1LF9A

Crystal structure of bacterial glucoamylase complexed with acarbose
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
674
structure length
674
Chain Sequence
SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
total genus 246
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf9A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf9A01
5GY3A 1F9DA 1JZ7A 1MMXA 1NS2A 2WVZA 1NS7A 1AYXA 3WKIA 1FO2A 2BRVX 3IAPA 2QNOA 3ECQA 2AHFA 1JYNA 1I8QA 4L0GA 4WVCA 1NSSA 1ULVA 1G6IA 1KS8A 4Z4LA 3QG0A 1NC5A 3P2CA 1OJMA 4AQ0A 3QPFA 3OS7A 3TF4A 1HN1A 1NSUA 1OJPA 1UG9A 3VDAA 2D73A 3T08A 3E73A 1WU4A 5E2JA 1X1HA 1SNZA 1RWAA 2JKPA 3T0DA 1YQ2A 2YIKA 5CA3A 2VN7A 5M7YA 3QDEA 3A24A 2RI8A 3QFZA 2D5JA 3NJXA 3QXFA 4XUVA 2WW3A 3VDCA 1TF4A 1LXMA 1LF6A 2Q1FA 3W7TA 3WIWA 3W7WA 1K1XA 4AYQA 3QT9A 1LXKA 3VD4A 3J7HA 1KSDA 3NJVA 1RWFA 3T09A 3WKHA 3W7SA 4Q2BA 1OJOA 1JZ2A 2CIRA 3QRYA 3RSYA 1V7XA 1FP3A 3VD7A 1DL2A 5GW7A 3RENA 1EGUA 1VD5A 2EADA 3EZ8A 1L7JA 3T0AA 4DOEA 1KRFA 3T2OA 5CD2A 2WVXB 4KTPA 3H7LA 3BGAA 1N7OA 5MEHA 1N7NA 2JF4A 1JS4A 3RX8A 3VXDA 1JYXA 3VD9A 1F4AA 3ANJA 3W5MA 1L2AA 4CJ1A 2HTAA 3WIRA 1UT9A 3EQAA 1NSXA 3RX7A 1FCEA 2JJBA 3VW5A 1Z45A 2FBAA 3DYMA 2JKEA 1G9JA 5CZLA 1RQ5A 3QWTA 3DECA 1JYVA 2WVYA 5DGRA 1AGMA 3SEPA 2DRSA 2DRRA 3MV11 2EACA 3VDBA 3GT5A 1NSRA 1K1WA 2XSGA 2FV1A 1MN0A 3RX5A 1MMZA 1NSVA 1KREA 1X1IA 3VD3A 1F9GA 1WU5A 3GLYA 1G87A 1OJNA 2CISA 3T2PA 2WW2A 2WVXA 2WDAA 2CQTA 2X03A 3NREA 1CLCA 1JOVA 1FBOA 3AFJA 3I3EA 3IAQA 4FUSA 1KWFA 3S4AA 3I3DA 1HCUA 3E6UA 1V7VA 2ZQ0A 3Q1NA 3K25A 1LF9A 1HM2A 1H12A 3D3IA 3S4BA 3MV01 1GLMA 3WKFA 4EL8A 1TXKA 2NVPA 1H14A 3CIHA 1GAHA 4DODA 2BRPA 1V5CA 2JG0A 1X1JA 2WW0A 2E24A 1IS9A 3QFYA 4WVBA 1C82A 3MWXA 1JZ5A 3MUY1 2AHGA 3OB8A 1HN0A 3WUXA 3A3VA 1FMIA 1DOGA 4J5TA 1FO3A 1SO0A 2GZ6A 3ANIA 