1LF9A

Crystal structure of bacterial glucoamylase complexed with acarbose
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
674
structure length
674
Chain Sequence
SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUCOAMYLASE
publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
total genus 246
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf9A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf9A01
3ACTA 3WFAA 1JYVA 2CIQA 3WIRA 3QG0A 4Q88A 3VD7A 1CLCA 3NREA 3A3VA 4CJ0A 1MMUA 4AYPA 3QT9A 3I3DA 3T0BA 1IA6A 1XW2A 3QDEA 3T2PA 2ZQ0A 3S4CA 1OJOA 3CIHA 2WW2A 1J0NA 4WVBA 3PMMA 3NJVA 1H14A 3VDAA 1G9GA 3QSPA 2XHNA 1G6IA 3ANKA 3H2WA 3DYPA 4RNLA 1WU6A 2QNOA 3RX7A 2JKEA 3T2OA 4CE7A 2HTAA 1L7KA 2WVZA 4AYOA 2JF4A 3BGAA 1MMZA 3VDCA 3T09A 2D5JA 1NSMA 1F4HA 3K25A 1WU5A 1FCEA 1SO0A 4AQ0A 2AHFA 2DROA 4FUSA 1C82A 2A8ZA 3OBAA 1V7VA 1LXKA 3T33A 1V7XA 1V5DA 1F9OA 1V5CA 2D73A 1V7WA 3DYOA 1H54A 3T0AA 2FBAA 2F6DA 2ZBLA 4DUVA 3VDBA 1G9JA 3NJXA 4BZHA 1NSRA 4DUWA 3AFJA 3QT3A 3ACSA 2WVYA 5A1AA 3Q1NA 2AHGA 4XUVA 4Z4JA 4KTRA 3WKIA 1H13A 1KRFA 2D8LA 1JYNA 5CD2A 3S4AA 1TXKA 1EGUA 2AFAA 2JKAA 1G87A 1N7QA 3W7XA 4BZFA 1LOHA 1KREA 5CA3A 3CZJA 1X1JA 1UG9A 1PX3A 3WC3A 3OB8A 3S4BA 1GLMA 1XWTA 3E6UA 3DCDA 2WVXA 3QXFA 3I3BA 2JG0A 1GAIA 3W7SA 1N7RA 1K1WA 2YIKA 1JYXA 1FP3A 5DGRA 2FUZA 3QFYA 3WKFA 2E22A 3ANIA 3VD9A 2VN4A 3W5MA 1PX4A 3MV01 1RWHA 3S4DA 1F9DA 3H7LA 2BRPA 4ZG8A 5CZLA 1MN0A 2P0VA 3T2QA 1X1IA 2VN7A 1JOVA 2EABA 5M7YA 1NSZA 1MMXA 2ZXQA 3DECA 3H3KA 3IAPA 1RWCA 2E24A 3MV11 2BRWA 2JJBA 4Q2BA 1N7NA 2XFGA 3WUXA 4WVCA 1JYWA 1FBOA 4L6XA 3VXDA 2GZ6A 4DODA 1X9DA 1IS9A 1JZ5A 2CQSA 1FAEA 1L7JA 3W7WA 3D3IA 3MUZ1 1VD5A 3WIWA 1KFGA 1KKTA 2Q1FA 3E73A 3GZKA 3ON6A 1NS8A 3E1F1 3VD4A 1HN0A 4WU0A 1RWAA 3QWTA 2ZZRA 1DP0A 1HMWA 3A24A 3WKGA 1L1YA 2WDAA 1LXMA 3K11A 1RWFA 2CISA 5GY3A 1NS0A 2WYNA 4Z4LA 2Z07A 1JZ8A 1N7PA 1K1XA 1JZ6A 2WCOA 3RRSA 1GA2A 1RQ5A 3DYMA 1KS8A 1H12A 2BRVX 3MUY1 5E2JA 3P2CA 4L0GA 1CB8A 1F4AA 4TTGA 1JZ2A 1NKGA 1K1YA 1NS4A 3IAQA 1W3YA 1X1HA 2XSGA 1HN1A 4TXTA 1JS4A 3EZ8A 3MWXA 2DRSA 2DRQA 3VD3A 1JZ4A 2EADA 1WZZA 1WU4A 1DOGA 1HMUA 1FMIA 1OJNA 1N7OA 4ZH5A 2JKPA 4BZEA 3X17A 1I8QA 4TF4A 4AYRA 2DRRA 1UT9A 1KSCA 1HM2A 3J7HA 3W7TA 3EQAA 4BZGA 4JJJA 1IA7A 2WVXB 5DGQA 5MEHA 1JZ3A 5KKBA 1YGAA 3OS7A 1DL2A 4DOEA 1LF6A 1AGMA 4AYQA 2CQTA 3SEPA 3GT5A 2WW3A 3ECQA 1J0MA 1KSDA 1Z45A 1GAHA 1OJMA 2RI9A 5GW7A 4WVAA 1NS2A 3W7UA 3W5NA 2CIRA 3I3EA 3RX8A 1NC5A 3RX5A 3GLYA 1RW9A 3T0DA 2RGKA 3WKHA 1RWGA 3QPFA 3ANJA 3VD5A 5M7IA 1FBWA 2WZSA 2B4FA 1YQ2A 3T08A 1JZ7A 1SNZA 4J5TA 1K72A 2GH4A 1F9GA 2X03A 2WW1A 1HM3A 1FO2A 1LURA 1OJPA 4KTPA 3RSYA 1XWQA 3VW5A 1TF4A 1NSVA 2RI8A 3QRYA 4EL8A 3IMHA 1NS7A 2HTBA 2NVPA 3TF4A 1ULVA 2EACA 2FV1A 1NSXA 1L2AA 3RENA 1HCUA 1AYXA 3WIQA 5E1QA 1NSUA 1KWFA 1NXCA 1FO3A 1MMYA 3QFZA 1NSSA 1F1SA 2EAEA 1CEMA 1LF9A 2FV0A 3QXQA 4DUXA 2WW0A 4CJ1A 2OKXA
chains in the Genus database with same CATH superfamily
3ACTA 1JCQB 3WFAA 1JYVA 2CIQA 3M73A 4FXGB 3WIRA 3QG0A 4GL3A 1N23A 3M74A 4Q88A 3VD7A 4BTWA 1CLCA 1FPPB 2WO0A 3D5SA 2PN5A 3NREA 2H6FB 3A3VA 3PZ2B 1OACA 1O79A 4CJ0A 1H3CA 4AYPA 5C05A 1MMUA 3QT9A 1TNZB 3I3DA 3T0BA 5ILJA 1IA6A 1IU7A 3DPYB 3DX2A 1XW2A 3QDEA 3K5TA 1NL4B 4M76A 4K3AA 3T2PA 2ZQ0A 3S4CA 2XQWA 2E2VA 1OJOA 3CIHA 2WW2A 1J0NA 5KBPA 2D1WA 2F7RA 4WVBA 3PMMA 3ALAA 3NJVA 1H14A 3VDAA 1G9GA 3QSPA 1AV4A 2XHNA 1G6IA 3N0FA 4ZH1A 1EKMA 3M71A 3ANKA 3H2WA 3K7XA 4EHMB 2F7PA 3BVXA 1FT1B 1D8EB 3D50A 1O1RB 1SA4B 1UI7A 1N22A 3DYPA 4L9PB 2WOFA 4RNLA 1WU6A 2QNOA 1QSJA 3RX7A 1HZFA 3HI7A 3N0GA 2JKEA 2C10A 2H6IB 1GSZA 3AFLA 3PYBA 3T2OA 4CE7A 3EUVB 2HTAA 2FUTA 3CU7A 1L7KA 4AYOA 2WVZA 2JF4A 3BUPA 3P5PA 3BGAA 1MMZA 3VDCA 1D8DB 3T09A 5GZKA 2D5JA 2V3PA 1IQXA 1NSMA 1H36A 1N4PB 3M00A 1F4HA 4FNUA 3K25A 1W5ZA 1WU5A 3TY1A 3Q78B 1FCEA 1SO0A 