4FNRA

Crystal structure of gh36 alpha-galactosidase agaa from geobacillus stearothermophilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTAAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELMYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 230
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnrA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnrA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnrA02
3HG4A 3BAJA 1BEUA 4LRTA 5T26A 3TAOA 5DBUA 3IVSA 5AHLA 4QAIA 4E2OA 1OYBA 5CPLA 4AYSA 1HNYA 2TPSA 3V75A 3WJSA 4LU0A 1W8SA 2P1FA 4I7WA 4DELA 3NL3A 2DZPA 4ICNA 3BAIA 3CGTA 3BV4A 1CXEA 4JYEA 3DDFA 3P5YA 2C16A 1LBMA 1I8JA 4P2VA 3VX1A 3QGVA 5D02A 5I3HA 3CWNA 2ZX7A 3PS7A 3BGJA 1UH3A 1TMHA 4X3ZA 2EHHA 3NPVA 1PIGA 2Y24A 3DI1A 3W7LA 1TIMA 3HPXA 1GTHA 3D4YA 1MSSA 2PWFA 3M43A 1R47A 1W31A 2TSYA 1LM1A 5KTLA 4LV9A 5BOOA 3Q94A 2FQIA 3EX1A 2ZDRA 3M44A 3W7HA 2QUVA 3TJXA 4JY9A 4O19A 1M53A 2YDAA 1E43A 3IIVA 3EWXA 4UFJA 1VYSX 1SU5A 2DZWA 3LXCA 4LS0A 1KXHA 3TOPA 1KM5A 1K3UA 3N2MA 2OCZA 3VM5A 2YFNA 3A24A 4KWVA 4UTJA 4CQ9A 3L4ZA 1H62A 2GOUA 3BCFA 3KAOA 4JDYA 2Z6IA 4TO8A 4HOWA 1Q6LA 2XVKA 1SW0A 2VRQA 3CZKA 1OFOA 5BRPA 4MVAA 1XD0A 4HHPA 4AW7A 4AHQA 3ZQ9A 4CKQA 1OHLA 2VC6A 1UUOA 3WJYA 2Z1KA 4HKPA 1HUVA 2ISWA 1GQNA 4O1BA 4GUGA 5BMWA 4MOZA 4WY0B 3VGDA 3UYCA 3IIXA 4QISA 3P5ZA 1ME7A 5TD4A 3S5OA 1XBYA 2HSAA 3MUXA 3GR8A 3KRZA 4MZ8A 3HG5A 5D38A 1BF2A 3GXNA 4OKDA 1VFUA 3BUDA 5I3KA 1UB3A 1L6WA 1AQHA 2ZA2A 1PIFA 4HT3A 3DKLA 3GK0A 3MP5A 4RJEA 1SFLA 3C8FA 3ZR6A 3CHVA 4HNUA 2ZBTA 1LYXA 3DX4A 4LY8A 5G2WA 3CQ0A 5KITA 2DZTA 1K7XA 3O6YX 2VEMA 3OA3A 4FNPA 1L6YA 1IV8A 1E51A 2AAMA 3RMJA 3L2LA 1GG0A 1YTEA 2JKAA 3SGZA 1JI1A 1C8QA 2ZYFA 1KM2A 3PBUA 1H63A 3TMLA 4GUFA 4O52A 3SW6A 1LWJA 4JFVA 1G94A 4JCLA 5AB3A 3WFZA 4RXFA 1JDAA 4GXMA 3LCHA 3BSGA 3PF3A 5AHEA 4OT7A 1DHKA 2FB2A 5D2TA 4NZJA 4UQBA 1OVDA 5EYWA 3NQGA 2XVGA 1VYRA 4FB7A 4XTDA 3BVJA 1FDYA 2I1OA 4J28A 2XWDA 1MVYA 4MKNA 2X2JA 3KHJA 2ZCGA 4MLRA 4JICA 2CLEA 3LBMA 1T8XA 3PBWA 1FXQA 3MW7A 4NJGA 5EMYA 2EKCA 3S8HA 1AMKA 1JXKA 4IPIA 4GI9A 1OFDA 3KVMA 2EAEA 4O57A 2AMGA 1FBAA 1F05A 3TE9A 3GKFA 3KLKA 4LOCA 3MP3A 3GZ3A 2GJPA 5D30A 5DBTA 4UQ9A 4AEOA 2WJZA 1V3MA 6TIMA 3RILA 1KFJA 3W7RA 5D09A 1CX9A 3AJXA 4TMBA 4PEEA 4CNOA 4X9SA 3O6DA 3P61A 1TPEA 3L4UA 1CI1A 2OYLA 4WXYA 3L4TA 1JXJA 2NUXA 4PC8A 5AC6A 5G2HA 3W2KA 2WSYA 2QUTA 2QDHA 3L0NA 1EWEA 2A0NA 1IZJA 4MZYA 1QPRA 3BLKA 2E09A 5K2ZA 2CZ5A 3HOJA 5AC7A 1KGUA 4BF9A 1RQEA 1ZNNA 2F7QA 2JBMA 4O10A 5BMXA 1W5QA 3B0UX 1KFCA 2GUYA 1WPCA 5D32A 3B05A 3BW4A 5D05A 1CW2A 2HTMA 4O16A 3G8EA 1NVMA 4N6FA 3DFQA 3I68A 1FDZA 5AYZA 1UD6A 1LRNA 2WSKA 4H8VA 1RV8A 1X1ZA 1DJQA 3CIXA 1WZLA 3EJTA 3UY8A 4BI5A 1W37A 4O18A 4JTSA 4UMBA 1W3NA 2H3DA 3ZSTA 1PZ3A 2GJRA 3VGHA 2O7SA 2QJGA 3PB0A 5FESA 2WNZA 1AVAA 2R94A 4YCOA 1KFLA 2TAAA 1OYCA 1WO2A 2PWHA 2YZRA 1S5VA 2E6AA 1EP1A 3DI0A 4MIMA 5GVJA 3I6RA 1E3XA 3HG3A 1SSGA 3SSJA 2F7OA 3MMTA 3L21A 1X8FA 2TYSA 2YSWA 1XDMA 4DQWA 3N9RA 4O28A 3W2MA 3WK0A 1R75A 2Z2UA 4QNEA 1L6SA 3OVRA 2Y88A 1CGTA 1JCJA 1MEIA 2B4GA 1TPWA 1TRIA 5K9XA 4HNTA 1KWGA 1P5BA 4RV8A 3P81A 1CYGA 3WY1A 5G2IA 1I75A 1WP6A 3K1DA 4K39A 2GJLA 3IEBA 3M47A 1D3CA 4U28A 3JRKA 5HUOA 2CWNA 1XCFA 1BLIA 1TPFA 4J3TA 1XUUA 3UWQA 4JTFA 3O16A 3P62A 2CHNA 2XN0A 2H90A 2J6XA 4WY0F 1GJPA 1VCGA 4Z1BA 4MZ1A 2FLIA 1OF8A 4MY8A 3EWBX 3ABSA 3BCDA 1UD5A 1A50A 4UUIA 1K8YA 3AMLA 1LLZA 1M6JA 4FO4A 4UTIA 3UG5A 3ZT5A 2D0GA 1TPVA 4K7YA 2J24A 2VFFA 1AG1O 1CXLA 1UD8A 3LHUA 3KVKA 4N9DA 3IVUA 3TJLA 5KINA 1KB3A 3HJZA 4HP5A 1ALDA 2PE4A 4BR1A 1CGXA 3UZ5A 2V5BA 4LVDA 1A5AA 5G1TA 2CLIA 1IF2A 5ABTA 5LGZA 3M9YA 1RP9A 4B9ZA 4DO6A 2RFGA 3S1VA 3IGUA 4P61A 4KWUA 4HNVA 4E0CA 2ZZ4A 2YCEA 4NI3A 4AH7A 4CGTA 3CIWA 5AYXA 3DKJA 1LBLA 4OU1A 4OV9A 3EJRA 2C7FA 4IMEA 3NM1A 1ZJBA 4UMCA 2CLKA 3GBEA 2DIJA 1XL9A 2D3NA 1OFEA 2EACA 3TV8A 2TRSA 4YCPA 2VFGA 3VI2A 4Z08A 4FLQA 4U2YA 4NVTA 4AF0A 5DY3A 3STFA 4WD0A 1GVOA 3NA8A 2X2GA 4UFLA 3MYOA 4J7RA 1HL9A 3G1DA 4U31A 1JF5A 3IV3A 4LS1A 2V5LA 3HGOA 4O4WA 2QDGA 2O7QA 3L4VA 1LZOA 1HO1A 1BPLB 2DORA 2QKFA 4AYGA 1FXPA 1OYAA 3B4UA 1QX1A 5DELA 4NNBA 1OF6A 4TX9A 1KBBA 3LHWA 3TC6A 5F7UA 1G9HA 3HIJA 4W93A 3GTNA 2QJIA 2BHUA 3O1NA 1HWWA 2OYMA 3RIKA 2KZHA 3QFEA 3NPUA 3L4XA 4UFMA 1GYNA 1AW1A 1ML1A 1V7YA 1Z42A 3R89A 2VUYA 2AQWA 5AOUA 1KLYA 1PS9A 4WZHA 2ZA3A 3LLFA 4O15A 3FOKA 2B7NA 4UFKA 4OWGA 4O11A 1Q3NA 5BNKA 4FX8A 3THQA 3PY2A 1LWHA 3W1PA 2C19A 2H6RA 3WY2A 4LW7A 2FDSA 5EPDA 1PHWA 1AW5A 3C2RA 3GAKA 4YL2A 3QQ1A 1F6PA 4WF7A 1TO3A 4CCEA 1G4EA 3MHUA 4QAWA 4A3UA 3W7QA 4UTHA 6ALDA 2YOCA 3W7IA 2C6QA 2ZRZA 4CQ8A 1J2WA 4IX0A 3VU2A 3WENA 3VGBA 1JR1A 1VRDA 3HZ3A 4YLWA 2X1UA 5FF4A 4AEEA 2ZXQA 2CLLA 3P80A 3A23A 1SW7A 3BMVA 1B4KA 5H2ZA 3C6CA 3KXQA 3DHPA 3H53A 1UKSA 1BTMA 3O05A 4EF9A 3VSTA 1GG1A 1SO4A 3NEVA 3N19B 5E93A 5AFDA 2C15A 2BLEA 5U7SA 3W2LA 1XGZA 3KLLA 3IRDA 3LRKA 2YFOA 1GYLA 2BY3A 2XIIA 3LV6A 9CGTA 2XN2A 2X16A 2EABA 1JRCA 1XXXA 5AN7A 3GXTA 3BAXA 3W7JA 5LHEA 4UNKA 3F03K 2C0AA 3NQ2A 2FPTA 4JTLA 3CZEA 1UA7A 4O0ZA 4N9BA 5J5DA 