3WKGA 1RWGA 1F1SA 4L6XA 3ANKA 1NS4A 1JZ8A 2CQSA 1NKGA 1PX3A 2P0VA 1F9OA 3WFAA 2DROA 2RGKA 1K1YA 1JZ6A 5A1AA 1NS0A 3VD5A 2BRWA 3WIQA 2XFGA 2AFAA 2A8ZA 3DCDA 3ACTA 3GZKA 4AYOA 4DUVA 2D8LA 5DGQA 3H3KA 4DUXA 3CZJA 1K72A 1WZZA 1WU6A 1X9DA 3W7XA 3ACSA 2EAEA 1N7QA 2HTBA 4ZG8A 3X17A 2ZXQA 2CIQA 3MUZ1 4WVAA 3S4CA 5M7IA 2OKXA 3DYOA 1IA7A 3W5NA 1YGAA 1RWCA 3S4DA 1N7PA 1XW2A 3RRSA 1KSCA 1XWTA 1NSZA 4TF4A 1GA2A 1RW9A 3K11A 2B4FA 4Q88A 1V5DA 2GH4A 4TXTA 1CB8A 2ZZRA 1NSMA 4BZFA 1MMUA 1XWQA 2E22A 3QSPA 4AYPA 3OBAA 1MMYA 1IA6A 2EABA 1FBWA 3T33A 1NS8A 1FAEA 1JZ3A 3I3BA 3QT3A 4Z4JA 3WC3A 2VN4A 4JJJA 2WW1A 4AYRA 1KKTA 1HMUA 1L7KA 1N7RA 2FUZA 3PMMA 1G9GA 4KTRA 4CE7A 4CJ0A 1L1YA 1JZ4A 3QXQA 4BZEA 4ZH5A 2ZBLA 2XHNA 1NXCA 3H2WA 1HM3A 1DP0A 1HMWA 4DUWA 1GAIA 1W3YA 4RNLA 5E1QA 2Z07A 4BZHA 3W7UA 2F6DA 2FV0A 1LOHA 1JYWA 2WYNA 3E1F1 3T0BA 1CEMA 3IMHA 4TTGA 2WZSA 3T2QA 4BZGA 1PX4A 1LURA 1J0NA 1RWHA 1J0MA 3ON6A 1H54A 1V7WA 3DYPA 2RI9A 5KKBA 1H13A 1KFGA 2JKAA 2WCOA 2DRQA 1F4HA 4WU0A
chains in the Genus database with same CATH superfamily
5GY3A 1F9DA 2BB5A 1JZ7A 1MMXA 1NS2A 2WVZA 1NS7A 4GTPB 4L9PB 1AYXA 1N24A 3PZ4B 1FO2A 4OZWA 3WKIA 2BRVX 5JPMB 1UI7A 3IAPA 3Q73B 2XWJB 2QNOA 3ECQA 2AHFA 1JYNA 1I8QA 3M77A 2D1WA 2F18A 4K3AA 2OOVA 1W4NA 2F0YB 4L0GA 4WVCA 1NSSA 2V8JA 1QAKA 3SXXA 1ULVA 4FXGB 1G6IA 1KS8A 2C10A 4Z4LA 4OZVA 5FO8B 2F7PA 3QG0A 4D4DA 3SDTA 1NC5A 2NOJA 3P2CA 4YCRA 1OJMA 4MU9A 4AQ0A 3NBJA 1D8EB 3QPFA 2F7OA 1D6YA 3D51A 3OS7A 3DX4A 2H6FB 3TF4A 1HN1A 1NSUA 3D4YA 1OJPA 1UG9A 3VDAA 2D73A 3T08A 3E73A 1TNYB 1WU4A 1X1HA 3N0FA 5E2JA 1SNZA 1RWAA 2JKPA 3KIIA 5JMDA 3T0DA 1YQ2A 1TQSA 1QAFA 2YIKA 5CA3A 4D4BA 2VN7A 3K7XA 5M7YA 3HXDB 3QDEA 3A24A 1W2ZA 2RI8A 4FNUA 3E34B 4EV2A 4GTRB 1QQFA 5ILHA 3QFZA 2D5JA 3NJXA 3QXFA 3N0GA 1HV6A 2WY8A 3DX1A 4XUVA 2XQWA 