4AQ0A 2AHFA 2V8KA 2DROA 4LNBB 3HIIA 5IK0A 1TQVA 4FUSA 1C82A 2A8ZA 3OBAA 2XN0A 1QQFA 4KFEA 2H6GB 1LXKA 1V7VA 2CFLA 4K35A 3T33A 1V7XA 4NEIA 1V5DA 3BUBA 1F9OA 3EJTA 1V5CA 3DSXB 4GTMB 1TU5A 2D73A 3WA2X 1V7WA 2ALWA 1O7DD 3DYOA 1H54A 2OQEC 1GHQA 1N95B 2FBAA 2F6DA 1SIIA 3T0AA 4BTXA 2ZBLA 3KSQB 4V1SA 4DUVA 1UMPA 3KSLB 1H39A 3VDBA 2V8JA 1G9JA 4GTPB 3D4ZA 3X3ZA 2SQCA 3D52A 1QALA 4KKJA 4DI5A 1QAKA 3NJXA 4BZHA 1NSRA 2CWUA 4DUWA 3AFJA 3DX3A 2ZIRB 3PZ1B 3QT3A 3BS6A 3ACSA 5DHKA 2WVYA 3RJ3A 4GTOB 4ONTA 5A1AA 5ILIA 3Q1NA 3NFVA 2C11A 2AHGA 4ZRQA 4XUVA 1RKYA 4BTYA 4Z4JA 3S9VA 1O5MB 4KTRA 1QBQB 3M77A 1LD7B 2NOJA 3WKIA 1H13A 1KRFA 4FNRA 3PZ3B 3VSMA 2D8LA 4KFFA 1JYNA 5CD2A 3BUQA 3S4AA 4UFCA 5IK6A 1TXKA 2RDYA 1EGUA 1SIHA 1JCRB 2AFAA 2V8IA 3EJRA 2R2LB 2JKAA 1G87A 2E2UA 1RJOA 3CZNA 1N7QA 1TQUA 3W7XA 4BZFA 2B39A 1LOHA 1TNUB 3NBBA 1N21A 1KREA 4FNVA 4YCRA 5CA3A 3CZJA 1AVLA 1X1JA 1H37A 3SXXA 1UG9A 3D51A 1PX3A 3WC3A 3OB8A 3SFYB 3S4BA 1GLMA 1R33A 2YX9A 3SQCA 3X40A 3LOYA 2WIIB 1LVNA 2WYIA 1XWTA 3E6UA 3SDUA 3DCDA 2OOVA 3EU8A 3SX1A 2WVXA 3QXFA 1N1BA 3I3BA 2JG0A 3E80A 1GAIA 4OK4A 1N4RB 3W7SA 1N7RA 1K1WA 2YIKA 1JYXA 1FP3A 5DGRA 2FUZA 3QFYA 3WKFA 2E22A 3ANIA 1W6CA 4MMIA 2H6HB 3VD9A 3HXDB 3BVVA 3X3XA 2VN4A 3W5MA 1HXAA 1PX4A 1TNOB 1H3AA 1RWHA 2G0DA 4GAXA 3S4DA 1QWUA 2OW6A 3EJUA 3MV01 2ONHA 1F9DA 4KFDA 3H7LA 5AGDA 5EATA 3AMOB 2F7QA 4V1RA 2YFOA 4FNSA 3BLBA 2BRPA 1D6ZA 4GTTB 4ZG8A 3Q75B 5CZLA 1MN0A 2P0VA 3HXFB 3T2QA 1O6RA 1X1IA 2VN7A 1JOVA 1W6GA 2EABA 4OZWA 5M7YA 1NSZA 1MMXA 5JMDA 1SQCA 2E2TA 3X41A 1O1TB 2ZXQA 3DECA 3H3KA 3IAPA 2ZISB 3KN4A 1W6JA 5IKAA 3BVTA 1RWCA 2E24A 1D6YA 3MV11 2YFNA 3OEDA 3DDGA 2BRWA 2JJBA 4Q2BA 1FT2B 1QWNA 2CG1A 4LNGB 1N7NA 2WGQA 2XFGA 3M7BA 1R76A 3WUXA 4GTQB 2Y73A 4WVCA 1JYWA 1FBOA 4L6XA 3VXDA 2GZ6A 4DODA 3HXCB 1X9DA 1IS9A 1JZ5A 2CQSA 4FNQA 1FAEA 1L7JA 1N9EA 3G4DA 3W7WA 1TNBB 1W2ZA 3D3IA 2CWTA 5ILHA 4GTVB 2F0YB 2WOHA 3MUZ1 3Q7AB 1JCSB 3E7JA 1VD5A 4LIXA 1HXGA 3EJQA 3WIWA 1KFGA 1KKTA 2Q1FA 1US1A 4F13A 2ZL8A 3E73A 3GZKA 5IK9A 5ILZA 2IEJB 3MPHA 3ON6A 1NS8A 3N9HA 3E1F1 1QAZA 3HXBB 3VD4A 2CG0A 1HN0A 3E37B 1RWAA 4WU0A 3QWTA 1AVKA 1HXKA 1TNYB 1IVWA 1HMWA 2ZZRA 1DP0A 3A24A 5JPMB 3M7CA 3WKGA 1L1YA 1DYUA 3DSSB 2WDAA 2OQEA 1LXMA 1N9AB 1RWFA 3K11A 3M76A 5GY3A 2WYNA 1NS0A 2CISA 4Z4LA 2Z07A 1JRQA 2W0QA 1JZ8A 3SDTA 1N7PA 1TQWA 1K1XA 2GOXA 1JZ6A 2WCOA 4D4AA 3PYAA 5FOBB 3BUDA 3M01A 4OZVA 3RRSA 1GA2A 1RQ5A 3SDQA 3DYMA 2OKXA 3MI6A 1KS8A 2BBCA 1H12A 2BRVX 3MUY1 1SPUA 5E2JA 1N4SB 4FJQA 1N1ZA 3M7LA 4D94A 3WVFA 3DSTB 3PGBA 5ILDA 3PZ4B 3G4FA 3DX0A 3P2CA 1KZPB 3DX1A 1CB8A 4L0GA 1TN7B 3SDRA 1F4AA 1IQYA 4TTGA 1JZ2A 1UI8A 4ZRPA 1NKGA 1K1YA 1NS4A 3IAQA 1W3YA 3BVWA 1D6UA 2A73B 3M02A 3CZSA 1X1HA 3M78A 1PU4A 2XSGA 4YDOB 2F18A 1HN1A 4TXTA 1JS4A 4OJZA 3EZ8A 1IVVA 1WMNA 3CV5A 3MWXA 2DRSA 4MBGB 4LNVA 2XWBB 2BEDB 2DRQA 1PS3A 3VD3A 3NBJA 1JZ4A 2EADA 3Q7FB 3Q73B 1WZZA 3M75A 2V3NA 1WU4A 5IM1A 3DSUB 1WMPA 1DOGA 1HMUA 1FMIA 1QAFA 1SA5B 1OJNA 1N7OA 3NNBA 4YDEB 3T0UA 1O6HA 3EU5B 1S64B 2PMVA 1DCEB 4ZH5A 2JKPA 5EAUA 4BZEA 3DRAB 4D4DA 3X17A 1I8QA 2WINB 2XWJB 4TF4A 4AYRA 1X81B 5DHIA 3DSVB 2DRRA 3BUIA 1UT9A 4D4CA 1HWWA 1HM2A 1KSCA 1TN8B 3M72A 1N20A 4FNPA 3D4YA 3W7TA 3J7HA 3VSNA 3E34B 3EQAA 4EV5A 1QX1A 4BZGA 2F7OA 4JJJA 5JMFA 1IA7A 1R34A 4E1YA 5DGQA 5MEHA 2WVXB 3M7EA 3SDVA 1JZ3A 2FYVA 5KKBA 1YGAA 3KIIA 3OS7A 2G02A 4OK2A 3X42A 4GTSB 1DL2A 4DOEA 4FNTA 3EJSA 1LF6A 1AGMA 2BB6A 4AYQA 5FO9B 2CQTA 2CFGA 4EV2A 2F1BA 2XN2A 2CFKA 3GT5A 3SEPA 2WW3A 3BVUA 1TN6B 1J0MA 1KSDA 3EJPA 3ECQA 3SAEA 1Z45A 1GAHA 2BT3A 1OJMA 4MU9A 1HV6A 2RI9A 3E33B 5GW7A 4WVAA 1NS2A 3W7UA 2BB5A 1C3DA 3W5NA 1WMOA 2CIRA 3I3EA 4F10A 3RX8A 5IKHA 3A0OA 3Q79B 1LTXB 1NC5A 3RX5A 1IVUA 1GXMA 3GLYA 4BOKA 1RW9A 1W4NA 3T0DA 3WA3A 2RGKA 1O6QA 1TQSA 1N24A 2J5CA 2WY7A 3WKHA 4GTRB 1O1SB 1RWGA 3QPFA 4D4BA 3BLCA 