4UNLA 4H2CA 4IXXA 3FA5A 3D4ZA 4UQDA 5I0DA 3BLEA 5CPNA 1SZEA 2PWGA 4RZ5A 2JGQA 1OG0A 4CCCA 4AHOA 2DJXA 1SMDA 4ZVJA 1TB3A 3MWAA 1OT1A 1QFEA 2I14A 2ZZ2A 3DXIA 1JCYA 1EP2A 1F6KA 1F5ZA 1RR2A 4AXKA 2WVUA 1H1ZA 4C1KA 4DXVA 5E0KA 2WCGA 4XKYA 3W2NA 2QCCA 1H3GA 1ZS2A 4J27A 4EIVA 1XC4A 3QSTA 3NQ8A 3DC0A 3WK3A 5J5RA 2OJPA 3VMOA 3DAQA 1EEPA 4M6QA 4XBSA 3VMNA 3IIOA 1G7VA 1HFBA 3P7YA 2A2IA 3L5MA 3S1UA 1PVNA 1R2RA 5A5WA 5EA9A 4WOZA 3NL6A 5I3GA 3PULA 2GQAA 4GWEA 4M5PA 3W9ZA 4NX5A 1J0KA 1QO2A 2YJQA 3UWVA 3G3MA 2GQ9A 2VELA 5LNVA 2GPTA 2VFDA 1KBJA 2BHZA 1TRDA 1CDGA 2A4AA 4DPPA 2CLOA 3INPA 3PC0A 2WKGA 1LRTA 4NZFA 1KTNA 3EXRA 5DXYA 4EWND 4BFAA 1PV8A 5DFAA 2OSXA 3THAA 2QCDB 1ME9A 5F2IA 4CCDA 2E0PA 1TTPA 3M07A 1F76A 4K37A 4JFSA 3RFAA 1LCOA 3HBLA 1W3TA 3A47A 1IXQA 1QI4A 2ZZ3A 4X9YA 1QPNA 5A2AA 3NAVA 3HB9A 3T78A 3GB6A 2OT0A 4ZQMA 1Q6RA 4BA0A 1G69A 1OABA 1UKQA 4LRSA 4LS2A 5EBUA 5HULA 1QI5A 3ELFA 1H7XA 4GJ1A 2VXNA 3BAYA 2JGYA 4NJIA 4JTIA 1GJWA 3LERA 4M6VA 1WA3A 2QCLA 3G1VA 5G1YA 3FAXA 1Q4NX 7TAAA 4Y8FA 1Z32X 2ZZ7A 3NNTA 1CXHA 4M56A 2WC7A 3VMPA 2X1SA 3M16A 1KTCA 4JL1A 3GDLA 3WFAA 2EO7A 4H8UA 4R34A 4W9TA 3TFXA 1KM3A 1TCDA 3FJLA 4RZ6A 2VEIA 3IGXA 5KSWA 1IIHA 4O4VA 1XV8A 1QPKA 3WNLA 1TCMA 2NX9A 1ICPA 1OX4A 2IQTA 1O60A 3Q58A 5F4XA 1XSJA 3QF0A 1B57A 3C0JA 1R30A 4JD4A 2YW4A 2F84A 3HGJA 4NT0A 5FEXA 1D3HA 3W88A 4IGHA 3EDKA 2ZRWA 1EHAA 1KM0A 1VGAA 3LCIA 4KFPA 3E9AA 2NT1A 4IJBA 3LHVA 1WBHA 5EMUA 1BAGA 3BUIA 2F7PA 2H8ZA 4FXSA 2V8ZA 3ATYA 4MLJA 4JTEA 4S2CA 1Q6QA 3CV5A 3EDDA 4FIRA 1WYIA 3AO0A 4EOUA 3TTSA 6TAAA 2YGYA 3GX9A 3C56A 2Y7DA 1JULA 3CZLA 4K6AA 3A9IA 3NPXA 3K30A 5I24A 4GINA 1ONRA 3RNDA 1JG9A 4PFMA 4K8EA 4N4PA 4QQ3A 4PL1A 2GVGA 3W7DA 3NM3A 3DHUA 4GQQA 2AGKA 3S5YA 2A7PA 2BY2A 3BO9A 4RR4A 2FHFA 1QPQA 5E0FA 2CZEA 3CEUA 5H91A 3C4UA 3A21A 1KV8A 1UKTA 2EAWA 1BSIA 4QNWA 2ZUSA 4LVFA 4UQAA 1RPXA 1VJIA 1MFUA 3BAKA 4ADUA 1VIWA 3L4WA 5FI8A 3LCLA 1H7OA 2Y7GA 3G24A 3UEQA 3P8JA 2ZXAA 4DO5A 4GUJA 5KZMA 1EH9A 4HSNA 1OSEA 2Q8LA 3UQNA 5I3FA 3GIYA 1OB0A 4AHPA 4UTUA 1FY6A 1VPXA 1LRQA 4DO4A 3SZ8A 1JJKA 4FEZA 1SZGA 4NQ1A 1K7EA 2E77A 2BSLA 1J0JA 3Q37A 1TPUA 2V2DA 1H51A 1ICQA 3VFLA 3W1RA 4I9AA 4O1DA 2BY1A 4Z1DA 1LORA 1QW8A 3M41A 2A7NA 3WK2A 4OBTA 1DOSA 3TCEA 5HMSA 2QPSA 1FWSA 1C9DA 2VFHA 5CPOA 1WZMA 1JVNA 1UJPA 3G3DA 3OVPA 2NWRA 3TIMA 5FEWA 1N55A 4E2BA 3EWUA 5E6ZA 2YYUA 2A6LA 2WPBA 3LRLA 1ZFJA 1P4CA 2ZRYA 4JNMA 4MAZA 5DO8A 2Q3OA 2YR1A 5CG7A 3W1UA 2WSPA 2ISVA 4R53A 5F4WA 1JCXA 1KXTA 3DHDA 2HS6A 1TTIA 2CZFA 3W7GA 3GXPA 5HPOA 1GVFA 4AB4A 4MUZA 1LTDA 3G1YA 3EWWA 4NNCA 2W0UA 4OE7A 4UXDA 5HWJA 1EB3A 2RDUA 3G1XA 1GJUA 1VCVA 4TMCA 3W7KA 5FF0A 4JYDA 1XSIA 3L67A 3I7QA 3PM6A 1VFMA 3W70A 1YYAA 4ORMA 3TFCA 4PTNA 1L2UA 1X7FA 4FLRA 3GYEA 1A5SA 4Q33A 4H4IA 3W1XA 2WKLA 2ZTKA 5A6MA 1H7NA 2ZRXA 2VKZG 1CGVA 1I2OA 1TPDA 2ZE0A 3Q2DA 3MO7A 2X1RA 2FFCA 4ZQNA 1EO5A 1SSDA 1VAHA 1EA9C 1ZY9A 2B7OA 1XH2A 1CIUA 3VKJA 3W7NA 3LPPA 3BH4A 2RHGA 4XBKA 3M5XA 5IBXA 3TH6A 3ABOA 1BVZA 3EDFA 2ZIDA 3DHFA 3QZEA 4RZ4A 1B9BA 5TIMA 2QLYA 1EPXA 2VENA 3MI3A 3C2VA 2Y4SA 4FX6M 4IMFA 1JDCA 3W38A 4DBEA 3TDFA 4IWWA 1XKYA 2PRHA 3U2OA 5C54A 3LX9A 4JCMA 1F73A 3PSVA 4HNNA 2ZICA 3PBYA 4JTHA 5F2GA 1WX0A 2QEZA 5FF3A 1K8XA 1Z41A 1UH4A 2OSWA 3G0XA 4LPCA 1FDJA 2YXGA 1V3LA 2QMKA 1TQSA 4QJ1A 4MB1A 3IJ9A 3CB8A 1A5BA 1IXNA 4AWUA 1MXDA 4R7JA 1W5NA 1OFQA 4JYFA 1WXJA 2V81A 4LC8A 3W72A 5C6MA 2QAPA 3EWYA 3LBCA 5IM51 4Y90A 4O17A 3TW7A 4TR9A 3VX0A 5CSRA 1WOBA 1WZKA 3DFTA 3BW2A 1DJNA 1KFEA 2CFFA 2HMCA 3W6YA 2CLMA 4FNQA 3FW6A 4MJMA 2D73A 4AVFA 3L2IA 5EL1A 4PODA 3T7VA 1RQBA 7TIMA 1H1YA 2F61A 3II1A 1OFAA 1L0PA 3CT7A 3W85A 3D0CA 5BW6A 4Y96A 4U33A 1B0IA 3HPSA 1Q45A 1H50A 3B03A 4U4MA 1GWJA 1YDNA 3EKZA 3BMWA 3EEGA 3G1SA 4OHQA 2WSQA 4OV4A 4NJKA 5CZ0A 4JIPA 4LT9A 3ZSSA 1GEQA 1ZAJA 5DN1A 4WQ6A 1XFBA 3KRUA 3H55A 1ME8A 1TTJA 1O7DC 2DZUA 5E70A 4H3DA 5D2WA 1AL7A 1TV8A 1Z48A 5L9FA 2X2IA 2Y62A 5C5YA 1HX0A 3W74A 1MEWA 4ORIA 2BY0A 2ZRUA 3KE0A 5LGXA 1L9WA 4QIUA 5AHNA 3GAYA 1VCFA 3CEPA 1CXKA 2C8NA 2QCGA 1PAMA 1MEHA 1MW2A 1TJPA 2ALWA 5MHBA 1W3IA 3G0UA 3R2GA 1JUEA 4IQLA 3C2FA 2XWEA 1I4NA 1QMLA 1W56A 3QYQA 1QI3A 2XIBA 3SFKA 1YPIA 1YDOA 3OLDA 4JN6A 4GE8A 3LHTA 3L0GA 2QMJA 2CPUA 1FUYA 3MHGA 3NQAA 1VJSA 2ZUTA 1DQWA 2CLFA 3TQKA 1B4EA 3VSVA 1JCMP 2ABBA 1JF6A 4OQVA 1HVXA 3IJ8A 4YMZA 3ZT6A 1W0MA 1G4SA 1GZGA 4UQCA 3CZNA 3AXIA 4X22A 3DX1A 3LHYA 5DY2A 1WZAA 3STEA 1J4EA 1W1ZA 3TC7A 4CQAA 3HO8A 2D3LA 1VHCA 4NXKA 4G1KA 3GXFA 3SECA 5F1VA 4DBDA 1KM6A 3LTYA 2LLEA 1NAL1 4XZ9A 5HNRA 4K8HA 2BXYA 4UQEA 4JTTA 3CM4A 4IPJA 4AWTA 4LTSA 2VFIA 3BUPA 1OFRA 3PR2A 3TROA 2FGZA 1AQMA 1I2QA 1OGSA 3VO0A 4Z0JA 3KRSA 5HXMA 1OX6A 4FLOA 1BKSA 3EXSA 1GTEA 3E96A 3TK7A 1BWLA 4AF0B 3UXAA 1U33A 1T0OA 2FE0A 2D0FA 2E6YA 1V3JA 2BTMA 1FWRA 1R2TA 2ZX6A 3UG3A 4GO9A 1EA0A 1ODUA 2Y7FA 5HINA 1JD9A 3NQ6A 3SI9A 4ATWA 3OIXA 1XBZA 2R8WA 2F7FA 1P6WA 3BG3A 4LVBA 5C55A 3O63A 4J9JA 1VS1A 3FIGA 3KFTA 3K8KA 5A2CA 3E0IA 1V5XA 2HS8A 1I2PA 2WVVA 2WNNA 3G1FA 5FF2A 4GQRA 4OIFA 1RP8A 2E5DA 3EX2A 3CU2A 3NQCA 2YA1A 2CXGA 4LUJA 4LV4A 1NF0A 