3Q79B 2WW3A 1TF4A 3VDCA 5GZKA 1X81B 1LXMA 5AGDA 1N95B 1W5ZA 5ILDA 2BEDB 3M73A 2Q1FA 1LF6A 1TN6B 2BB6A 3DSSB 3W7TA 3BUQA 3NFVA 3WIWA 1H3AA 1W6GA 3DRAB 3W7WA 3K5TA 1K1XA 2ZL8A 4AYQA 1QBQB 3HIGA 3QT9A 4ZRPA 1LXKA 4E1YA 2YFOA 3VD4A 3M02A 3BVTA 2H6IB 1KSDA 3J7HA 3D5SA 3NJVA 1UMPA 1RWFA 3T09A 1H3CA 2ZIRB 3KSLB 3D50A 3WKHA 1LVNA 3W7SA 4FNRA 4Q2BA 2XN1A 1LD8B 5IKAA 4KFDA 4LNGB 1TQVA 1O1SB 1TU5A 1OJOA 4GAXA 1KSIA 1JZ2A 3RJ3A 3SFYB 1N4PB 1IQXA 2CIRA 4EV5A 3QRYA 3RSYA 3WA2X 1A2VA 1V7XA 1TNOB 1FP3A 1TQTA 2CFLA 3VD7A 3M75A 1DL2A 1N22A 2Y73A 4MMHA 5GW7A 1EGUA 3RENA 2CFGA 1VD5A 2EADA 2J5CA 2W0QA 3EZ8A 1L7JA 3T0AA 4DOEA 4ZH1A 2FUQA 1KRFA 3X3ZA 3T2OA 4BOJA 3M71A 5CD2A 2F7RA 2WVXB 1HX9A 4KTPA 3H7LA 3BGAA 3E7JA 1N7OA 5MEHA 2XN0A 1PS3A 1O1RB 1N7NA 1IQYA 2JF4A 1KZOB 1O6HA 2ZISB 1O7DD 1QWNA 1JS4A 1N9EA 3RX8A 3VXDA 1JYXA 2F1AA 4UFCA 3E33B 3VD9A 1HXCA 1F4AA 3MI6A 3KQ4A 4BTYA 1O1TB 3ANJA 3W5MA 3SDRA 1L2AA 4KFEA 3X41A 4CJ1A 2HTAA 2B39A 5FO7B 1SIHA 3WIRA 2WGQA 3BLBA 1KZPB 1UT9A 2PN5A 2IEJB 5FOBB 2BBCA 3EQAA 2F7QA 1LD7B 2CFWA 3A0OA 1NSXA 4ZRQA 3RX7A 1S64B 3BVUA 4BTWA 1FCEA 2JJBA 1JCSB 3VW5A 2FBAA 1Z45A 3DYMA 2JKEA 1G9JA 3EU8A 3Q75B 5CZLA 1RQ5A 3E80A 3BLCA 3QWTA 3DECA 1JYVA 3HXFB 4V1RA 2WVYA 5EASA 3DSVB 1AGMA 5DGRA 3SEPA 5JPNB 2DRSA 4GTSB 2DRRA 3MV11 2EACA 3VDBA 3GT5A 1NSRA 2CG0A 3KN4A 2V8KA 4OJZA 3PGBA 1K1WA 2OQEA 2XSGA 3N9HA 2FV1A 3M7BA 3DX2A 4GL3A 1TNZB 1MN0A 3RX5A 1MMZA 1N94B 1NSVA 3G6JB 1TQWA 2H6GB 1KREA 1X1IA 3DSXB 4GTOB 3VD3A 2CWVA 3PYAA 1F9GA 1QALA 1QWUA 1WU5A 4BOKA 1TNUB 3GLYA 1AVKA 1G87A 4BTXA 1OJNA 2BT3A 1HZFA 1TN7B 4MMIA 2CISA 3T2PA 2WW2A 5IL3A 4F10A 2WVXA 1HXGA 2WDAA 2CQTA 2X03A 3Q7AB 1UI8A 3NREA 5ILIA 1CLCA 4KKIA 4MBGB 5FO9B 1OACA 3EJUA 1NI1B 1JOVA 4GTQB 2GOXA 3DSWB 1FBOA 3NNBA 3AFJA 2E2UA 3I3EA 1N4SB 3IAQA 3G4FA 4FUSA 