3ANJA 4MMHA 3VD5A 1H3BA 3C72B 2WYHA 5IL3A 1FBWA 1GXNA 5M7IA 3P5RA 2B4FA 1YQ2A 2WZSA 3T08A 1JZ7A 1SNZA 4J5TA 1K72A 3DSWB 4C1SA 1W7CA 3X3YA 2GH4A 1F9GA 2X03A 3OXUA 4RNQA 1HM3A 1FO2A 2WW1A 5EASA 1KSIA 5JPNB 1S63B 3HXEB 3KQ4A 1N94B 1LURA 5ILKA 2CWVA 1W6KA 1OJPA 4KTPA 3RSYA 1XWQA 3VW5A 3DX4A 1MZCB 2CFWA 1TF4A 4QT9A 2RI8A 1NSVA 3E32B 1HTYA 2PNCA 4FXKB 5ILYA 3QRYA 4EL8A 1A2VA 3IMHA 1NS7A 2HTBA 2XN1A 2NVPA 2OW7A 3TF4A 3D5RA 4BOJA 3HIGA 1ULVA 2I07B 2EACA 2FV1A 3LZ9A 1HXCA 1NSXA 1GXOA 1L2AA 1H35A 2F1AA 3KLSA 3RENA 3DDFA 1HCUA 1AYXA 5FO8B 3WIQA 2WY8A 1KZOB 5E1QA 3LVTA 1N4QB 1NSUA 2CFDA 1KWFA 3E30B 1NXCA 1FO3A 1MMYA 3QFZA 1NSSA 1F1SA 1HX9A 2EAEA 1CEMA 1NI1B 3SFXB 5FO7B 1LF9A 2OOVC 2FV0A 3QXQA 4DUXA 2WW0A 5IL8A 2FUQA 3G6JB 4KKIA 4CJ1A 1TQTA 2ONGA 3AMOA 2Y74A 1IVXA 1LD8B
chains in the Genus database with same CATH topology
3ACTA 1JCQB 3WFAA 1JYVA 2CIQA 3M73A 4FXGB 3WIRA 3QG0A 4GL3A 3M74A 4Q88A 3VD7A 1CLCA 1FPPB 3D5SA 2PN5A 3NREA 2H6FB 3A3VA 3PZ2B 1O79A 4CJ0A 1H3CA 4AYPA 1MMUA 3QT9A 1TNZB 3I3DA 3T0BA 1IA6A 3DPYB 1XW2A 3QDEA 1NL4B 4M76A 3T2PA 2ZQ0A 3S4CA 2XQWA 1OJOA 3CIHA 2WW2A 1J0NA 4WVBA 3PMMA 3NJVA 1H14A 3VDAA 1G9GA 3QSPA 2XHNA 1G6IA 4ZH1A 3M71A 3ANKA 3H2WA 3K7XA 4EHMB 1FT1B 1D8EB 1O1RB 1SA4B 3DYPA 4L9PB 4RNLA 1WU6A 2QNOA 1QSJA 3RX7A 1HZFA 2JKEA 2H6IB 1GSZA 3AFLA 3PYBA 3T2OA 4CE7A 3EUVB 2HTAA 3CU7A 1L7KA 2FUTA 4AYOA 2WVZA 2JF4A 3P5PA 3BGAA 1MMZA 3VDCA 1D8DB 3T09A 5GZKA 2D5JA 2V3PA 1NSMA 1H36A 1N4PB 1F4HA 3K25A 1WU5A 3TY1A 3Q78B 1FCEA 1SO0A 4AQ0A 2AHFA 2V8KA 2DROA 4LNBB 4FUSA 1C82A 2A8ZA 3OBAA 1QQFA 2H6GB 1V7VA 1LXKA 3T33A 1V7XA 4NEIA 1V5DA 1F9OA 1V5CA 3DSXB 4GTMB 2D73A 1V7WA 3DYOA 1H54A 1GHQA 1N95B 2FBAA 2F6DA 3T0AA 2ZBLA 3KSQB 4V1SA 4DUVA 1UMPA 3KSLB 1H39A 3VDBA 2V8JA 1G9JA 4GTPB 2SQCA 4KKJA 3NJXA 4BZHA 1NSRA 4DUWA 3AFJA 2ZIRB 3QT3A 3PZ1B 3BS6A 3ACSA 2WVYA 3RJ3A 4GTOB 4ONTA 5A1AA 3Q1NA 2AHGA 4ZRQA 4XUVA 4Z4JA 3S9VA 1O5MB 4KTRA 1QBQB 3M77A 1LD7B 2NOJA 3WKIA 1H13A 1KRFA 3PZ3B 3VSMA 2D8LA 1JYNA 5CD2A 3S4AA 1TXKA 1EGUA 1JCRB 2AFAA 2V8IA 2R2LB 2JKAA 1G87A 1N7QA 3W7XA 4BZFA 2B39A 1TNUB 1LOHA 1KREA 4FNVA 4YCRA 5CA3A 3CZJA 1X1JA 1H37A 1UG9A 1PX3A 3WC3A 3OB8A 3SFYB 3S4BA 1GLMA 3SQCA 2WIIB 1XWTA 3E6UA 3SDUA 3DCDA 3EU8A 2WVXA 3QXFA 3I3BA 2JG0A 3E80A 1GAIA 4OK4A 1N4RB 3W7SA 1N7RA 1K1WA 2YIKA 1JYXA 1FP3A 5DGRA 2FUZA 3QFYA 3WKFA 3ANIA 2E22A 4MMIA 2H6HB 3VD9A 3HXDB 2VN4A 3W5MA 1PX4A 1TNOB 1H3AA 2G0DA 3S4DA 1RWHA 3MV01 1F9DA 3H7LA 5AGDA 4V1RA 2BRPA 4GTTB 4ZG8A 3Q75B 5CZLA 1MN0A 2P0VA 3HXFB 3T2QA 1O6RA 2VN7A 1JOVA 1X1IA 2EABA 5M7YA 1NSZA 1MMXA 5JMDA 1SQCA 1O1TB 2ZXQA 3DECA 3H3KA 3IAPA 2ZISB 1W6JA 1RWCA 2E24A 3MV11 3OEDA 2BRWA 2JJBA 4Q2BA 1FT2B 4LNGB 1N7NA 2XFGA 3M7BA 1R76A 3WUXA 4GTQB 4WVCA 1JYWA 1FBOA 4L6XA 3VXDA 2GZ6A 4DODA 3HXCB 1X9DA 1IS9A 1JZ5A 2CQSA 1FAEA 1L7JA 3W7WA 1TNBB 3D3IA 4GTVB 2F0YB 3MUZ1 3Q7AB 1JCSB 1VD5A 3E7JA 4LIXA 3WIWA 1KFGA 1KKTA 2Q1FA 3E73A 3GZKA 2IEJB 3ON6A 1NS8A 3E1F1 3HXBB 3VD4A 1HN0A 3E37B 4WU0A 1RWAA 3QWTA 1TNYB 2ZZRA 1DP0A 1HMWA 3A24A 5JPMB 3M7CA 3WKGA 1L1YA 3DSSB 2WDAA 1LXMA 1N9AB 3K11A 3M76A 5GY3A 1NS0A 2WYNA 1RWFA 2CISA 4Z4LA 2Z07A 1JZ8A 3SDTA 1N7PA 1K1XA 2GOXA 1JZ6A 2WCOA 4D4AA 3PYAA 5FOBB 3RRSA 1GA2A 1RQ5A 3SDQA 3DYMA 2OKXA 1KS8A 2BBCA 1H12A 2BRVX 3MUY1 5E2JA 1N4SB 4D94A 3M7LA 3WVFA 3DSTB 3PZ4B 3P2CA 1KZPB 4L0GA 1CB8A 1TN7B 3SDRA 1F4AA 4TTGA 1JZ2A 4ZRPA 1NKGA 1K1YA 1NS4A 3IAQA 1W3YA 2A73B 1X1HA 3M78A 2XSGA 4YDOB 1HN1A 4TXTA 1JS4A 4OJZA 3EZ8A 3MWXA 2DRSA 4MBGB 4LNVA 2XWBB 2BEDB 2DRQA 3VD3A 1JZ4A 2EADA 3Q7FB 3Q73B 1WZZA 3M75A 2V3NA 1WU4A 3DSUB 1DOGA 1HMUA 1FMIA 1SA5B 4YDEB 1N7OA 1OJNA 1O6HA 3EU5B 1S64B 2PMVA 1DCEB 4ZH5A 2JKPA 4BZEA 3DRAB 4D4DA 3X17A 1I8QA 2WINB 2XWJB 4TF4A 4AYRA 1X81B 3DSVB 2DRRA 1UT9A 4D4CA 1KSCA 1TN8B 3M72A 1HM2A 3J7HA 3W7TA 3VSNA 3E34B 3EQAA 4BZGA 4JJJA 5JMFA 