3PB2A 2H3BA 3BG9A 4KFOA 3PG9A 4JX5A 3TSDA 2EADA 3BUQA 3QH2A 3N73A 5D03A 3PUDA 5LNSA 4IX2A 1TV7A 2V2CA 2X2HA 4C1LA 3W76A 5KMYA 3WMSA 2E5CA 4NJHA 3W2UA 3VNYA 1DV7A 2GVJA 1QCWA 2WQPA 3K8MA 1X1OA 4O12A 1PEZA 1YDVA 3RLUA 1S3HA 4IMDA 4E38A 5HR7A 2DZVA 1H7WA 3YPIA 1AL8A 4ZQRA 4ZL1A 1CXIA 1OJXA 4HIBA 1DEDA 4ADSA 5AHMA 3P84A 3PBVA 4LXFA 3ZR4A 1SUXA 2QAFA 2V9DA 3VNZA 3BPWA 4RK8A 4PSPA 1NSJA 2ZUVA 2RDWA 3LCWA 4UNIA 2F2HA 1I2RA 4JIQA 1JQXA 3B0VC 1CGYA 1YTDA 2F7RA 4HPJA 1EO7A 1HL2A 1O5XA 3RLVA 1EP3A 3LDVA 1CXFA 1XI3A 5CGMA 2GJNA 4Y6GA 2YPIA 3PSWA 2OW7A 1KXQA 3CC1A 1PCKA 3CWOX 4Q32A 2EGZA 4D2JA 3P67A 1R2SA 3W1AA 1BG9A 3QPYA 3KL0A 1NOFA 1T96A 2ZXBA 4AIEA 1ICSA 4J3VA 2XFWA 3L9CA 3UY7A 2WANA 3EJUA 3GR7A 3QQ0A 5I3JA 2ZRVA 3OVQA 3TXVA 3MBDA 1WAUA 3QRHA 4GO8A 3OBKA 2QCHA 4NJJA 3NQFA 5CXPA 4YXGA 1ZAHA 1LDCA 1THFD 4MFDA 5CSSA 1UASA 4J3XA 4XQ6A 4FNSA 3NL2A 3P82A 4O0KA 2C18A 4FF7A 5L6UA 2QV4A 3UWUA 3O06A 2DZSA 3NZ1A 2Y85A 3C52A 4LVGA 2G96A 5E6YA 4HSOA 1W5PA 3H54A 3BLBA 1KLZA 1CLVA 3G1AA 2OZ0A 1O4UA 2Y89A 4OGZA 4KFNA 3MJYA 1O95A 3ZT7A 1TTQA 4FIQA 1XCWA 5KEZA 4JTJA 3EX4A 4XKYB 3G18A 2XN1A 2CU0A 3O8AA 4MY9A 2DH2A 2E5BA 1HXKA 5U4NA 3IIZA 4FLSA 5G5IA 2WV8A 1KGXA 2JKPA 3T44A 1TQWA 3W1TA 2OW6A 5D33A 2X1TA 2V3EA 3S1WA 1GVIA 1TPH1 1QOPA 4TVUA 1OK6A 4UR8A 3G22A 3HG2A 3S5ZA 2BX7A 4JFWA 3WNMA 4UTLA 1JDDA 5IBXC 4A22A 1PCWA 1KFBA 4NXSA 3T40A 1EUNA 4WXZA 3PUOA 4S1FA 3NDOA 2WNWA 3HMJG 2FHCA 3UCQA 8TIMA 1G7UA 3C2EA 3EJSA 4B5NA 1R33A 2WSRA 4UTKA 1JFHA 4UIOA 4PH6A 4H8HA 1DTUA 3B04A 1JUKA 2ATSA 3KEHA 4IMCA 3TAKA 3DX0A 4FHAA 4XUGA 1LBFA 2ZX9A 3LCFA 2ZXDA 2PWEA 4M8UA 1YLVA 3HGRA 5F4SA 3GVGA 3MBFA 3TW6A 3QPZA 5E1QA 3CLMA 3K8LA 5D37A 1JL8A 2V82A 2C1HA 3U8GA 5HJLA 3IK2A 4S2BA 4HA1A 1KCKA 4GRSA 3W71A 2DJLA 1J0IA 2G3NA 1XDLA 1KM1A 2ZZ5A 4M19A 2F1BA 3F1QA 4LNYA 4GC4A 3CTLA 1H7RA 2J88A 3BLIA 1H5YA 2BWGA 3UPWA 1D3GA 1WDWA 1PIIA 5CPMA 1W9XA 2QCMA 3W7CA 2ZUUA 2PRLA 5FF7A 1M7PA 1SO5A 1NFBA 1KWKA 1KM4A 4QM1A 1U83A 2RKXA 3CPUA 3C3NA 3T4CA 5G4EA 1R46A 1MW3A 2QPUA 2WKJA 3W1QA 4ADTA 1KGWA 2H8XA 3NOEA 2ZZ1A 2B0MA 5D2XA 3WEOA 1RPKA 4J3WA 2GUUA 1WE5A 1XH1A 5BRQA 3DZ1A 1W5MA 1FQ0A 3FFSA 3WNPA 2E6FA 3KL5A 1BVNP 3BVWA 4Z0SA 2WVTA 3W73A 4HOXA 1HG3A 4DF2A 4K7VA 5DCDA 1EX5A 5AC8A 2YW3A 3GNNA 3QW3A 3DX3A 4L4MA 4BZYA 3NQMA 1OX4B 1GVQA 1G67A 2WOQA 4O1AA 3GXDA 2WNQA 1JUBA 1QWUA 3QMRA 3W07A 4WX2A 1YXDA 1S46A 4RLIA 2E1DA 5DCBA 4UOZA 3LI1A 1M7XA 3SR7A 5AYYA 1K8ZA 4Z1CA 2VEPA 3W75A 3ZO9A 3AJ7A 4FMVA 3DFPA 4N4QA 4HOZA 2EEXA 4JDBA 3TKFA 3F4WA 2QF7A 3M7WA 2ISSA 5DLCA 1O5KA 2VFEA 1MFVA 3A4AA 4CNNA 4B9YA 4IUOA 3WNKA 1G5AA 1ZALA 1PJ9A 3STCA 4JFUA 3WDIA 1KBKA 3E12A 3S1XA 5HR6A 2A1YA 3R5EA 4E2DA 2ATMA 3FYPA 2C3ZA 4UTMA 1N8FA 1FCVA 1Y0EA 5K7JA 3R8RA 1TYGA 3O6CA 3QMTA 4EVZA 3LM7A 1DBTA 4UCGA 3TR2A 5FEPA 1JD7A 1P0NA 1S5WA 3G0SA 2TMDA 1KA9F 2E4TA 3L68A 3S42A 4GI8A 5DCEA 3E49A 3NQDA 2OMAA 4UTTA 1CGWA 2VR5A 1BWKA 2V30A 4CN6A 1KTBA 1O94A 1WV2A 1KXVA 3NXFA 4WY0A 1QNVA 4YWIA 3EX3A 2DIEA 8CGTA 4UMAA 2NUYA 3W86A 1J0HA 4K38A 4AEFA 4N6EA 5LHFA 5F2MA 1KBIA 1Z44A 3UWZA 2NXGA 1UOKA 3NR0A 3AMKA 5A8GA 3IVTA 4PCSA 2ALDA 3FAWA 4H6KA 2E9BA 4UZUA 4BWLA 2WVSA 2Y7EA 4LWWA 5EY5A 2ZWYA 3DGRA 5E9AA 2E68A 2CW6A 4Z1AA 3W37A 5K9CA 1KV5A 2NXHA 2R14A 4Y9AA 3DX2A 1FCBA 4NUWA 4O50A 2NWSA 2OSYA 2NXIA 3W23A 2FHBA 2YIHA 2D0HA 4NX0A 3LXBA 2FYVA 4GBUA 1K02A 1TSIA 3PAJA 5HQEA 5SWUA 1VHNA 3IJ7A 1MW1A 3OHIA 3EB2A 2G3MA 5LZLA 3KX6A 4A2RA 3LRMA 4GNJA 2PC4A 4ZQCA 1XD1A 1QWNA 3BG5A 4AIOA 5FEZA 2NZLA 5EKYA 3NQEA 4CNPA 3NYZA 4O8RA 3NVTA 4K36A 3S0CA 1PE1A 3DENA 3DDGA 4UZSA 2X30A 1TQTA 2PWDA 2NX1A 1T99A 5CZJA 3OLGA 1A47A 4J3UA 3FS2A 4I7VA 3BUBA 4RKAA 3LOTA 4AMWA 3VNDA 4L4LA 1PS3A 4JL2A 1EUAA 1LROA 3UNDA 1C8VA 3TX9A 2V2HA 1VC4A 3BSHA 4HPXA 2BXZA 3AXHA 1TJRA 3S2CA 2FPVA 1UD2A 4LC6A 2NV2A 4GUIA 4UC5A 1A5CA 1M7OA 4DF0A 3ECQA 2G95A 4JFTA 1JCLA 1QPOA 1K7FA 5AHFA 1N7KA 1SO3A 1K03A 1TQXA 2QJHA 1SPQA 2Y61A 3GLCA 1QHOA 4LUIA 1FX6A 1G4TA 4FX7A 5HUPA 1MXGA 4QSHA 4CLMA 1IGSA 1W5OA 3L66A 3CZGA 1TPB1 1MO0A 1FWWA 5I3IA 1SFJA 1Y7VA 3MI6A 3QW4B 3N2XA 5BRBA 3FEMA 2YKKA 3EX6A 3IGSA 1XCXA 3D52A 1XH0A 1B3OA 3B8DA 1ZAIA 3BW3A 2FH6A 3JS3A 3L0KA 3W83A 3GDTA 1HTYA 1DL3A 3LV5A 2NLIA 5TBOA 4JTUA 1RVGA 2VT0A 3W7EA 1JCNA 5LKYA 1SMAA 3RK8A 1YADA 4EF8A 3DBPA 2Y6ZA 2J25A 3PWAA 3MP4A 1DQXA 2Z1BA 3W1MA 3A22A 1SR9A 1HTIA 2FB3A 4M6PA 3A5VA 1JIBA 1ZENA 2F1AA 1LOLA 2Q3RA 2R91A 4HPHA 2VOMA 4UTWA 1J5TA 2RDTA 4NU7A 3ZWTA 3GXIA 2C13A 1GVSA 3USBA 2V3FA 2Y2WA 1YPFA 4ZQPA 3OG3A 1XSKA 2GVYA 2Y63A 1P0KA 3R12A 1PPIA 3W7OA 4GUHA 2JK2A 2A7RA 2ABAA 4ZQOA 1KFKA 2FTPA 1QHPA 4A21A 1OFPA 1NM9A 2YYTA 3WJWA 2CZDA 3DU0A 2J27A 2B7QA 3DFOA 3W7MA 5G4WA 3FKKA 3NZRA 3VGGA 2YX0A 3GXMA 3F4NA 3PUEA 4M7SA 3OEXA 3UPBA 3FKRA 4PL2A 1UBSA 3A6OA 3W1LA 3GDKA 2ZFAA 1HL8A 2I9EA 1MWOA 1IIGA 3HJEA 1UD3A 2Z6JA 2JKEA 4WUIA 2G5WA 3RU6A 5K3VA 4XWUA 1SQ7A 1QDSA 1VLIA 3BVVA 1RQHA 3TQ0A 2CLHA 1SO6A 4PCFA 3CLWA 5HDRA 3LLDA 2P10A 3EJPA 3WDHA 4UR7A 4CVWA 1EWDA 1OX5A 4AMAA 3QSRA 3NO5A 5CGTA 1DORA 5DXXA 4AAJA 2B7PA 4M7TA 3UWWA 1TPC1 