1KWFA 5IK9A 3SDUA 3PZ2B 4F13A 3TY1A 3S4AA 1N21A 5KBPA 1W6KA 4GTTB 1HCUA 3I3DA 3E6UA 1V7VA 2ZQ0A 3Q1NA 3M78A 2RDYA 5ILJA 1LF9A 3K25A 4FNQA 1W7CA 2H6HB 1HM2A 2SQCA 1H12A 4FNSA 3D3IA 3LOYA 3S4BA 1IVUA 3MV01 1GLMA 3WKFA 4EL8A 1TXKA 3HXCB 2NVPA 1O6RA 1WMNA 1DCEB 1H14A 3CIHA 1GAHA 2CWUA 1SIIA 2ONHA 4DODA 2BRPA 3EJSA 1V5CA 2JG0A 1X1JA 3C72B 4FJQA 2WW0A 2FUTA 2E24A 1IS9A 3QFYA 5DHIA 1QSJA 1C82A 4WVBA 1RKYA 2OOVC 3MWXA 1JZ5A 1US1A 3X3YA 3BVWA 1HTYA 1O5MB 3MUY1 2G0DA 2AHGA 3VSMA 3OB8A 1O6QA 1HN0A 1C3DA 1SQCA 4KKJA 3WUXA 1SPUA 3A3VA 1FMIA 1DOGA 4J5TA 1FO3A 1O79A 2WOHA 3M01A 3SFXB 2GZ6A 1SO0A 3ANIA 3WKGA 1D8DB 1RWGA 2WYIA 1F1SA 5EAUA 4OK2A 5ILYA 3BVXA 3EJQA 4L6XA 3ANKA 3BUPA 1NS4A 1W6JA 2ALWA 3OEDA 1JZ8A 1IVWA 2CQSA 1NKGA 1PX3A 2P0VA 3Q78B 5ILZA 1N4QB 4D4CA 1F9OA 2WY7A 1AV4A 3WFAA 2DROA 2RGKA 1K1YA 3VSNA 2WINB 1SA4B 1JZ6A 3E32B 2XN2A 5A1AA 1GXNA 1NS0A 1GXOA 1TNBB 3AFLA 3VD5A 1AVLA 3BVVA 2BRWA 1H36A 1NL4B 3WIQA 2XFGA 3M72A 2AFAA 2A8ZA 1R33A 3DCDA 3ACTA 1N1ZA 3GZKA 5EATA 3LZ9A 4AYOA 3DDFA 2CG1A 4DUVA 5JMFA 2D8LA 2G02A 2CWTA 5DGQA 1WMPA 3H3KA 3DSUB 2I07B 2PMVA 3M7LA 4QT9A 1K72A 3CZJA 3LVTA 4DUXA 3EU5B 1N23A 3EJRA 1D6ZA 1WZZA 3M74A 3P5PA 1WU6A 1PU4A 3ALAA 1X9DA 3W7XA 3ACSA 1N4RB 2EAEA 3DSTB 1N7QA 2WOFA 4KFFA 3DPYB 2HTBA 1QAZA 4ZG8A 3X17A 2FYVA 2ZXQA 2CFKA 2CIQA 5C05A 3MUZ1 5IK6A 1FT2B 1W6CA 4WVAA 1GXMA 3S4CA 2OKXA 5M7IA 3EJTA 1GHQA 2R2LB 3M76A 3DYOA 1H39A 1IA7A 3W5NA 1HWWA 1YGAA 2WYHA 2Y74A 1H3BA 1RWCA 5ILKA 1HXKA 3E37B 3S4DA 1H37A 3SDVA 1N7PA 1XW2A 3DDGA 3T0UA 3BUDA 2ONGA 5IL8A 4LIXA 3RRSA 3AMOB 3HIIA 1KSCA 1XWTA 1NSZA 3X3XA 4TF4A 1N20A 4FNPA 1GA2A 1MZCB 1RW9A 1TN8B 3K11A 5IKHA 3PZ1B 5IK0A 2B4FA 3PZ3B 1IVXA 2V8IA 1V5DA 4Q88A 2GH4A 1FT1B 4TXTA 1WMOA 1CB8A 4C1SA 4GTMB 1DYUA 2ZZRA 1HXAA 1NSMA 4BZFA 1MMUA 1XWQA 3CU7A 2E22A 2F1BA 