1IA7A 2WVXB 5DGQA 5MEHA 3M7EA 3SDVA 1JZ3A 5KKBA 1YGAA 3OS7A 2G02A 4OK2A 4GTSB 1DL2A 4DOEA 1LF6A 1AGMA 2BB6A 4AYQA 5FO9B 2CQTA 3SEPA 3GT5A 2WW3A 3ECQA 1TN6B 1J0MA 1KSDA 3SAEA 1Z45A 1GAHA 1OJMA 4MU9A 2RI9A 3E33B 5GW7A 4WVAA 1NS2A 3W7UA 2BB5A 1C3DA 3W5NA 2CIRA 3I3EA 3RX8A 3A0OA 3Q79B 1LTXB 1NC5A 3RX5A 1GXMA 3GLYA 4BOKA 1RW9A 3T0DA 2RGKA 1O6QA 2WY7A 3WKHA 4GTRB 1O1SB 3QPFA 1RWGA 4D4BA 3BLCA 3ANJA 4MMHA 3VD5A 1H3BA 3C72B 5M7IA 1FBWA 1GXNA 3P5RA 2B4FA 1YQ2A 2WZSA 3T08A 1JZ7A 1SNZA 4J5TA 1K72A 3DSWB 4C1SA 2GH4A 1F9GA 2X03A 3OXUA 2WW1A 1HM3A 1FO2A 5JPNB 1S63B 3HXEB 3KQ4A 1N94B 1LURA 1W6KA 1OJPA 4KTPA 3RSYA 1XWQA 3VW5A 1MZCB 1TF4A 4QT9A 2RI8A 1NSVA 3E32B 4FXKB 3QRYA 4EL8A 3IMHA 1NS7A 2HTBA 2NVPA 3TF4A 3D5RA 4BOJA 1ULVA 2I07B 2EACA 2FV1A 1NSXA 1GXOA 1L2AA 1H35A 3KLSA 3RENA 1HCUA 1AYXA 5FO8B 3WIQA 2WY8A 1KZOB 5E1QA 1N4QB 1NSUA 1KWFA 3E30B 1NXCA 1FO3A 1MMYA 3QFZA 1NSSA 1F1SA 2EAEA 1CEMA 1NI1B 3SFXB 5FO7B 1LF9A 2FV0A 3QXQA 4DUXA 2WW0A 4CJ1A 3G6JB 4KKIA 2FUQA 1LD8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ACT A;  3WFA A;  1JYV A;  2CIQ A;  3WIR A;  3QG0 A;  4Q88 A;  3VD7 A;  1CLC A;  3NRE A;  3A3V A;  4CJ0 A;  1MMU A;  4AYP A;  3QT9 A;  3I3D A;  3T0B A;  1IA6 A;  1XW2 A;  3QDE A;  3T2P A;  2ZQ0 A;  3S4C A;  1OJO A;  3CIH A;  2WW2 A;  1J0N A;  4WVB A;  3PMM A;  3NJV A;  1H14 A;  3VDA A;  1G9G A;  3QSP A;  2XHN A;  1G6I A;  3ANK A;  3H2W A;  3DYP A;  4RNL A;  1WU6 A;  2QNO A;  3RX7 A;  2JKE A;  3T2O A;  4CE7 A;  2HTA A;  1L7K A;  2WVZ A;  4AYO A;  2JF4 A;  3BGA A;  1MMZ A;  3VDC A;  3T09 A;  2D5J A;  1NSM A;  1F4H A;  3K25 A;  1WU5 A;  1FCE A;  1SO0 A;  4AQ0 A;  2AHF A;  2DRO A;  4FUS A;  1C82 A;  2A8Z A;  3OBA A;  1V7V A;  1LXK A;  3T33 A;  1V7X A;  1V5D A;  1F9O A;  1V5C A;  2D73 A;  1V7W A;  3DYO A;  1H54 A;  3T0A A;  2FBA A;  2F6D A;  2ZBL A;  4DUV A;  3VDB A;  1G9J A;  3NJX A;  4BZH A;  1NSR A;  4DUW A;  3AFJ A;  3QT3 A;  3ACS A;  2WVY A;  5A1A A;  3Q1N A;  2AHG A;  4XUV A;  4Z4J A;  4KTR A;  3WKI A;  1H13 A;  1KRF A;  2D8L A;  1JYN A;  5CD2 A;  3S4A A;  1TXK A;  1EGU A;  2AFA A;  2JKA A;  1G87 A;  1N7Q A;  3W7X A;  4BZF A;  1LOH A;  1KRE A;  5CA3 A;  3CZJ A;  1X1J A;  1UG9 A;  1PX3 A;  3WC3 A;  3OB8 A;  3S4B A;  1GLM A;  1XWT A;  3E6U A;  3DCD A;  2WVX A;  3QXF A;  3I3B A;  2JG0 A;  1GAI A;  3W7S A;  1N7R A;  1K1W A;  2YIK A;  1JYX A;  1FP3 A;  5DGR A;  2FUZ A;  3QFY A;  3WKF A;  2E22 A;  3ANI A;  3VD9 A;  2VN4 A;  3W5M A;  1PX4 A;  3MV0 1;  1RWH A;  3S4D A;  1F9D A;  3H7L A;  2BRP A;  4ZG8 A;  5CZL A;  1MN0 A;  2P0V A;  3T2Q A;  1X1I A;  2VN7 A;  1JOV A;  2EAB A;  5M7Y A;  1NSZ A;  1MMX A;  2ZXQ A;  3DEC A;  3H3K A;  3IAP A;  1RWC A;  2E24 A;  3MV1 1;  2BRW A;  2JJB A;  4Q2B A;  1N7N A;  2XFG A;  3WUX A;  4WVC A;  1JYW A;  1FBO A;  4L6X A;  3VXD A;  2GZ6 A;  4DOD A;  1X9D A;  1IS9 A;  1JZ5 A;  2CQS A;  1FAE A;  1L7J A;  3W7W A;  3D3I A;  3MUZ 1;  1VD5 A;  3WIW A;  1KFG A;  1KKT A;  2Q1F A;  3E73 A;  3GZK A;  3ON6 A;  1NS8 A;  3E1F 1;  3VD4 A;  1HN0 A;  4WU0 A;  1RWA A;  3QWT A;  2ZZR A;  1DP0 A;  1HMW A;  3A24 A;  3WKG A;  1L1Y A;  2WDA A;  1LXM A;  3K11 A;  1RWF A;  2CIS A;  5GY3 A;  1NS0 A;  2WYN A;  4Z4L A;  2Z07 A;  1JZ8 A;  1N7P A;  1K1X A;  1JZ6 A;  2WCO A;  3RRS A;  1GA2 A;  1RQ5 A;  3DYM A;  1KS8 A;  1H12 A;  2BRV X;  3MUY 1;  5E2J A;  3P2C A;  4L0G A;  1CB8 A;  1F4A A;  4TTG A;  1JZ2 A;  1NKG A;  1K1Y A;  1NS4 A;  3IAQ A;  1W3Y A;  1X1H A;  2XSG A;  1HN1 A;  4TXT A;  1JS4 A;  3EZ8 A;  3MWX A;  2DRS A;  2DRQ A;  3VD3 A;  1JZ4 A;  2EAD A;  1WZZ A;  1WU4 A;  1DOG A;  1HMU A;  1FMI A;  1OJN A;  1N7O A;  4ZH5 A;  2JKP A;  4BZE A;  3X17 A;  1I8Q A;  4TF4 A;  4AYR A;  2DRR A;  1UT9 A;  1KSC A;  1HM2 A;  3J7H A;  3W7T A;  3EQA A;  4BZG A;  4JJJ A;  1IA7 A;  2WVX B;  5DGQ A;  5MEH