3TSBA 1UH2A 3ZWSA 4MYXA 2NUWA 2NX3A 4H7VA 3TONA 2WO5A 1QO5A 2QCEA 4FNUA 4UOQA 3R13A 5TQLA 3HPZA 4ZMGA 1JRBA 3I7SA 3ABRA 3M5ZA 3NPWA 5I23A 3O07A 1VFOA 2A5HA 1QAPA 2FIQA 3M1ZA 1GVRA 4U2ZA 3EKLA 5CLWA 3MI2A 2EQDA 1DHPA 3TMQA 1VQTA 5LNRA 1X6UA 3BLPX 2EPHA 5A2BA 1PL9A 2ZUWA 3VE9A 1DKWA 2RH9A 1B2YA 3W2JA 2Y70A 4BI7A 3L2MA 3MHFA 3VGFA 3WNOA 1GOXA 4JEQA 4A2SA 3NQVA 1H7PA 1H61A 1HO4A 3KL3A 2FJKA 3G1HA 4J3SA 4O54A 2QR6A 3L65A 2XVLA 3HGSA 3QM3A 3JR2A 1ZHAA 3WNNA 3S5NA 1ZJAA 3GDMA 1NEYA 3VM7A 3SIZA 1I45A 1MXSA 2C14A 3L5LA 3OLEA 1XM3A 3LGEA 3TU9A 2V0TA 3TA6A 4O14A 1TQVA 1GT8A 3ZS4A 1F74A 3EWZA 1VLWA 4R33A 4JY8A 2YA2A 4PEKA 1VR6A 3LB0A 4AMXA 3N3MA 1VYPX 3UG4A 4N2YA 4UFIA 5CLTA 3SGUA 3C2OA 1JAEA 3E02A 4PA8A 3U6WA 3L5AA 3UERA 4ALDA 1G6CA 4N9CA 3LHZA 4LVAA 1LP6A 1OT2A 5CZTA 3BVXA 4CN4A 3IIPA 2W79A 4FXRA 5A6LA 3P60A 3KWXA 4U3CA 3B0PA 3WDJA 5CGQA 5LSMA 1TREA 4N9EA 3B06A 3VSUA 1SW3A 4KWWA 3EDEA 5KZDA 4MY1A 2WVVB 2Y5EA 3NQ7A 3I65A 4FNRA 4X0NA 3BGGA 3V1PA 2FPYA 1KW1A 3QEZA 2GVLA 3GNDA 1I2NA 1ZCOA 3W1NA 3DFSA 5D2YA 3UD6A 3LPOA 2ZWZA 6CGTA 1IXOA 1D7FA 1ZJIA 3WY3A 1TV5A 1YXCA 1MW0A 2E6DA 3CZSA 2PCQA 3N9SA 1CPUA 2OX1A 3BARA 3BC9A 4WJEA 3BVTA 3ZFHA 3GBDA 2J9XA 1C29A 3ANYA 3W84A 2DP3A 3HQ1A 3UZJA 1A53A 1E40A 3P8IA 5KZEA 1WBJA 4BK9A 4HN4A 4GFSA 4MJZA 5LNUA 3OLIA 1W54A 1TQUA 1UA3A 1IXPA 3TSMA 2NV1A 3UWYA 5K9DA 2ZZ6A 3WELA 4Q4KA 4DPQA 2IGTA 3FYOA 3GDRA 2E8YA 3ZOAA 4GI6A 3ABQA 4TU1A 4AWSA 5D2VA 3T55A 2V3DA 1AK5A 1QW9A 2NT0A 4POCA 5D04C 4DF1A 2WCSA 2GQ8A 3L4YA 4UTTC 1LOSA 1VH7A 2A85A 1KCLA 5CZSA 3A5FA 4MFEA 1YTKA 3MYPA 1EIXA 3KVJA 1JGIA 1VB9A 2G97A 5C2XA 1UUMA 3WJZA 1G1YA 2VNCA 3KOFA 4UFHA 1SZNA 3KVLA 3W22A 4MPQA 3W7PA 1CGUA 2EF9A 1AW2A 3S9YA 2E8ZA 4JTKA 3CTTA 4XB3A 3M6YA 4BWLC 1F2JA 4TIMA 2VEKA 2ZTJA 3GKAA 2Q8ZA 4I7UA 4ML9A 1QWGA 1OK4A 3O15A 2PURA 3TNOA 2PRMA 5HWMA 5LNWA 3TXZA 1WOAA 1U2YA 3WJXA 3TTYA 1XUZA 3DFNA 4RXGA 1LLWA 2OYKA 3UXDA 3FLUA 3HF3A 3M5YA 3WY4A 4JX6A 3BAWA 3LTPA 3QJAA 3VE7A 4JTGA 1S5TA 4XTIA 3PG8A 4WLCA 5F2LA 3C61A 3ZR5A 4OJYA 4PCTA 2F18A 1OFBA 4FNTA 2D2OA 2YA0A 2ZX8A 2BZNA 3N14A 1PZ2A 1NF7A 1U30A 3NGJA 3LCXA 5CKSA 2ZQ0A 3M0ZA 3W87A 1RD5A 1UCWA 2BHYA 2ZA1A 5AHIA 3LXAA 3NL5A 3LI0A 3S6DA 3I7RA 3RF9A 4IMGA 2BXVA 3CPRA 4JX4A 5K4XA 3EXTA 1LOQA 3SY5A 4DEFA 4WOQA 1QOQA 1PHQA 3EDJA 1DVJA 3BK0A 2Z0IA 2FH8A 1IZKA 4JGDA 1TMQA 2VRKA 2DZXA 5F1UA 3FJ6A 4GKLA 1FCUA 4IXHA 4WSKA 2DU2A 1R34A 3WN6A 2OT1A 1QR7A 1VZWA 3WEMA 4ONVA 3WK1A 5HWNA 3PVFA 1JQVA 4RCXA 3D51A 4WSJA 3LCGA 3QMSA 1D9EA 4A29A 1MZHA 1Q6OA 2P0OA 1GCYA 2QCNA 3BVUA 1YXYA 2QCFA 1HT6A 2DH3A 1U5JA 1SZFA 3VGEA 2A6NA 1H60A 4O1CA 4X2RA 2QUUA 3VCRA 4JR5A 3M5VA 1UD4A 4UCFA 1G4PA 1WQ5A 3DH7A 4IOTA 4JS3A 2W6RA 4BI6A 1ADOA 2A21A 4GIAA 4CN1A 4N02A 2NSXA 3ATZA 4PSRA 1GPWA 4RX0A 2EJ1A 3BLFA 1E3ZA 2WPGA 2J9ZA 3SJ3A 2QCDA 4ZZ9A 3TUUA 4QITA 3TQVA 1FWNA 1RZMA 3G8RA 3STGA 4LQ1A 1FWTA 3EJQA 3D50A 4MYAA 3LTSA 5K4ZA 1FCQA 7CGTA 3N34A 4KMQA 2ZX5A 1XBXA 2UV8G 2J9YA 4O53A 4NNAA 4O13A 5I5RA 3P74A 4UTWC 1AMYA 2AAAA 1XBVA 1TQJA 1P1XA 3QC3A 1V3KA 1M5WA 4KKXA 3NG3A 4JXCA 3W3OA 1F7BA 1JI2A
chains in the Genus database with same CATH superfamily
1J5HA 3ET9F 1F3JB 4IG2B 2W8CA 1YYLH 1O66A 2AK1L 2ZL8A 2P1FA 3O0FA 4GH1A 3B83A 5ETUA 4ICNA 4Y16D 4HXBL 2VDKL 2Z1VA 3GIZH 2AHIA 4NM4L 1T66C 2IANE 4AQ1B 2WAHA 3PS7A 2V6HA 4MGGA 1RK0A 1G7LA 1N5YH 3IJEB 1OWWA 5HPMB 3M43A 1NAMA 2WKOA 4UB0L 3QRGH 1QKZL 2GY5A 4MJIA 4DWHA 4I0PA 4EZJA 4KI5E 2GOUA 1YEDB 2VUOA 2Z6IA 1Q6LA 1L3WA 1ZKAA 3UBPC 2VRQA 4R2GD 3D0VA 4HHPA 3T9PA 5DD1H 4HKPA 3OW1A 5C07E 3P5ZA 3NUKA 4Z7WB 1V6VA 4GSRA 4Y5YB 3WFHB 1OGTA 3QDJA 4HT3A 3P3BA 5TPWL 3H21A 4X6EA 4ZXLA 3T0DA 1WBZB 2XIQA 3VIPA 4NQDD 5IQ9B 3DJZA 1EHXA 3ARUA 1ZSHA 3HG1B 4C90A 4LVOB 4P5UA 3I9AA 1ZS8B 4JCLA 4MZIA 4ZMOA 1M04A 3NIDE 4NZJA 2VSCA 2R59A 2Z93B 4HVBA 4DAGL 4FB7A 4E9VA 4J28A 3SADA 1KLGA 1UR1A 3FRUB 3KHJA 5CF3A 2JI3A 2GK1A 1ISZA 3P2VA 4BHUI 5D1ZA 1IC7L 4RZCA 4GK8A 3M0IA 2WSDA 2IOMA 3NJNA 4B97A 2WZMA 5IJVB 3N11A 1OFDA 2E7HA 3IGFA 1F6AA 1KG0B 3DVFA 1ZHBA 4XOBA 2K9FB 3MP3A 4Z9KB 3GZ3A 2NYYC 3TYDA 4BTYA 1EBGA 2WJZA 1IIIA 3V6FA 2CISA 1MFMA 4PJ5D 4Y5XC 1NFDA 2W9EH 3KXFD 4M8QB 3VYPA 2VDGA 2HUHA 3NQKA 1KGUA 4DIXA 4ODXB 5DR5L 5L2KB 2F53E 3HKZA 1QG3A 5T1JA 2AK1H 2HB0A 4JTSA 4K3JL 1TMCB 4GP8B 2CC0A 4BHUA 3WAKA 2VCCA 3ABXA 3NO1A 4HXBH 3WMPA 2B7DT 4NM4H 2B1AL 4D0BB 1EP1A 5C09A 3ENEA 1HEZB 3ITXA 1N3NB 3FT4B 3L21A 1XDMA 2Y88A 1JCJA 3DFHA 1FLRH 1J8HB 4MAUL 2JFCA 4UB0H 1QKZH 4E5XG 4JPIA 3OS7A 1TPFA 5DC9B 4Z3HA 2NZIA 1W1IE 5D7KD 2KC0A 4UUIA 4G7RB 1OARH 2WQXA 1AE6L 3HI6L 4IRJD 3ATEA 3L3HA 2VWSA 3KPOB 3TFBA 5LGZA 1IQYA 4P61A 1NDVA 4Z7NB 1LQ0A 2OKOA 5TPWH 2DQUL 2Q76B 1BD2B 4IMEA 3GZQA 3NM1A 3BEWA 3DFYA 5IHRA 5CEXA 4YCPA 2EVFA 2XN9D 5MENA 3L5XH 2PCFB 1CK0L 4ENEC 3UYPB 3R94A 2C7UA 4NL1A 3P4MA 4O4WA 1LZOA 1BPLB 4QCEA 3PV6B 1EDHA 2A83B 4LAJH 1OF6A 4DAGH 3NVDA 2QJIA 2KZHA 2W5FA 4O15A 4M9PA 1N7OA 5I8CB 1FFPA 2IH1A 1IFHL 5H94A 3RSYA 2FDSA 5SWSD 1TZ9A 5GZNC 3GAKA 4PULA 2H9GB 1V05A 1J2WA 3EYUL 3PDOB 2CO1A 1MUJB 4XPAL 4Q8TA 5HPCA 2NY6D 