4LNBB 3CV5A 3QSPA 1JCQB 3CZSA 4FNVA 4AYPA 3OBAA 1MMYA 3KLSA 1IA6A 2WO0A 1TQUA 2EABA 3SQCA 1FBWA 3HI7A 4YDEB 3DX3A 3P5RA 3T33A 3SAEA 1NS8A 1FAEA 2PNCA 1JZ3A 2WIIB 3E30B 3QT3A 4Z4JA 3WC3A 2VN4A 4LNVA 3I3BA 3WA3A 1SA5B 4JJJA 2WW1A 4AYRA 4D94A 1KKTA 1HMUA 1L7KA 1D6UA 3NBBA 3PYBA 3M7EA 1N7RA 4GTVB 2FUZA 3PMMA 4D4AA 5IM1A 3G4DA 4OK4A 1N9AB 1G9GA 4FXKB 4KTRA 3HXBB 1IVVA 1FPPB 2V3NA 4CE7A 4CJ0A 3D4ZA 1L1YA 5DHKA 1JZ4A 3QXQA 4RNQA 4ONTA 4BZEA 2OQEC 4ZH5A 1JCRB 2ZBLA 2YFNA 1GSZA 2XHNA 1NXCA 2C11A 3BUIA 2A73B 2V3PA 3H2WA 1HM3A 2CFDA 3DX0A 3SDQA 3MPHA 1HMWA 1DP0A 4DUWA 2XWBB 3KSQB 4K35A 1JRQA 3SX1A 1GAIA 1W3YA 4RNLA 5E1QA 4NEIA 2Z07A 4BZHA 1IU7A 3AMOA 3W7UA 1RJOA 3BUBA 2F6DA 3HXEB 2FV0A 1S63B 1LOHA 4V1SA 1JYWA 2WYNA 1R34A 2E2TA 4M76A 1H35A 3OXUA 2YX9A 3WVFA 3EUVB 3E1F1 1QX1A 3D52A 3T0BA 1CEMA 3IMHA 3BS6A 4TTGA 3D5RA 4EHMB 3M7CA 2WZSA 4YDOB 3CZNA 3T2QA 4BZGA 1PX4A 1LURA 3S9VA 3X40A 1J0NA 1RWHA 1J0MA 2E2VA 3ON6A 1H54A 1V7WA 3DYPA 1LTXB 1N1BA 2RI9A 1H13A 4DI5A 1R76A 3M00A 5KKBA 4FNTA 1KFGA 2OW6A 1EKMA 3Q7FB 2JKAA 3EJPA 2WCOA 2DRQA 1F4HA 4WU0A 2OW7A 3X42A
chains in the Genus database with same CATH topology
5GY3A 1F9DA 2BB5A 1JZ7A 1MMXA 1NS2A 2WVZA 1NS7A 4GTPB 4L9PB 1AYXA 3PZ4B 3WKIA 1FO2A 5JPMB 2BRVX 3IAPA 3Q73B 2XWJB 2QNOA 3ECQA 2AHFA 1JYNA 3M77A 1I8QA 2F0YB 4L0GA 4WVCA 1NSSA 2V8JA 1ULVA 4FXGB 1G6IA 1KS8A 4Z4LA 5FO8B 3QG0A 4D4DA 3SDTA 1NC5A 2NOJA 3P2CA 4YCRA 1OJMA 4MU9A 4AQ0A 1D8EB 3QPFA 3OS7A 2H6FB 3TF4A 1HN1A 1NSUA 1OJPA 1UG9A 3VDAA 2D73A 3T08A 3E73A 1TNYB 1WU4A 5E2JA 1X1HA 1SNZA 1RWAA 2JKPA 5JMDA 3T0DA 1YQ2A 2YIKA 5CA3A 4D4BA 2VN7A 3K7XA 5M7YA 3HXDB 3QDEA 3A24A 2RI8A 3E34B 4GTRB 1QQFA 3QFZA 2D5JA 3NJXA 3QXFA 2WY8A 4XUVA 2XQWA 3Q79B 2WW3A 1TF4A 3VDCA 5GZKA 1X81B 1LXMA 5AGDA 1N95B 2BEDB 3M73A 1LF6A 2Q1FA 1TN6B 2BB6A 