A;  1JZ3 A;  5KKB A;  1YGA A;  3OS7 A;  1DL2 A;  4DOE A;  1LF6 A;  1AGM A;  4AYQ A;  2CQT A;  3SEP A;  3GT5 A;  2WW3 A;  3ECQ A;  1J0M A;  1KSD A;  1Z45 A;  1GAH A;  1OJM A;  2RI9 A;  5GW7 A;  4WVA A;  1NS2 A;  3W7U A;  3W5N A;  2CIR A;  3I3E A;  3RX8 A;  1NC5 A;  3RX5 A;  3GLY A;  1RW9 A;  3T0D A;  2RGK A;  3WKH A;  1RWG A;  3QPF A;  3ANJ A;  3VD5 A;  5M7I A;  1FBW A;  2WZS A;  2B4F A;  1YQ2 A;  3T08 A;  1JZ7 A;  1SNZ A;  4J5T A;  1K72 A;  2GH4 A;  1F9G A;  2X03 A;  2WW1 A;  1HM3 A;  1FO2 A;  1LUR A;  1OJP A;  4KTP A;  3RSY A;  1XWQ A;  3VW5 A;  1TF4 A;  1NSV A;  2RI8 A;  3QRY A;  4EL8 A;  3IMH A;  1NS7 A;  2HTB A;  2NVP A;  3TF4 A;  1ULV A;  2EAC A;  2FV1 A;  1NSX A;  1L2A A;  3REN A;  1HCU A;  1AYX A;  3WIQ A;  5E1Q A;  1NSU A;  1KWF A;  1NXC A;  1FO3 A;  1MMY A;  3QFZ A;  1NSS A;  1F1S A;  2EAE A;  1CEM A;  1LF9 A;  2FV0 A;  3QXQ A;  4DUX A;  2WW0 A;  4CJ1 A;  2OKX A; 
#chains in the Genus database with same CATH topology
 3ACT A;  1JCQ B;  3WFA A;  1JYV A;  2CIQ A;  3M73 A;  4FXG B;  3WIR A;  3QG0 A;  4GL3 A;  1N23 A;  3M74 A;  4Q88 A;  3VD7 A;  4BTW A;  1CLC A;  1FPP B;  2WO0 A;  3D5S A;  2PN5 A;  3NRE A;  2H6F B;  3A3V A;  3PZ2 B;  1OAC A;  1O79 A;  4CJ0 A;  1H3C A;  4AYP A;  5C05 A;  1MMU A;  3QT9 A;  1TNZ B;  3I3D A;  3T0B A;  5ILJ A;  1IA6 A;  1IU7 A;  3DPY B;  3DX2 A;  1XW2 A;  3QDE A;  3K5T A;  1NL4 B;  4M76 A;  4K3A A;  3T2P A;  2ZQ0 A;  3S4C A;  2XQW A;  2E2V A;  1OJO A;  3CIH A;  2WW2 A;  1J0N A;  5KBP A;  2D1W A;  2F7R A;  4WVB A;  3PMM A;  3ALA A;  3NJV A;  1H14 A;  3VDA A;  1G9G A;  3QSP A;  1AV4 A;  2XHN A;  1G6I A;  3N0F A;  4ZH1 A;  1EKM A;  3M71 A;  3ANK A;  3H2W A;  3K7X A;  4EHM B;  2F7P A;  3BVX A;  1FT1 B;  1D8E B;  3D50 A;  1O1R B;  1SA4 B;  1UI7 A;  1N22 A;  3DYP A;  4L9P B;  2WOF A;  4RNL A;  1WU6 A;  2QNO A;  1QSJ A;  3RX7 A;  1HZF A;  3HI7 A;  3N0G A;  2JKE A;  2C10 A;  2H6I B;  1GSZ A;  3AFL A;  3PYB A;  3T2O A;  4CE7 A;  3EUV B;  2HTA A;  2FUT A;  3CU7 A;  1L7K A;  4AYO A;  2WVZ A;  2JF4 A;  3BUP A;  3P5P A;  3BGA A;  1MMZ A;  3VDC A;  1D8D B;  3T09 A;  5GZK A;  2D5J A;  2V3P A;  1IQX A;  1NSM A;  1H36 A;  1N4P B;  3M00 A;  1F4H A;  4FNU A;  3K25 A;  1W5Z A;  1WU5 A;  3TY1 A;  3Q78 B;  1FCE A;  1SO0 A;  4AQ0 A;  2AHF A;  2V8K A;  2DRO A;  4LNB B;  3HII A;  5IK0 A;  1TQV A;  4FUS A;  1C82 A;  2A8Z A;  3OBA A;  2XN0 A;  1QQF A;  4KFE A;  2H6G B;  1LXK A;  1V7V A;  2CFL A;  4K35 A;  3T33 A;  1V7X A;  4NEI A;  1V5D A;  3BUB A;  1F9O A;  3EJT A;  1V5C A;  3DSX B;  4GTM B;  1TU5 A;  2D73 A;  3WA2 X;  1V7W A;  2ALW A;  1O7D D;  3DYO A;  1H54 A;  2OQE C;  1GHQ A;  1N95 B;  2FBA A;  2F6D A;  1SII A;  3T0A A;  4BTX A;  2ZBL A;  3KSQ B;  4V1S A;  4DUV A;  1UMP A;  3KSL B;  1H39 A;  3VDB A;  2V8J A;  1G9J A;  4GTP B;  3D4Z A;  3X3Z A;  2SQC A;  3D52 A;  1QAL A;  4KKJ A;  4DI5 A;  1QAK A;  3NJX A;  4BZH A;  1NSR A;  2CWU A;  4DUW A;  3AFJ A;  3DX3 A;  2ZIR B;  3PZ1 B;  3QT3 A;  3BS6 A;  3ACS A;  5DHK A;  2WVY A;  3RJ3 A;  4GTO B;  4ONT A;  5A1A A;  5ILI A;  3Q1N A;  3NFV A;  2C11 A;  2AHG A;  4ZRQ A;  4XUV A;  1RKY A;  4BTY A;  4Z4J A;  3S9V A;  1O5M B;  4KTR A;  1QBQ B;  3M77 A;  1LD7 B;  2NOJ A;  3WKI A;  1H13 A;  1KRF A;  4FNR A;  3PZ3 B;  3VSM A;  2D8L A;  4KFF A;  1JYN A;  5CD2 A;  3BUQ A;  3S4A A;  4UFC A;  5IK6 A;  1TXK A;  2RDY A;  1EGU A;  1SIH A;  1JCR B;  2AFA A;  2V8I A;  3EJR A;  2R2L B;  2JKA A;  1G87 A;  2E2U A;  1RJO A;  3CZN A;  1N7Q A;  1TQU A;  3W7X A;  4BZF A;  2B39 A;  1LOH A;  1TNU B;  3NBB A;  1N21 A;  1KRE A;  4FNV A;  4YCR A;  5CA3 A;  3CZJ A;  1AVL A;  1X1J A;  1H37 A;  3SXX A;  1UG9 A;  3D51 A;  1PX3 A;  3WC3 A;  3OB8 A;  3SFY B;  3S4B A;  1GLM A;  1R33 A;  2YX9 A;  3SQC A;  3X40 A;  3LOY A;  2WII B;  1LVN A;  2WYI A;  1XWT A;  3E6U A;  