4LPXA 4Y5XB 4MADA 4F0HA 4EF9A 2ZOWA 1SO4A 4PE8A 1V8EA 5M17A 2VLME 2VLJD 1GYLA 3ZBMA 4S3FA 3ASNB 4G1EB 4HK0B 2FPTA 1EF2A 4K3JH 5JIIA 4RA3A 3QB7C 2D9QB 5EG6C 3HC3L 4EAEA 2YAHA 1BVKA 3L3OA 1UMLA 4AHOA 3JTTA 1YEYA 4ZODA 3OC8A 2EH7H 2NR6A 1I82A 3VTAA 5E5MB 1JNJA 1W2PA 5E0KA 3T3PE 3W2NA 1KMGA 2UBPC 4OQTL 3GS0A 4MAUH 5CC6A 4MZRA 2JJWA 1Q1PA 4E9SA 3IIOA 3CFIC 1AGFB 1R2RA 1J8VA 2Y2TA 5CLYA 1QO2A 5IVNA 3ARWA 5IVXB 3CVHB 4LOEA 3CJJA 2WVYA 3AM8A 5DLML 1AE6H 1P7HL 1C9SA 35C8L 3IMRA 2AJVH 5K9QG 2KL6A 3EA1A 3RYSA 2AJSH 4LL9A 4V1DB 5D6DC 1SY6A 3H24A 1NY1A 4YUEL 3X2QB 4HK3J 3G5YA 3EYFA 4J23A 4P9MH 1UGNA 3I6KB 3KZ8A 1BXUA 1A1OB 1SJHA 2D3JA 1CXHA 1CIDA 1SJEA 3P3UA 2VOTA 4OJZA 5CILL 1GA2A 4UQ3B 4KZ0A 1UVQB 3TFXA 1BZ9B 2VEIA 1IIHA 3P73A 3CH1A 4U1IB 1RIVH 2AMXA 2NZ1A 3WLOA 2IQTA 3KZPA 1O60A 4HG4K 2LU4A 4FMFA 1XGPA 3IDGA 5B38A 1AQ8A 2Y7QA 2K8QA 2X3BA 3EUUA 3M1CA 1IFHH 4QT5A 4IGBC 4UB9A 4Z7QE 2HVJB 2DMGA 5EZPA 1IGJA 3VFGL 3WQGA 2F8IA 3MWCA 3K30A 3EYUH 2KLTA 4PFMA 4K8EA 3GS6A 4XPAH 2WQVA 3SDDA 4ISVA 1BSIA 4N8VB 1QOXA 2FWSA 1HXYA 3MKCA 4YFLI 4A2MA 4KUZL 1S9XA 1MRQA 1FY6A 2EDLA 3DSNA 4NGHL 4RSVA 4ZNCD 3WJLA 1WT5C 2V2DA 4B5TA 5DA0B 1JHTA 3IJYA 1UT2A 2VLRD 1S9KC 3ZJ6A 2VFHA 3HC3H 4G8EA 1PYFA 2XXFA 5AOIA 5DS2A 5EBMA 2RH0A 1NANI 1ASPA 3ULVC 5TE6L 5I0YA 4RZKA 4UAHA 1PKQE 3WD3A 3N55A 1JK9B 4OQTH 2QQ6A 3W7KA 1BXAA 1MDTA 2KZBA 5ICYB 2HLAB 3MRPA 3AIEA 3EGJA 1I53A 1MIEH 1BBJA 3ARGC 4LCSA 3H26A 4ZQNA 2WXJA 4AD4A 5DS8B 5JZ7C 1G6RB 1FL6A 3MFFB 1S9YA 4H8WC 5IWLA 4LGRB 3I2CH 1ROCA 4NUQA 2J5LC 4U6TA 4DBEA 4IWWA 3QZAA 3LX9A 1F73A 1DANU 4WHYH 4BCXA 5JMOC 3T2LA 2WZIA 2G5BA 5IM51 3FTYA 3BKYH 4FG0A 4LOUD 4X61A 4XP9L 3BW2A 4HWUA 1DJNA 2F9RA 3VOJA 3G6DL 4YXLL 1ACYL 2FIRT 3FQ4A 4LNRA 4MMZC 5CILH 4M4PA 5DS1A 1H50A 4GYKA 1SJVA 4GQZA 3EKZA 4OHQA 4OV4A 4YLCA 4WQ6A 1CLZL 2DZUA 4HSQA 5LJYH 4KO9A 2FZNA 3VH8G 1LXKA 3MODL 2DWSA 2AANA 4TX6A 1FRGH 3MRJB 1ISWA 2BNRD 3P9MB 1CXKA 5ESAA 3RWIA 4O2FA 3F85A 3LKOB 2XWEA 4DI8A 3ZL2A 1ZD6A 4B60A 1D7KA 5EBLA 4JEGB 3SRFA 4OLYL 1VJSA 2Z8WC 1KRBC 1K2DB 4H26A 1LL6A 1MYRA 3ZT6A 1W0MA 5A6KA 3W9DB 3MRCA 5FJIA 3ARDD 3ZKSD 1W1ZA 4A7GA 4NXKA 5F7EL 4B9JA 4XZUB 4KUZH 3STBA 1KIUA 1E0XA 2GSIA 2OQJA 2OR9L 4NGHH 5HXMA 1DN2A 1HHIB 4QTHA 1P5UA 1K70A 2PR4H 5K1VA 3U82B 4JRXE 1XGRA 2ADAA 2I7SA 1PFOA 3FIGA 4R7LA 1H8LA 4MD4B 2WVVA 5TE6H 5FF2A 2BS8A 3EFFA 5FGSA 2YO3A 2H3BA 3TSDA 2YAPA 3DJSA 1LE9A 2JK5A 4ELKA 2CSPA 3VILA 2E5CA 3G5XA 4Y9FA 3AY4A 2H6UA 3ARGB 1PEZA 4FQHA 1S3HA 5HR7A 4BSWA 4GFIA 2FT6A 2YBTA 1IFRA 2Y25A 3TF4A 2QGYA 3PAYA 5AALA 3AMOA 1JQXA 2OXGA 3U4EB 2J5LB 3C5ZC 1N8WA 2WOFA 1VERA 5B7EA 2OW7A 4MMYA 2XG4A 3HNSL 1XP3A 4J1OA 1QTSA 3Q0HA 5BOFA 2ZP0T 3SDCC 4NO2B 2J5WA 3GR7A 3TQPA 4YXLH 1ACYH 4IBSA 3RCYA 3MBDA 4C7DA 1S39A 1W80A 5IM7A 3HR5A 3CNKA 5CJ8A 5FIPA 1LDCA 5J13C 4O0KA 5T33L 2X03A 1CDJA 1WIPA 3GB7B 4MMZB 1QFOA 2P8PB 3U9UB 2X5PA 4JG0L 3G18A 4P04A 1HXKA 3IIZA 4EI5C 1LJMA 2P7TB 1KGXA 3W1TA 1A4KA 1TEFA 2EXTA 3LEXA 4UTLA 1OIOA 5L4JA 3NDOA 3LYRA 4WY7L 4OLYH 5BRZB 4NLHA 4HCHA 3T09A 2WSRA 1IFGA 1BD0A 4DESA 5CBEA 3GVGA 2C1HA 4URKA 4YDNA 3AADB 4P7QA 3A13A 1GW1A 1SVBA 2UZYA 1B4RA 4F8OA 2ZQKA 4XX6A 4K9EL 4PB9L 4QM1A 5G4EA 1NDYA 1D7CA 3T0EE 1DO6A 4DBUA 1RPKA 4J3WA 2GUUA 1WE5A 1HJXA 1Q85A 2N0KA 2IH9A 1A9EB 3IE9A 5BOPA 4XO9A 3TNNB 3W73A 4KNSA 1HG3A 3FRPA 2EIEA 3JWDL 5KSAA 1UA6L 1U8NB 3B7UX 4XGZB 1JGVL 1V6WA 4LSVL 3HC0B 5IK3B 4P5SA 2E1DA 3A3HA 1B0RB 3MLUL 4I4WA 1PDYA 3AJ7A 1W3KA 4N4QA 2DKUA 4Q6YA 4RISL 5SX4I 4XP5L 1CICA 2ISSA 1O5KA 2YD3A 3RVXC 4NN5C 3R25A 2ANUA 3WNKA 4OCMC 3TVMD 3UTSE 3IN0A 3WDIA 4U5IA 1X6NA 3VUPA 2KZWA 4WK2B 3CUPA 5I9QC 1J86A 1RAMA 1DBTA 1G7JB 2R9RA 2TMDA 1XTLA 4ZNEA 5HY9A 1O94A 1WV2A 3C5ZB 3HNSH 2NUYA 5IW1A 3D2UA 4ONOA 1MFAL 3LS5L 1FDLH 3R1GH 4J3OC 3FT1A 5A8GA 3SDCB 4EN3D 4LWWA 1VF5C 5E9AA 3OAYK 2OZ4A 1YJDC 4LIQL 5T33H 5HYJB 2CFKA 3NXLA 5J13B 5KG9B 1QLFA 1VHNA 3FSVA 3KX6A 3TCSA 3X1BA 4CNPA 4FOJA 3BISA 3SB3A 4KJWC 2WLMA 4XXWC 2X30A 4TLTA 5CZJA 4IIFA 3NA4A 4YR6B 1MCLA 4EI5B 2DSUA 2J8OA 3CFCL 5CU5A 3X13B 3TCLB 1QPOA 3OHXC 2QJHA 4ROQA 3MREB 1IGSA 3HBPA 1F13A 1BAWA 4ZO9A 3IU4H 1KYAA 5F9WC 2NY5C 3QAQA 3UVIA 5D9SB 4HJEA 2DT0A 2BC4A 3S2JA 4X63A 2CE6A 2LU7A 3QEGL 3UP6A 4EF8A 2GBTA 3MRMA 1AZ1A 4LGXA 1JIBA 1YX1A 3H3BC 2GLKA 1XYZA 4K9EH 5AAWC 3NBJA 4A3YA 4PB9H 2LOEA 4Z6AT 5DJZA 4A68A 4JR9L 3BVDB 3GXIA 4F80A 3N40F 4P2OC 2XQ0A 4XAKD 3HFYA 4JN1H 2PF8A 3DESA 2J1XA 1T04A 3Q2LA 2Y1HA 2YPLD 1B6UA 1KBGL 2YYTA 1T5XB 1FZOB 5G4WA 2YX0A 3JWDH 2EXYC 4JZJA 4JHAL 5AOJA 1Z0NA 2WHKA 3UJ2A 3T0WA 4FKEA 2ZSWB 3MLUH 3HS0A 1SO6A 4WEVX 2VDLL 3WDHA 3NPZB 4KKZA 4RISH 2CQTA 2ZD0A 4DPCX 3TSBA 3S4SA 1W1PA 5IFJB 3LZNA 1E3FA 4NN5B 2A5HA 3ZE0F 1I1YA 2FDBP 3EH3B 5CLWA 5M3WA 2EQDA 2A9CA 1MSPA 1ED3B 2B0SL 3BLPX 2EPHA 4BZ1L 1ADSA 1MRFL 4HUUA 2WCOA 2YCKX 5I9QB 4JEQA 4CD7A 2QR6A 1G7MA 3HGSA 4OZGE 1MFAH 3OYXA 3QQ4A 4CW1A 4DVBA 3GC5A 2JIWA 4JY8A 2R4RL 3WLQA 4YEFA 2X1OA 1MIML 1OP3K 4W8BA 2WTOA 1JAEA 4LIQH 3X11A 3E02A 4PUBL 2O61B 1OHZA 1CECA 3EOTH 1NC2B 3II3A 1DQIA 2XWTA 4GVFA 3I02B 5E9XA 2OMYA 4OBSA 