3DSSB 3W7TA 3WIWA 1H3AA 3DRAB 3W7WA 1K1XA 4AYQA 1QBQB 3QT9A 4ZRPA 1LXKA 3VD4A 2H6IB 1KSDA 3J7HA 3D5SA 3NJVA 1UMPA 1RWFA 3T09A 1H3CA 2ZIRB 3KSLB 3WKHA 3W7SA 4Q2BA 1LD8B 4LNGB 1O1SB 1OJOA 1JZ2A 3RJ3A 3SFYB 1N4PB 2CIRA 3QRYA 3RSYA 1V7XA 1TNOB 1FP3A 3VD7A 3M75A 1DL2A 4MMHA 5GW7A 3RENA 1EGUA 1VD5A 2EADA 3EZ8A 1L7JA 3T0AA 4DOEA 4ZH1A 2FUQA 1KRFA 3T2OA 4BOJA 3M71A 5CD2A 2WVXB 4KTPA 3H7LA 3BGAA 3E7JA 1N7OA 5MEHA 1O1RB 1N7NA 2JF4A 1KZOB 1O6HA 2ZISB 1JS4A 3RX8A 3VXDA 1JYXA 3E33B 3VD9A 1F4AA 3KQ4A 1O1TB 3ANJA 3W5MA 3SDRA 1L2AA 4CJ1A 2HTAA 2B39A 5FO7B 3WIRA 1KZPB 1UT9A 2PN5A 2IEJB 5FOBB 2BBCA 3EQAA 1LD7B 3A0OA 1NSXA 4ZRQA 3RX7A 1S64B 1FCEA 2JJBA 1JCSB 3VW5A 2FBAA 1Z45A 3DYMA 2JKEA 1G9JA 3EU8A 3Q75B 5CZLA 1RQ5A 3BLCA 3E80A 3QWTA 3DECA 1JYVA 3HXFB 4V1RA 2WVYA 3DSVB 1AGMA 5DGRA 3SEPA 5JPNB 2DRSA 4GTSB 2DRRA 3MV11 2EACA 3VDBA 3GT5A 1NSRA 2V8KA 4OJZA 1K1WA 2XSGA 2FV1A 3M7BA 4GL3A 1TNZB 1MN0A 3RX5A 1MMZA 1N94B 1NSVA 3G6JB 2H6GB 1KREA 1X1IA 3DSXB 4GTOB 3VD3A 3PYAA 1F9GA 1WU5A 4BOKA 1TNUB 3GLYA 1G87A 1OJNA 2CISA 1HZFA 1TN7B 4MMIA 3T2PA 2WW2A 2WVXA 2WDAA 2CQTA 2X03A 3Q7AB 3NREA 1CLCA 4KKIA 4MBGB 5FO9B 1NI1B 1JOVA 4GTQB 2GOXA 3DSWB 1FBOA 3AFJA 3I3EA 1N4SB 3IAQA 4FUSA 1KWFA 3SDUA 3PZ2B 3TY1A 3S4AA 1W6KA 4GTTB 1HCUA 3I3DA 3E6UA 1V7VA 2ZQ0A 3Q1NA 3M78A 3K25A 1LF9A 2H6HB 1HM2A 2SQCA 1H12A 3D3IA 3S4BA 3MV01 1GLMA 3WKFA 4EL8A 1TXKA 3HXCB 2NVPA 1O6RA 1DCEB 1H14A 3CIHA 1GAHA 4DODA 2BRPA 1V5CA 2JG0A 3C72B 1X1JA 2WW0A 2FUTA 2E24A 1IS9A 3QFYA 1QSJA 4WVBA 1C82A 3MWXA 1JZ5A 1O5MB 3MUY1 2G0DA 2AHGA 3VSMA 3OB8A 1O6QA 1SQCA 1C3DA 1HN0A 4KKJA 3WUXA 3A3VA 1FMIA 1DOGA 4J5TA 1FO3A 1O79A 3SFXB 1SO0A 2GZ6A 3ANIA 3WKGA 1D8DB 1RWGA 1F1SA 4OK2A 4L6XA 3ANKA 1NS4A 1W6JA 3OEDA 1JZ8A 2CQSA 1NKGA 1PX3A 2P0VA 3Q78B 1N4QB 4D4CA 1F9OA 2WY7A 3WFAA 2DROA 2RGKA 