3SDU A;  3DCD A;  2OOV A;  3EU8 A;  3SX1 A;  2WVX A;  3QXF A;  1N1B A;  3I3B A;  2JG0 A;  3E80 A;  1GAI A;  4OK4 A;  1N4R B;  3W7S A;  1N7R A;  1K1W A;  2YIK A;  1JYX A;  1FP3 A;  5DGR A;  2FUZ A;  3QFY A;  3WKF A;  2E22 A;  3ANI A;  1W6C A;  4MMI A;  2H6H B;  3VD9 A;  3HXD B;  3BVV A;  3X3X A;  2VN4 A;  3W5M A;  1HXA A;  1PX4 A;  1TNO B;  1H3A A;  1RWH A;  2G0D A;  4GAX A;  3S4D A;  1QWU A;  2OW6 A;  3EJU A;  3MV0 1;  2ONH A;  1F9D A;  4KFD A;  3H7L A;  5AGD A;  5EAT A;  3AMO B;  2F7Q A;  4V1R A;  2YFO A;  4FNS A;  3BLB A;  2BRP A;  1D6Z A;  4GTT B;  4ZG8 A;  3Q75 B;  5CZL A;  1MN0 A;  2P0V A;  3HXF B;  3T2Q A;  1O6R A;  1X1I A;  2VN7 A;  1JOV A;  1W6G A;  2EAB A;  4OZW A;  5M7Y A;  1NSZ A;  1MMX A;  5JMD A;  1SQC A;  2E2T A;  3X41 A;  1O1T B;  2ZXQ A;  3DEC A;  3H3K A;  3IAP A;  2ZIS B;  3KN4 A;  1W6J A;  5IKA A;  3BVT A;  1RWC A;  2E24 A;  1D6Y A;  3MV1 1;  2YFN A;  3OED A;  3DDG A;  2BRW A;  2JJB A;  4Q2B A;  1FT2 B;  1QWN A;  2CG1 A;  4LNG B;  1N7N A;  2WGQ A;  2XFG A;  3M7B A;  1R76 A;  3WUX A;  4GTQ B;  2Y73 A;  4WVC A;  1JYW A;  1FBO A;  4L6X A;  3VXD A;  2GZ6 A;  4DOD A;  3HXC B;  1X9D A;  1IS9 A;  1JZ5 A;  2CQS A;  4FNQ A;  1FAE A;  1L7J A;  1N9E A;  3G4D A;  3W7W A;  1TNB B;  1W2Z A;  3D3I A;  2CWT A;  5ILH A;  4GTV B;  2F0Y B;  2WOH A;  3MUZ 1;  3Q7A B;  1JCS B;  3E7J A;  1VD5 A;  4LIX A;  1HXG A;  3EJQ A;  3WIW A;  1KFG A;  1KKT A;  2Q1F A;  1US1 A;  4F13 A;  2ZL8 A;  3E73 A;  3GZK A;  5IK9 A;  5ILZ A;  2IEJ B;  3MPH A;  3ON6 A;  1NS8 A;  3N9H A;  3E1F 1;  1QAZ A;  3HXB B;  3VD4 A;  2CG0 A;  1HN0 A;  3E37 B;  1RWA A;  4WU0 A;  3QWT A;  1AVK A;  1HXK A;  1TNY B;  1IVW A;  1HMW A;  2ZZR A;  1DP0 A;  3A24 A;  5JPM B;  3M7C A;  3WKG A;  1L1Y A;  1DYU A;  3DSS B;  2WDA A;  2OQE A;  1LXM A;  1N9A B;  1RWF A;  3K11 A;  3M76 A;  5GY3 A;  2WYN A;  1NS0 A;  2CIS A;  4Z4L A;  2Z07 A;  1JRQ A;  2W0Q A;  1JZ8 A;  3SDT A;  1N7P A;  1TQW A;  1K1X A;  2GOX A;  1JZ6 A;  2WCO A;  4D4A A;  3PYA A;  5FOB B;  3BUD A;  3M01 A;  4OZV A;  3RRS A;  1GA2 A;  1RQ5 A;  3SDQ A;  3DYM A;  2OKX A;  3MI6 A;  1KS8 A;  2BBC A;  1H12 A;  2BRV X;  3MUY 1;  1SPU A;  5E2J A;  1N4S B;  4FJQ A;  1N1Z A;  3M7L A;  4D94 A;  3WVF A;  3DST B;  3PGB A;  5ILD A;  3PZ4 B;  3G4F A;  3DX0 A;  3P2C A;  1KZP B;  3DX1 A;  1CB8 A;  4L0G A;  1TN7 B;  3SDR A;  1F4A A;  1IQY A;  4TTG A;  1JZ2 A;  1UI8 A;  4ZRP A;  1NKG A;  1K1Y A;  1NS4 A;  3IAQ A;  1W3Y A;  3BVW A;  1D6U A;  2A73 B;  3M02 A;  3CZS A;  1X1H A;  3M78 A;  1PU4 A;  2XSG A;  4YDO B;  2F18 A;  1HN1 A;  4TXT A;  1JS4 A;  4OJZ A;  3EZ8 A;  1IVV A;  1WMN A;  3CV5 A;  3MWX A;  2DRS A;  4MBG B;  4LNV A;  2XWB B;  2BED B;  2DRQ A;  1PS3 A;  3VD3 A;  3NBJ A;  1JZ4 A;  2EAD A;  3Q7F B;  3Q73 B;  1WZZ A;  3M75 A;  2V3N A;  1WU4 A;  5IM1 A;  3DSU B;  1WMP A;  1DOG A;  1HMU A;  1FMI A;  1QAF A;  1SA5 B;  1OJN A;  1N7O A;  3NNB A;  4YDE B;  3T0U A;  1O6H A;  3EU5 B;  1S64 B;  2PMV A;  1DCE B;  4ZH5 A;  2JKP A;  5EAU A;  4BZE A;  3DRA B;  4D4D A;  3X17 A;  1I8Q A;  2WIN B;  2XWJ B;  4TF4 A;  4AYR A;  1X81 B;  5DHI A;  3DSV B;  2DRR A;  3BUI A;  1UT9 A;  4D4C A;  1HWW A;  1HM2 A;  1KSC A;  1TN8 B;  3M72 A;  1N20 A;  4FNP A;  3D4Y A;  3W7T A;  3J7H A;  3VSN A;  3E34 B;  3EQA A;  4EV5 A;  1QX1 A;  4BZG A;  2F7O A;  4JJJ A;  5JMF A;  1IA7 A;  1R34 A;  4E1Y A;  5DGQ A;  5MEH A;  2WVX B;  3M7E A;  3SDV A;  1JZ3 A;  2FYV A;  5KKB A;  1YGA A;  3KII A;  3OS7 A;  2G02 A;  4OK2 A;  3X42 A;  4GTS B;  1DL2 A;  4DOE A;  4FNT A;  3EJS A;  1LF6 A;  1AGM A;  2BB6 A;  4AYQ A;  5FO9 B;  2CQT A;  2CFG A;  4EV2 A;  2F1B A;  2XN2 A;  2CFK A;  3GT5 A;  3SEP A;  2WW3 A;  3BVU A;  1TN6 B;  1J0M A;  1KSD A;  3EJP A;  3ECQ A;  3SAE A;  1Z45 A;  1GAH A;  2BT3 A;  1OJM A;  4MU9 A;  1HV6 A;  2RI9 A;  3E33 