1KW1A 2X4UA 4QXUL 4HK5A 3KGTA 1XXDC 1QLEB 3SQRA 4JVWA 3UZJA 4YDVA 4HUCA 4HN4A 2EKSB 2GBUA 3TR9A 5ECVA 4ATDA 4CQDA 4DPQA 3OHXB 1Q9OB 3GDRA 3OKDB 4NBYB 4TU1A 4KEUA 2N3JA 2WCSA 1LOSA 4GG6B 4G5AA 2BV9A 4XSMA 1EIXA 4ZTOL 3EO0B 2RUSA 4JRXD 3IDJB 4YIQA 1V03A 4MPQA 1AW2A 1NGZB 2VR7A 1QWGA 3X14A 3L3GB 4JR9H 5A3IC 3VXPB 1U92A 1WOAA 3DOPA 1KN4H 3OVGA 1FZJB 1TWZA 1W72L 3NDYE 4P2OB 3QJAA 1CTNA 3ERXA 5FYJH 1I3GL 4JVPA 2COQA 5J1AA 4FNTA 1G9NL 3ZTDC 4JHAH 2WLNA 1ITCA 1OM3L 3W87A 5F7DA 3H22A 4IS6A 5HHNB 5E8EA 2VDLH 3ARBA 3O11A 3G7TA 1TMQA 3RYMA 3JZ7A 1CL7I 3UTQA 2VZUA 2BIOA 5M2FX 2BFGA 3WKQA 1MWAA 2F58L 3MC5A 1SPDA 5GSVA 5HWNA 3ZN6A 4LLUB 4N9OB 3F84A 3RTQA 2XFFA 2L8AA 2DTSA 1MZHA 1QBLH 3GUTA 1LVNA 5J06A 4KQ4H 3HS9A 2HG5A 2WOHA 4UCFA 4KDWA 1ACZA 4Z7NF 2I9UA 2NSXA 2JKWA 3SJ3A 5FKPB 1IU7A 4BY3A 3LTSA 2GIMA 4NHUA 4O13A 4RGNE 5ABEA 1YAIA 1XBVA 4OV5B 1OOAA 1S8DB 2R0WH 3KGSA 1SZRA 2R4RH 5MEOB 3WIRA 1DQLH 1MIMH 4IBUA 2RCSH 5JOFA 3QDGD 3S46A 3NZPA 4PUBH 4HK6A 2IS7A 2EDFA 5C3LD 1KSIA 2JTDA 3KWSA 4PUEA 1RZ8B 5I3HA 3ECWA 1IM9A 4QXUH 1OO2A 2EPMX 2WTPA 1UH3A 3AUWB 2IPGA 3HPXA 3UBXG 1MSSA 1EGVA 3RVWC 2FQIA 3W7HA 1GGYA 1FCGA 1NUGA 4RFOL 1FFNA 4HFUH 1KJ2B 1J10A 5LGHL 1UBPC 2E22A 3MLZL 2CALA 1A6WH 4REQA 1HWHB 1OZTG 1N8ZB 2W38A 5E94A 5TF1L 5C71A 3RZCD 4MPKA 3OXRA 2KYIA 4NZ8A 4OK4A 3X3ZA 3Q9PA 3QIBA 2OZ8A 5J6GB 1U93A 4QISA 3ARRA 3AZRA 4QF1B 2O9PA 5HQMA 3NH7H 2MPAL 3B2MA 1BF2A 3CX5J 2H7WA 1PIFA 2CHDA 5K9OB 3SY1A 3T6XA 5F7LB 3C8FA 3QKZA 4JQ1A 5EO9B 2IXQA 1Z69A 1W72H 1B4LA 5EEYA 1IV8A 4JQIA 2A6DB 4P23C 3L2LA 1GG0A 4U5KA 1I3GH 1HCYA 1J0NA 1G9NH 5JXED 3GZKA 1S7QA 1OM3H 4QRBA 3REWA 1M56B 4MA1C 3SKNB 4RNRA 5H37A 2Z92A 5HHVH 3W11C 1UZ6E 5IVXF 4ZTPH 4IIQC 4ZB0A 4W9LC 4M93C 4L8CB 1FHDA 2F58H 1LO0H 4PMNA 2H4EA 4EUPA 1F05A 5JTWA 1OV8A 4AL8H 3HB3D 2XY2A 4YBHA 3P0WA 1N0XL 5KUKA 2ICWI 1SHXA 5DZNA 2OYLA 1O7SA 1UC4A 4JO3L 4LOFA 1HZKA 2JLLA 2JMRA 4YTQA 2NY2C 3GG8A 2QPXA 4X5WB 4HB7A 5BUPA 4DBWA 2Z1XA 1F4HA 3GQFA 2HTMA 3CDCA 5AZEL 3QEUB 2WSKA 1SXSA 3WBDA 4AEIL 4BI5A 5CH9A 3WN5A 4O18A 2HA1A 1EAJA 3UA3A 1V0LA 2A2QT 3KBPA 4PIRF 2J66A 1YPZE 4XZNX 4D6DA 3G5VB 4KMLB 4JLRA 5J6SA 2IBBA 3NJMA 1X8FA 4LLMB 3WK0A 5ERWB 5AZ2L 3IAGC 43CAB 5FK9B 5CLZA 5C0RL 2ICWA 5G2IA 2Q8XA 1KKOA 4I6KA 5LGHH 1I9EA 3NZGA 4J3TA 1S4IA 2IG2H 1E6QM 5TF1H 1NJ9B 1A4JB 1GPOH 2YRBA 1LLZA 4D8PB 1SR0A 5GHWL 4R96B 1ALDA 4GUQA 3O9WA 5D7LD 5G1TA 4F8PA 5BVJA 3RDJA 5ABTA 1WFTA 1GY2A 3MA7A 2PDMA 2ZZ4A 4N5EC 3SGJC 3GYCA 1ZA6A 1PU4A 3TPKA 3RRQA 4U1SA 2QJMA 3WIHL 4R7DB 5DEFB 2WMPA 4S1DD 1UUSA 5BUGA 4MAYC 2CFWA 1DVUA 4L4TD 3MYOA 1ORSB 5K69A 3RGTA 1GJIA 1NCCL 4P23B 2YD2A 3DO7A 3L4VA 3ZIYA 1N2RA 5BVPH 1NKRA 3TC6A 3WS3A 3GTNA 3P9LA 4P2YA 3B2PA 4MA1B 1Z42A 3NSNA 1ISXA 2A6JA 4PR4A 2BOBB 3W4RA 3LLFA 4KY1L 1PDZA 2XETA 5HHQB 2PDHA 1WHOA 2Y06L 1EAPB 2YZ8A 4IIQB 1FA4A 2WJEA 1F6PA 4M93B 4CCEA 3KWWB 3TEXA 3EYVB 5ALBL 2C6QA 5FUOL 1TX0A 2IALA 3LA4A 5LUMA 4F4RA 1ITXA 2F8QA 4QRFA 1X7SA 2WNGA 1AODA 2RGLA 4BK4A 4JO3H 3CIVA 1V7NL 3LIUA 1JK8B 3SCMC 5JHBA 1QI2A 3DGDA 5A43C 3GWJA 5GRVK 3RWDB 1AKJD 2XTJD 4ODTH 2NY2B 1CZ8L 5AZEH 3WUGA 1NMAL 4OZOA 4Q4RA 3TO4C 5CSZB 4AEIH 5IKCA 2MOQA 5DLLA 4QHRA 1A3WA 2AERT 1RKRA 1SZEA 4JO5A 3UA4A 1OB1B 3ZE1E 4IPLA 2AP2A 1EP2A 1RR2A 3T3ME 3NBBA 1UJTA 4EIUA 4NZUL 4A7QA 5I8EA 5C0RH 2JLPA 2H9AA 2L7JA 2QJDA 3UG8A 1OW0C 5DUPL 1Z1WA 3CDGA 2LQRA 1JPSL 3VMNA 3PP3H 4DKDC 2VABA 5TE4L 2YZ1A 4WOZA 4GYBA 4Y89A 3W9ZA 4XVOA 3GIVB 3D69A 4R3SA 3PC0A 3PPCA 2WKGA 3DVIA 1KTNA 5DXYA 4CC4C 2ADIA 3QARA 5IHLB 1ME9A 4OLVL 2A4EA 1MQKL 1XGQB 3BQUD 5GGSA 1QI4A 4X9YA 1QU4A 4WVXA 3E8UL 5A2JH 1B2WL 1H7XA 1T22B 1JGDB 3WIHH 2X4TB 3U4KA 3EKGA 5I2IA 3WMLA 2J4WL 2HPOA 2AAVA 3GK8L 4MAYB 4CKVX 4W9TA 1CTMA 3TYUA 3MMWA 2Z7ZA 1NBZA 1TCMA 1FP8A 1H49A 3T1WA 2PYEB 5IW6B 5HJYA 1MH5A 2V5RA 2ZUYA 3LCIA 4KFPA 4MSWB 5HVFB 4KY1H 3QS3A 1BMGA 4NQDE 43C9A 4JTEA 2W65B 4BFIB 4S2CA 3FB6A 2DEPA 4B96A 4FIRA 4EOUA 3TTSA 2C34A 2IBGA 3M88A 4LPUA 1RL1A 1JGUL 5FUOH 1U8HB 3CC5A 1NPNA 3L81A 1EXUA 1XF2A 4HALA 2DYPB 2VXSL 5E0FA 2EAWA 4JM2D 1V7NH 3X41A 2UXTA 4R8WL 2IKHA 2JF7A 4Y4KD 5CP7A 4Y2OB 1SF5A 2Z31C 3SCMB 1CZ8H 5FFOA 1VPXA 5DZPA 3N1MC 3H7LA 2XV6B 3S3CB 5DK3A 5BU6A 1NMAH 1KIRB 5H1WA 5CC5A 3VFLA 3BHBB 1R5IB 3KBFA 4NQCB 5J56B 5J9PA 5EA0L 3SE9L 4PJ5E 2X6CA 3LQZA 3TO4B 3MR9A 1EDYA 5FA4B 1V7WA 3KXFE 1XGUB 3PRZA 4O02B 5FYJD 4JZNB 4XAFA 4DZBB 4L9XA 4FFYA 2WDAA 4XVUD 4NZUH 1MY7A 2W0UA 4NUMA 3I7QA 3P4LA 4PTNA 3TEZA 1U8OB 4H4IA 1JPSH 1CGVA 3O6KH 1YRRA 3MO7A 4JKKA 5TE4H 4XVTL 1IM3A 3GBMH 3BWAB 2ZJSL 4B9CA 3UTSA 4FAMA 3RY6A 2AKRA 3MYJA 1D9KA 3ZL4L 1AUSL 2WJDA 4OLVH 5SWQB 5IQLA 3CVDA 4BDVA 3AT9A 2R0KH 2VSDA 5HGBA 4YLQT 2YXGA 1V3LA 1OF2A 5K1NA 3E8UH 1B2WH 1WXJA 4AC2A 3MCOA 5CSRA 3PP4L 3NZHH 2HMCA 4PGLA 4FNQA 2VISB 5D7KE 3VNMA 3IDXL 3VB9A 3O2DH 3KM1A 4J3ZA 7TIMA 2WQWA 4X6BB 4HU3A 4G82A 1EIBA 1KENL 1XH3A 3GK8H 3GH7A 2VP8A 1GWJA 4NJKA 1E28B 5DRXB 1GMIA 3H55A 3MZGB 1WA2X 5ID1A 2Y62A 1R5WB 4MDJA 3TJ4A 3QJRB 1TVBB 2BY0A 3IGLA 2MUCA 5A40E 2W81C 5CS7A 3QE5A 4P9HC 1I1CA 4OTXL 5H4YA 1JFQH 1TYJA 