJA 4W9FC 1XCFA 4XWGL 3WLBB 1SN2A 3BVDB 3VXQA 3NK3A 2ADFH 3SGEI 4WY0F 4GRWB 4DBWA 5ABGA 2X1SA 2DW6A 2OCFD 4FR1A 4XZNX 1QPKA 1HKIA 1KYAA 3O6LH 2OWXA 3VFCA 3LAFA 1JN6B 5DS8B 1V51A 1G1OA 4E41B 1W54A 3Q5YA 3CPUA 5G55A 5E00B 2WJEA 1HKKA 3E96A 4PREA 4CNNA 3GJFH 2NQLA 1O5KA 3F6JA 1E1CA 4BSJA 1NM4