B;  5GW7 A;  4WVA A;  1NS2 A;  3W7U A;  2BB5 A;  1C3D A;  3W5N A;  1WMO A;  2CIR A;  3I3E A;  4F10 A;  3RX8 A;  5IKH A;  3A0O A;  3Q79 B;  1LTX B;  1NC5 A;  3RX5 A;  1IVU A;  1GXM A;  3GLY A;  4BOK A;  1RW9 A;  1W4N A;  3T0D A;  3WA3 A;  2RGK A;  1O6Q A;  1TQS A;  1N24 A;  2J5C A;  2WY7 A;  3WKH A;  4GTR B;  1O1S B;  1RWG A;  3QPF A;  4D4B A;  3BLC A;  3ANJ A;  4MMH A;  3VD5 A;  1H3B A;  3C72 B;  2WYH A;  5IL3 A;  1FBW A;  1GXN A;  5M7I A;  3P5R A;  2B4F A;  1YQ2 A;  2WZS A;  3T08 A;  1JZ7 A;  1SNZ A;  4J5T A;  1K72 A;  3DSW B;  4C1S A;  1W7C A;  3X3Y A;  2GH4 A;  1F9G A;  2X03 A;  3OXU A;  4RNQ A;  1HM3 A;  1FO2 A;  2WW1 A;  5EAS A;  1KSI A;  5JPN B;  1S63 B;  3HXE B;  3KQ4 A;  1N94 B;  1LUR A;  5ILK A;  2CWV A;  1W6K A;  1OJP A;  4KTP A;  3RSY A;  1XWQ A;  3VW5 A;  3DX4 A;  1MZC B;  2CFW A;  1TF4 A;  4QT9 A;  2RI8 A;  1NSV A;  3E32 B;  1HTY A;  2PNC A;  4FXK B;  5ILY A;  3QRY A;  4EL8 A;  1A2V A;  3IMH A;  1NS7 A;  2HTB A;  2XN1 A;  2NVP A;  2OW7 A;  3TF4 A;  3D5R A;  4BOJ A;  3HIG A;  1ULV A;  2I07 B;  2EAC A;  2FV1 A;  3LZ9 A;  1HXC A;  1NSX A;  1GXO A;  1L2A A;  1H35 A;  2F1A A;  3KLS A;  3REN A;  3DDF A;  1HCU A;  1AYX A;  5FO8 B;  3WIQ A;  2WY8 A;  1KZO B;  5E1Q A;  3LVT A;  1N4Q B;  1NSU A;  2CFD A;  1KWF A;  3E30 B;  1NXC A;  1FO3 A;  1MMY A;  3QFZ A;  1NSS A;  1F1S A;  1HX9 A;  2EAE A;  1CEM A;  1NI1 B;  3SFX B;  5FO7 B;  1LF9 A;  2OOV C;  2FV0 A;  3QXQ A;  4DUX A;  2WW0 A;  5IL8 A;  2FUQ A;  3G6J B;  4KKI A;  4CJ1 A;  1TQT A;  2ONG A;  3AMO A;  2Y74 A;  1IVX A;  1LD8 B; 
#chains in the Genus database with same CATH homology
 3ACT A;  1JCQ B;  3WFA A;  1JYV A;  2CIQ A;  3M73 A;  4FXG B;  3WIR A;  3QG0 A;  4GL3 A;  3M74 A;  4Q88 A;  3VD7 A;  1CLC A;  1FPP B;  3D5S A;  2PN5 A;  3NRE A;  2H6F B;  3A3V A;  3PZ2 B;  1O79 A;  4CJ0 A;  1H3C A;  4AYP A;  1MMU A;  3QT9 A;  1TNZ B;  3I3D A;  3T0B A;  1IA6 A;  3DPY B;  1XW2 A;  3QDE A;  1NL4 B;  4M76 A;  3T2P A;  2ZQ0 A;  3S4C A;  2XQW A;  1OJO A;  3CIH A;  2WW2 A;  1J0N A;  4WVB A;  3PMM A;  3NJV A;  1H14 A;  3VDA A;  1G9G A;  3QSP A;  2XHN A;  1G6I A;  4ZH1 A;  3M71 A;  3ANK A;  3H2W A;  3K7X A;  4EHM B;  1FT1 B;  1D8E B;  1O1R B;  1SA4 B;  3DYP A;  4L9P B;  4RNL A;  1WU6 A;  2QNO A;  1QSJ A;  3RX7 A;  1HZF A;  2JKE A;  2H6I B;  1GSZ A;  3AFL A;  3PYB A;  3T2O A;  4CE7 A;  3EUV B;  2HTA A;  3CU7 A;  1L7K A;  2FUT A;  4AYO A;  2WVZ A;  2JF4 A;  3P5P A;  3BGA A;  1MMZ A;  3VDC A;  1D8D B;  3T09 A;  5GZK A;  2D5J A;  2V3P A;  1NSM A;  1H36 A;  1N4P B;  1F4H A;  3K25 A;  1WU5 A;  3TY1 A;  3Q78 B;  1FCE A;  1SO0 A;  4AQ0 A;  2AHF A;  2V8K A;  2DRO A;  4LNB B;  4FUS A;  1C82 A;  2A8Z A;  3OBA A;  1QQF A;  2H6G B;  1V7V A;  1LXK A;  3T33 A;  1V7X A;  4NEI A;  1V5D A;  1F9O A;  1V5C A;  3DSX B;  4GTM B;  2D73 A;  1V7W A;  3DYO A;  1H54 A;  1GHQ A;  1N95 B;  2FBA A;  2F6D A;  3T0A A;  2ZBL A;  3KSQ B;  4V1S A;  4DUV A;  1UMP A;  3KSL B;  1H39 A;  3VDB A;  2V8J A;  1G9J A;  4GTP B;  2SQC A;  4KKJ A;  3NJX A;  4BZH A;  1NSR A;  4DUW A;  3AFJ A;  2ZIR B;  3QT3 A;  3PZ1 B;  3BS6 A;  3ACS A;  2WVY A;  3RJ3 A;  4GTO B;  4ONT A;  5A1A A;  3Q1N A;  2AHG A;  4ZRQ A;  4XUV A;  4Z4J A;  3S9V A;  1O5M B;  4KTR A;  1QBQ B;  3M77 A;  1LD7 B;  2NOJ A;  3WKI A;  1H13 A;  1KRF A;  3PZ3 B;  3VSM A;  2D8L A;  1JYN A;  5CD2 A;  3S4A A;  1TXK A;  1EGU A;  1JCR B;  2AFA A;  2V8I A;  2R2L B;  2JKA A;  1G87 A;  1N7Q A;  3W7X A;  4BZF A;  2B39 A;  1TNU B;  1LOH A;  1KRE A;  4FNV A;  4YCR A;  5CA3 A;  3CZJ A;  1X1J A;  1H37 A;  1UG9 A;  1PX3 A;  3WC3 A;  3OB8 A;  3SFY B;  3S4B A;  1GLM A;  3SQC A;  2WII B;  1XWT A;  3E6U A;  3SDU A;  3DCD A;  3EU8 A;  2WVX A;  3QXF A;  3I3B A;  2JG0 A;  3E80 A;  1GAI A;  4OK4 A;  1N4R B;  3W7S A;  1N7R A;  1K1W A;  2YIK A;  1JYX A;  