4E41A 1W56A 3GI9L 3QYQA 5JHLL 3AI0A 2JELL 3QR3A 1JGUH 3MV9B 1QWKA 1ETA1 2QBWA 2IEPA 3TQKA 2J56A 5HI3D 2BIHA 5AW7B 2HBXA 3RZWA 4EBQL 1JF6A 1H11A 4UQCA 3GUGA 1JZ2A 5HNUA 1PZ1A 4NIKB 3B34A 4GQ9L 1GHSA 4R8WH 1L9NA 3SECA 4QWWC 3KPRD 2WWCA 1AR1D 2EDRA 4RH4A 4YSQA 3GNOA 4X99A 4K2UL 2Z31B 4NSBA 4WHYG 4V33A 4TUKL 4P8WA 1PX3A 5KVFH 4AF0B 1MPAL 3N6JA 5EA0H 3MRQA 3C2YA 2G60L 1XBZA 3KPLB 5AEAA 1FWDC 4ODWA 4HKBB 4L80A 3BP6B 3RBSA 3FO0L 2X42A 3L3JA 5FAGA 2VLJE 3PWUB 4IK7A 5IDIA 2WIIA 5CCHE 4DK5A 4XVTH 3H4FA 2UZXA 3HBQA 2ZJSH 4FX5A 2VR4A 3QS2A 4PJ6A 7FABL 2IBZX 1CDIA 2V5JA 1XEDA 2CHZA 1QVOA 2A9MH 1DEDA 3LGDA 3R18A 4PRNB 3TBYB 3CUJA 3PBVA 2JCWA 4LXFA 1SUXA 4JPWH 2OWWA 1INEH 1B90A 4P4KC 5EU6D 4XUYA 1PSKL 1O9ZA 4E5XA 1XIHA 4JEJA 1JPGB 5LNEA 5GGSY 4UAOC 4HAGA 4GZ7A 1PCKA 4Y5YC 3L1EA 5REQB 3PP4H 1T0MB 2FJFA 3TYGH 2FL5A 3EJUA 1F1DA 2QVKA 2HKFL 3M0VA 5KBNC 3IDXH 4XBGB 3NQFA 3V9EA 1KENH 3NL2A 2QV4A 4IEFA 2G96A 5E6YA 2GT9B 1O4UA 1EBPA 4KFNA 2DWXA 2IDTA 5H2BB 2OQLA 1QR1B 1HI6B 1TQWA 4HC1L 3V8OA 1TPH1 2HT4C 4LLWB 2DI7A 2C9SA 4Q9CA 1L8NA 4P46C 3FQUA 3GI9H 5JHLH 2JELH 3MRLB 2VM9A 4EBQH 4PH6A 4DZ8A 2YD9A 4ODUA 4FHAA 1FORH 3PZTA 2O5YH 4GQ9H 5GGRA 3ZJAA 1KCKA 4H7CA 1J0IA 3BUYA 4DAFA 5FM8A 4J3OF 1NLDH 2F1BA 1RZFL 3CXOA 4WI9A 4ZXBA 1D3GA 3GO2A 4L3EA 3T8VA 3VE0B 3VWKD 1PF3A 1GH7A 1JZEA 1MW3A 3F05A 4W6XB 2I5IA 2ZZ1A 2XG5B 3DUUB 1TA3A 4WDWA 1XYMA 2G60H 4QLLA 5DI8A 4RAUA 3DZ1A 3O7UA 4WI7A 1N8OE 3GC2A 2TRHA 2P5WD 3APDA 4L18A 4HJJL 3GNNA 4BZYA 1IRAY 4ZMNA 3FO0H 5EF0A 3W28A 4TVPH 4ZAKC 1GRWA 3QMRA 3RX8A 1K4DB 4ZFQA 4M4RB 3VFSB 1PKNA 2VDIA 1J93A 2ZF8A 3ONBA 2VLRE 5J57B 2A73B 1AR2A 2Y6TE 4GG6F 4CNNA 4M8VA 4O2CA 4DJDA 4LY4A 2YRLA 4PBVC 1LURA 3NMEA 5M95B 3U0TB 4NG3A 1Y0EA 1AVLA 4WDIA 3G0SA 4P4KB 3S42A 4U1LA 5D1ZI 3CFTA 4S2SB 3ZE0B 1E4LA 4UAOB 4WEBL 4PMYA 2HKFH 3AMKA 4QHNA 3CYVA 2Q8AL 3O6LL 4YHIB 3ZY7A 3K2IA 2I9TA 4DYKA 1JBJA 1F4XL 1P9MC 2ISDA 5D5MF 4GY1A 3V7PA 2G3MA 2XTKA 4CNSA 4AIOA 1DVFC 1RURL 2O5XL 1WBYB 3P3TA 3NVTA 3IVKA 4K36A 2EDJA 4H0LC 3S0CA 4UZSA 4AX3A 3OKYA 1HILA 1V3IA 2Y0FA 5EU4B 4XPTL 3QLDA 4JL2A 1VFLA 1U8MA 1P7KA 3U6RB 4JY5H 2KDGA 3AXHA 1TJRA 3W5NA 2ALAA 2P26A 4LMQI 1A5CA 4D0CB 5AHFA 2BSED 2VZ3A 4P46B 4G8IA 4JFPA 4CC1A 3O3AA 3L66A 6PTDA 1MO0A 1WAPA 3QUMB 5CZXD 5BRBA 1ZEAL 4RNJA 4XO8A 2FH6A 2ZKHL 4GAAA 3HQOA 4IBZA 1VZGA 1MAKA 4AD3A 2BNRE 4ETYA 1QOKA 2YB4A 4HJWA 3S0PA 2PZ0A 3QC5X 5LWYH 5EU3B 2FB3A 2UY6A 4H9VA 4L6OA 4AQEA 4M81A 3EZJB 2EE2A 3LKSA 3KYMB 1HP5A 3HFFA 2J73A 3VVWA 3SXXA 3BIKA 3ALAA 1DCLA 2Y63A 3DVGA 4XAWL 3SUVA 4KJPC 3IJIA 1IAOA 2IAMC 1JXGA 2X6AA 5DJ2B 2VRJA 4IOIB 4G5DA 4R88A 4NRYB 2VDKH 3OEXA 3UPBA 3J2PA 5I16B 4NNXB 3B9KC 3NCFB 1UM6L 5F0JB 1UZHA 1VLIA 4ZAKB 1RJYB 1RHCA 2OFJA 3M17B 1KZYA 3IXTB 3WQFA 2O4QA 1UH2A 4WNQA 1TXKA 2NQDA 1CFTB 4MCZA 4MWFB 1VCBC 4F0LA 3KMDA 1XF1A 2AZAA 3LKNA 5T1LB 3QQDB 3A4XA 1G4MA 4XHJD 5EZLA 3W1ZA 5CHNB 1URZA 2KS0A 1HN1A 4O54A 1HXJA 3HE7D 1RCQA 5A2FA 1UYQA 3EWZA 3NIYA 1POJA 3ASWA 3LB0A 2Q8AH 4YAQB 3O6LH 4I3SL 1W0VA 1CD9B 1OTTC 3C0SA 4WK0B 3KLAA 3N1GC 3QUGA 4S3DA 1F4XH 1ZLVK 2HT2C 1FVCB 3C5JA 3EHBC 4RNFA 1WLHA 3FSZA 1J5DA 4ZFGL 2O5XH 2BNUB 4NPYB 4U1NA 3V1PA 4XV0A 1DVFB 4XPTH 1EEYA 4YYCA 2OX1A 3B0XA 4WJEA 2O9RA 1WBJA 1IC7H 3ZJ7A 3CSYB 4O1FA 1F4AA 5FM5M 2NNCA 3WELA 3F65A 3H56A 2HWZL 2E2TA 1F42A 2R1WB 2V3DA 3EOUA 3TN0A 1XISA 3GW0A 2V9RA 4BE6A 5DZ9A 2A85A 4W9GC 4DN3L 5C08B 5DMGD 1UUMA 3H70A 3BIBX 1KB5B 4PJ7B 1OD9A 3K91A 2J8UE 2AQVA 5DR5H 3TNOA 4IP5A 2YD4A 1YNPA 1GCFA 4Z7AA 4XAWH 3GLDA 3ZR5A 4M7LT 3MV11 4AH2B 2IAMB 3BZFB 3BOLA 2B1AH 3II2A 2VIRB 5BO1L 3AABA 2DSWA 3MJGX 5AHIA 1UM6H 2V5SA 1OACA 4F7CA 3B9KB 4YZFF 2ARJQ 1H6UA 3SY5A 3DI3B 3BWSA 2FH8A 4ZENA 2ATPB 1ZLUH 2OMXA 4LKCB 4NDMA 4JDZA 1EF3A 1R34A 5AW2B 1VKFA 4MJJA 3SRHA 4LEFA 5MEQB 7PCYA 4UQ2A 2WXFA 3BRFA 4FI4A 3IDNA 3CBJB 2A6NA 3BX7C 2MQGA 3NYKA 2AEQL 1ADOA 4JJ5A 2AV1A 3HI6H 2BJML 1XC6A 4KNUA 4KKNA 3SBWC 4KTRA 2BZDA 3MUZ1 1OSYA 5AG9A 5HI5C 1T0PB 3ALGA 1DYUA 1ADQL 4OBRA 1BA9A 3NG3A 2V2XB 3VRLE 1KPRB 5E9DD 2DQUH 4I3SH 3HOGA 4AYSA 4M6ML 1IGML 3TT3L 2TPSA 2NQ3A 3BP4B 4ILSA 4HETA 2GPZA 4X6FA 1CK0H 4EI6A 1TO4A 3TZVA 4ZFGH 5GS0L 3EHBB 3GHPA 1Z5HA 2QIIA 1XTMA 3RJOA 4XZBA 1M6OB 4KTEL 1GTHA 2MQ3A 4FERA 3TIEB 1JN6A 2IPJA 3Q94A 4BKNA 1ECYA 2BG5A 2B20A 2BP1A 3TJXA 4QHLA 4Z7IA 3X1FA 2HWZH 4KWVA 4QJ5B 5FA5A 3VWJC 2IKGA 4Y2DC 5ENWA 2WZ5A 4DN3H 1I8IB 2Z35A 4RA0C 4AISA 2FEDC 1A0QL 1NCHA 4QNPF 5KZCD 1BXCA 3D2TA 1XBYA 4ADGA 2INEA 4MZ8A 3DIFB 1QBML 4US5D 1AQHA 4H7ZA 3U5YA 3DX4A 4BBWA 1BVLB 1FWCC 3OA3A 4YHKL 3GFZA 3QYCA 2HAZA 4PYGA 1KM2A 3TMLA 4HJUA 1WTLA 1MELA 1ETJA 3MTXA 3PTKA 5BO1H 1YO4A 5I66B 2J6EL 3OTTA 3OKLB 1HSAA 5H35A 1QATA 5I2UA 2R23A 5DQDL 5FYKL 4JICA 4K73A 1XLFA 4D71A 2HN7B 1YNKL 4NJGA 4XAKE 3OXSA 2E7LC 4GIPD 1A6TB 2WWKT 5GS1C 2YPLE 5KS9F 2NY7L 1KTRL 5D30A 3RVUC 5L2JB 3AY2A 2AEQH 5DLMH 35C8H 4X9SA 2PLMA 2V4LA 3VD2A 2NUXA 1GS8A 4HIEB 5DHEA 3UTPD 5HYSB 2CZ5A 3PWJA 1MMXA 2EBNA 5IUSA 1MCWM 2POZA 5EHFA 4QG9A 3B05A 4YUEH 4NO0B 1IGMH 3TT3H 1C92A 4X4ZA 2X7WA 5HMFA 3MXWL 1I1FB 2GOKA 5D7IE 1LL1A 1WO2A 3E6HA 1MAML 3S8GB 5IUCA 3K71A 2GUBA 4KTEH 3QNYA 4IMLA 4PMUA 4O28A 4TVPD 4NO5B 4PJEA 2PCEA 3VNKA 3RUGE 2Z24A 4K39A 3VRJB 3NCYP 1L9MA 4I5RA 5DHVB 1XUUA 3RY5A 4YHPA 3P62A 4Z1BA 3EMZA 5JW3L 3VFGH 2H1PL 4FO4A 1ZE3C 5F97E 3VWJB 4JIEA 1MDLA 4Y2DB 2IQAB 4QP0A 1E9IA 5HGDA 4R84A 3M9YA 1QBMH 4ZTEA 5AYXA 1UOWA 1FUNA 2B14A 2VITB 4Z3GA 2E7CA 1O6SA 3L5IA 3O41B 3N13A 4EMZA 4YHKH 3LNHA 3LN4A 4N0CD 4WWKD 3I4EA 1GVOA 3AGWA 4J7RA 2APFA 1FHVA 3HGOA 1HO1A 1FXPA 4B41A 3NDZE 4UM8A 1SRDA 3BPOC 3FYYA 5BZDB 2J6EH 5AB1A 3KCWA 1QK2A 4E9WA 5DQDH 4W4OC 2VUYA 4WZHA 2XN9A 4ZS7L 3L3KA 4KK9D 2YGOA 4QRRA 3WY2A 4NHVA 1WFMA 2DICA 1PJWA 1F3XA 2NY7H 4YHOL 2AK4D 5GS1B 5K59F 5EBWB 4ZUTB 1FHNA 4LRIC 1AANA 2FZBA 1N6QL 3VGBA 1QACA 1V54B 2OXHA 4GFTB 4X4XB 4U1KA 3ULVL 5SWSA 1RZKC 4KTYA 1XGZA 4XMLL 3RY4A 2C1PA 4RAHA 5AW0B 3E0GA 3NJVA 4XP9H 2YGVA 3QYSA 4JQVC 3NQ2A 3G6DH 3QYMA 4AGQA 1PFCA 4YC2C 1OTSD 2FVNA 2OS7A 1F41A 3PXHA 3CWHA 4DP7X 1QNOA 1BGGA 1E0WA 5JHDD 3OB0H 3GU2A 1NP0A 2VLJA 4N8UA 1CLZH 3QNZB 5LBSL 4DXVA 3MODH 2K8MA 4OOZA 4K9JA 2WCAA 2QLVB 4MCNA 3DMMA 3QDGE 2PP1A 3JQOB 3VPLA 3GMMA 2GK0A 1TZ8A 1HFBA 3CPLB 1KQYA 5EN2B 3V7MA 5H6HA 2HH0L 5TDPA 2BHZA 3WQ5A 4NZFA 3EW3B 4ABQA 3NFPB 4BFAA 2QCDB 4XZWA 1FJ1B 1IT8A 5EU7C 1IXQA 3SN1A 1ZVNA 2R1NA 2ZZ3A 4MMIA 5F7EH 1AQ0A 2QJNA 4S0TD 4BA0A 2PTDA 1QI5A 2CXEA 3V5DB 2OR9H 4KDTA 4BQ6A 2QCLA 5G1YA 1J9RA 3NESA 5LGKA 2X6MA 3QFGA 4Y4FA 1UR2A 4A2FA 1T1XB 1R7AA 3O3DB 1OCQA 3GFYA 4XTRC 4C4UA 1GHRA 1XSJA 3BPOB 1RA5A 4NFDA 5FDWA 1OAYL 5JA8B 1RBAA 3C0JA 2YW4A 3V5CA 3EDKA 1A80A 3AOFA 4DZAA 1KDJA 2WM0A 4L56A 4ZS7H 3AW5A 1CFSB 5T1KB 3X3XA 1WYIA 3PZMA 5TAOA 4CC0A 4YHOH 1ISVA 4S3JA 3US1A 1BJMA 1OPOA 5F89A 1K4GA 1FNGB 3IM1A 3UPAA 4N4PA 3S5YA 1NEZG 1BYOA 1QPQA 3CEUA 4E9RA 1ZGLM 4Q7BA 3X1NA 2E59A 4HBQA 3VCCA 3PDDA 1H7OA 2A3TA 1E5NA 4EPEC 3K1KC 4OJCA 4OLEA 1OB0A 1ZGLP 4H6QA 2BSLA 4L5ZA 3TN6A 4OBTA 3PL6D 1DOSA 1TG7A 1A4BA 4YYFA 3GMNB 4Z42C 2XA3A 2NXZC 4YC2B 2NWRA 1XFPA 4ES4A 4GW4A 1XQLA 2A6LA 4QXGL 5BWAA 1QQDA 2QDWA 1N0LA 2IANA 4G72B 1FL3B 4G2AA 5LBSH 1DQKA 3FH8A 5LIXX 1A3ZA 4JG0H 2FATL 4G11A 3NREA 3EWWA 4UXDA 5TDOA 4TMCA 3IK4A 3CBWA 1CG9A 5C0CB 4BH7A 4PGCA 1H7NA 2ZRXA 2VLRA 4LPTA 4X98B 2WP3T 5AVXB 2RHGA 2HH0H 3UBXA 2EO9A 5IBXA 4WY7H 1UM4L 1U22A 1XLLA 4I1PA 2QEZA 1NSZA 1BZ7B 5C07A 3FXIC 5AAPA 1KPVA 5IF0A 1WDDA 3QUYC 3T8XB 3CV6A 1V3HA 3W6YA 3VIFA 5HHOD 2B8OT 1XO8A 3IU3B 5DDHB 3MNVB 1GTFA 2VAAB 4UT9L 3LIZL 4QS5A 1Q45A 3B03A 5FOBB 4XBPA 5DYOA 3KPSD 5D7LE 1RZPA 2PBGA 1VBGA 3AACA 2P8LB 1UA6H 1OAYH 4WI4A 1JGVH 3NP4A 4LSVH 5MERA 4FQQB 1TWSA 2OVLA 4KEMA 3G0UA 3LNPA 1RK1B 3V0UA 3AYSA 4L4TE 5EZJB 4XP5H 5ACZB 4K71C 4MWAD 1YPIA 4DLFA 2N1TE 1ONEA 2FO8A 1XG3A 4G6ML 3INUL 9PCYA 1U8CB 1CNVA 4YSUA 4OI7A 5F1VA 1VP5A 5IROC 1IQ8A 3O45B 3DUHA 3H4WA 5CJMA 4PJ9C 3LS5H 1R3LB 2F53A 4Z78A 1S7XA 2FJGA 3TWYA 3BUVA 4E8CA 1CFNB 4U0QB 1S2TA 2C4XA 1R2TA 4ACYA 3QT2A 1T1YB 1UT9A 1D6EA 2N59A 3ARDA 3FTGA 1QPPA 3OR6A 4QXGH 2NXZB 1NKGA 4KRLB 5A2CA 3TGXA 3E0IA 4TQIA 1NBVL 2XSXA 3ASOB 5H4ZA 2XTJE 3EBIA 3NQCA 2GSGA 3Q8FA 5CIPA 1BM3L 4A8LA 3HIIA 4NENA 3GPSA 1TV7A 3DX8A 3OKKA 3KVQA 4UDUA 2PW2A 4AUYA 3CFCH 1K8DB 3KDPB 1PU0A 1C12B 1XQKA 1L5GB 2VDNL 2QSTA 3QUXA 2V9DA 4Y4HC 4RESB 1B0GA 1GVEA 1PVHA 1QUPA 3RLVA 2DQDL 5AVRB 1S9VA 1PKLA 4G6AC 3BH9B 3QEGH 2AF2A 4D2JA 5EPMA 3P67A 1IKNC 3CU1A 2V5CA 1E15A 1ICSA 3QUYB 4D7PA 1VKXA 3D39B 3MMEB 3AIBA 1H15B 4UT9H 3LIZH 3DV6A 3B7TA 1SIIA 3IE4A 4FF7A 3UWUA 1LEKA 3E2QA 5BS0D 1HKFA 2LTQC 1AQKL 3CUHA 1W5PA 1YDPA 1KBGH 5DMJB 2M1KA 1GNXA 5TJWK 1XX1A 2WZEA 2OSLB 4NLAA 1MJJB 2NY5L 4MY9A 4NZTL 4U4IA 1G7QA 5D5MB 2RJMA 2V3EA 4XN1A 3ZIMA 1I8MA 4I9MA 3TS8A 2G9KA 1ACCA 4PLOB 3OKEA 3G22A 2OOGA 3WNMA 1IL1B 4ATLA 1WWBX 3W9EA 1JP5A 4LIQE 1FYTE 2X4SB 4XBMA 3DURB 4K71B 2J72A 4OZ4B 4PLJD 5B39G 1JFHA 1R0AL 4ANVA 5DVPA 5EU5B 1MDRA 4XWOD 3DXAB 1MMYA 2PWEA 2XIOA 2B0SH 4BZ1H 1JL8A 1MRFH 4WWOA 3V5FA 2XM2A 3A64A 2HJKB 3IJQA 4ZSOE 2ZZ5A 3VRIA 2YOAA 3CQHA 1X5KA 3GQYA 2ZE3A 2FJSA 2J57A 2ZUUA 3C0LA 4HX1B 1UWRA 2IPUK 4PJ9B 4HKXB 1OOWA 4ADTA 2H32B 1RUSA 1YIXA 3GLAA 2QPEB 4QOKD 1BVNP 1I7UB 2VDPL 1VFAB 4AJYV 2J7CA 5ECUA 4PTDA 4Z0BL 1FWFC 3C5SA 3ZHFA 5MHSD 3SFWA 2BNQD 1NFPA 4HJIA 5AYYA 3XIMA 1DBJL 2YMXL 1D8WA 4AZIA 4JDBA 3TKFA 1E73M 2CNYA 3CFKA 3EO1A 2VDNH 4LLYB 5FYJE 1ZLDA 5FO7A 5HR6A 2KPNA 1PGRB 4PJ7F 2JXMB 3QZNA 4KRNA 5EF2A 4Y4HB 3DRQA 2DQDH 1PYWA 4IK6A 5JBFA 3FCTB 3RN6A 4LCCC 4ZTOH 2N4IA 3VXUE 2DIEA 4ZOBA 3EXLA 2VGGA 1Z44A 1UOKA 4I6VA 3K4DA 4PBWD 3M0LA 3OYZA 5EUOB 4BWLA 2WVSA 2Y7EA 1FFRA 3IFPA 4X6DF 2CW6A 3RITA 3PJSA 5J1SC 4Y9AA 2FUTA 1KJVB 1AQKH 2FYVA 3SO7A 3IJ7A 4LPWA 4GNJA 2OOFA 3EYQD 2QV5A 2BS71 2LTQB 3GG0A 5EKYA 4WTZG 1Q0XL 4RBPH 4E6MA 4GABA 4P8UA 4NZTH 1T99A 4C56D 1E27B 3ITCA 4RKAA 3LOTA 4CADA 4EN3A 2CM6A 4JRYB 3R58A 4HIQA 4H9UA 4LC6A 3WHXA 3T4AA 4UC5A 3I6GB 3WO8A 1BREA 4BFFA 1XIIA 4MZ3A 1NC4B 1NDGB 2X4RA 2ICEB 3DRTB 3RJDA 1R0AH 3GHTA 4ZDHA 3N2TA 2NXYC 5I76B 3H9ZA 3FEMA 2PTTB 1W9BM 3W83A 4I85A 4JTUA 1UUNA 4Y2NA 3A6BL 4HZ6A 4RDYA 3MP4A 1DQXA 3CCHB 2Z1BA 3SZKC 3ZXWA