1FP3 A;  5DGR A;  2FUZ A;  3QFY A;  3WKF A;  3ANI A;  2E22 A;  4MMI A;  2H6H B;  3VD9 A;  3HXD B;  2VN4 A;  3W5M A;  1PX4 A;  1TNO B;  1H3A A;  2G0D A;  3S4D A;  1RWH A;  3MV0 1;  1F9D A;  3H7L A;  5AGD A;  4V1R A;  2BRP A;  4GTT B;  4ZG8 A;  3Q75 B;  5CZL A;  1MN0 A;  2P0V A;  3HXF B;  3T2Q A;  1O6R A;  2VN7 A;  1JOV A;  1X1I A;  2EAB A;  5M7Y A;  1NSZ A;  1MMX A;  5JMD A;  1SQC A;  1O1T B;  2ZXQ A;  3DEC A;  3H3K A;  3IAP A;  2ZIS B;  1W6J A;  1RWC A;  2E24 A;  3MV1 1;  3OED A;  2BRW A;  2JJB A;  4Q2B A;  1FT2 B;  4LNG B;  1N7N A;  2XFG A;  3M7B A;  1R76 A;  3WUX A;  4GTQ B;  4WVC A;  1JYW A;  1FBO A;  4L6X A;  3VXD A;  2GZ6 A;  4DOD A;  3HXC B;  1X9D A;  1IS9 A;  1JZ5 A;  2CQS A;  1FAE A;  1L7J A;  3W7W A;  1TNB B;  3D3I A;  4GTV B;  2F0Y B;  3MUZ 1;  3Q7A B;  1JCS B;  1VD5 A;  3E7J A;  4LIX A;  3WIW A;  1KFG A;  1KKT A;  2Q1F A;  3E73 A;  3GZK A;  2IEJ B;  3ON6 A;  1NS8 A;  3E1F 1;  3HXB B;  3VD4 A;  1HN0 A;  3E37 B;  4WU0 A;  1RWA A;  3QWT A;  1TNY B;  2ZZR A;  1DP0 A;  1HMW A;  3A24 A;  5JPM B;  3M7C A;  3WKG A;  1L1Y A;  3DSS B;  2WDA A;  1LXM A;  1N9A B;  3K11 A;  3M76 A;  5GY3 A;  1NS0 A;  2WYN A;  1RWF A;  2CIS A;  4Z4L A;  2Z07 A;  1JZ8 A;  3SDT A;  1N7P A;  1K1X A;  2GOX A;  1JZ6 A;  2WCO A;  4D4A A;  3PYA A;  5FOB B;  3RRS A;  1GA2 A;  1RQ5 A;  3SDQ A;  3DYM A;  2OKX A;  1KS8 A;  2BBC A;  1H12 A;  2BRV X;  3MUY 1;  5E2J A;  1N4S B;  4D94 A;  3M7L A;  3WVF A;  3DST B;  3PZ4 B;  3P2C A;  1KZP B;  4L0G A;  1CB8 A;  1TN7 B;  3SDR A;  1F4A A;  4TTG A;  1JZ2 A;  4ZRP A;  1NKG A;  1K1Y A;  1NS4 A;  3IAQ A;  1W3Y A;  2A73 B;  1X1H A;  3M78 A;  2XSG A;  4YDO B;  1HN1 A;  4TXT A;  1JS4 A;  4OJZ A;  3EZ8 A;  3MWX A;  2DRS A;  4MBG B;  4LNV A;  2XWB B;  2BED B;  2DRQ A;  3VD3 A;  1JZ4 A;  2EAD A;  3Q7F B;  3Q73 B;  1WZZ A;  3M75 A;  2V3N A;  1WU4 A;  3DSU B;  1DOG A;  1HMU A;  1FMI A;  1SA5 B;  4YDE B;  1N7O A;  1OJN A;  1O6H A;  3EU5 B;  1S64 B;  2PMV A;  1DCE B;  4ZH5 A;  2JKP A;  4BZE A;  3DRA B;  4D4D A;  3X17 A;  1I8Q A;  2WIN B;  2XWJ B;  4TF4 A;  4AYR A;  1X81 B;  3DSV B;  2DRR A;  1UT9 A;  4D4C A;  1KSC A;  1TN8 B;  3M72 A;  1HM2 A;  3J7H A;  3W7T A;  3VSN A;  3E34 B;  3EQA A;  4BZG A;  4JJJ A;  5JMF A;  1IA7 A;  2WVX B;  5DGQ A;  5MEH A;  3M7E A;  3SDV A;  1JZ3 A;  5KKB A;  1YGA A;  3OS7 A;  2G02 A;  4OK2 A;  4GTS B;  1DL2 A;  4DOE A;  1LF6 A;  1AGM A;  2BB6 A;  4AYQ A;  5FO9 B;  2CQT A;  3SEP A;  3GT5 A;  2WW3 A;  3ECQ A;  1TN6 B;  1J0M A;  1KSD A;  3SAE A;  1Z45 A;  1GAH A;  1OJM A;  4MU9 A;  2RI9 A;  3E33 B;  5GW7 A;  4WVA A;  1NS2 A;  3W7U A;  2BB5 A;  1C3D A;  3W5N A;  2CIR A;  3I3E A;  3RX8 A;  3A0O A;  3Q79 B;  1LTX B;  1NC5 A;  3RX5 A;  1GXM A;  3GLY A;  4BOK A;  1RW9 A;  3T0D A;  2RGK A;  1O6Q A;  2WY7 A;  3WKH A;  4GTR B;  1O1S B;  3QPF A;  1RWG A;  4D4B A;  3BLC A;  3ANJ A;  4MMH A;  3VD5 A;  1H3B A;  3C72 B;  5M7I A;  1FBW A;  1GXN A;  3P5R A;  2B4F A;  1YQ2 A;  2WZS A;  3T08 A;  1JZ7 A;  1SNZ A;  4J5T A;  1K72 A;  3DSW B;  4C1S A;  2GH4 A;  1F9G A;  2X03 A;  3OXU A;  2WW1 A;  1HM3 A;  1FO2 A;  5JPN B;  1S63 B;  3HXE B;  3KQ4 A;  1N94 B;  1LUR A;  1W6K A;  1OJP A;  4KTP A;  3RSY A;  1XWQ A;  3VW5 A;  1MZC B;  1TF4 A;  4QT9 A;  2RI8 A;  1NSV A;  3E32 B;  4FXK B;  3QRY A;  4EL8 A;  3IMH A;  1NS7 A;  2HTB A;  2NVP A;  3TF4 A;  3D5R A;  4BOJ A;  1ULV A;  2I07 B;  2EAC A;  2FV1 A;  1NSX A;  1GXO A;  1L2A A;  1H35 A;  3KLS A;  3REN A;  1HCU A;  1AYX A;  5FO8 B;  3WIQ A;  2WY8 A;  1KZO B;  5E1Q A;  1N4Q B;  1NSU A;  1KWF A;  3E30 B;  1NXC A;  1FO3 A;  1MMY A;  3QFZ A;  1NSS A;  1F1S A;  2EAE A;  1CEM A;  1NI1 B;  3SFX B;  5FO7 B;  1LF9 A;  2FV0 A;  3QXQ A;  4DUX A;  2WW0 A;  4CJ1 A;  3G6J B;  4KKI A;  2FUQ A;  1LD8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...