1K1YA 3VSNA 2WINB 1SA4B 1JZ6A 3E32B 5A1AA 1GXNA 1NS0A 1GXOA 1TNBB 3AFLA 3VD5A 2BRWA 1H36A 1NL4B 3WIQA 2XFGA 3M72A 2AFAA 2A8ZA 3DCDA 3ACTA 3GZKA 4AYOA 4DUVA 5JMFA 2D8LA 2G02A 5DGQA 3H3KA 3DSUB 2I07B 2PMVA 3M7LA 4QT9A 1K72A 3CZJA 4DUXA 3EU5B 1WZZA 3M74A 3P5PA 1WU6A 1X9DA 3W7XA 3ACSA 1N4RB 2EAEA 3DSTB 1N7QA 3DPYB 2HTBA 4ZG8A 3X17A 2ZXQA 2CIQA 3MUZ1 1FT2B 4WVAA 1GXMA 3S4CA 2OKXA 5M7IA 1GHQA 2R2LB 3M76A 3DYOA 1H39A 1IA7A 3W5NA 1YGAA 1H3BA 1RWCA 3E37B 3S4DA 1H37A 3SDVA 1N7PA 1XW2A 3RRSA 4LIXA 1KSCA 1XWTA 1NSZA 4TF4A 1GA2A 1MZCB 1TN8B 3K11A 1RW9A 3PZ1B 2B4FA 3PZ3B 2V8IA 1V5DA 4Q88A 2GH4A 1FT1B 4TXTA 1CB8A 4C1SA 4GTMB 2ZZRA 1NSMA 4BZFA 1MMUA 1XWQA 3CU7A 2E22A 4LNBB 3QSPA 1JCQB 4AYPA 4FNVA 3OBAA 1MMYA 3KLSA 1IA6A 2EABA 3SQCA 1FBWA 4YDEB 3P5RA 3T33A 3SAEA 1NS8A 1FAEA 1JZ3A 2WIIB 3E30B 3QT3A 4Z4JA 3WC3A 2VN4A 4LNVA 3I3BA 1SA5B 4JJJA 2WW1A 4AYRA 4D94A 1KKTA 1HMUA 1L7KA 3PYBA 3M7EA 1N7RA 4GTVB 2FUZA 3PMMA 4D4AA 4OK4A 1N9AB 1G9GA 4FXKB 4KTRA 3HXBB 1FPPB 2V3NA 4CE7A 4CJ0A 1L1YA 1JZ4A 3QXQA 4ONTA 4BZEA 4ZH5A 1JCRB 2ZBLA 1GSZA 2XHNA 1NXCA 2A73B 2V3PA 3H2WA 1HM3A 3SDQA 1DP0A 1HMWA 4DUWA 2XWBB 3KSQB 1GAIA 1W3YA 4RNLA 5E1QA 4NEIA 2Z07A 4BZHA 3W7UA 2F6DA 3HXEB 2FV0A 1S63B 4V1SA 1LOHA 1JYWA 2WYNA 4M76A 1H35A 3OXUA 3WVFA 3EUVB 3E1F1 3T0BA 1CEMA 3IMHA 3BS6A 4TTGA 3D5RA 4EHMB 3M7CA 2WZSA 4YDOB 3T2QA 4BZGA 1PX4A 1LURA 3S9VA 1J0NA 1RWHA 1J0MA 3ON6A 1H54A 1V7WA 3DYPA 1LTXB 2RI9A 5KKBA 1H13A 1R76A 1KFGA 3Q7FB 2JKAA 2WCOA 2DRQA 1F4HA 4WU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GY3 A;  1F9D A;  1JZ7 A;  1MMX A;  1NS2 A;  2WVZ A;  1NS7 A;  1AYX A;  3WKI A;  1FO2 A;  2BRV X;  3IAP A;  2QNO A;  3ECQ A;  2AHF A;  1JYN A;  1I8Q A;  4L0G A;  4WVC A;  1NSS A;  1ULV A;  1G6I A;  1KS8 A;  4Z4L A;  3QG0 A;  1NC5 A;  3P2C A;  1OJM A;  4AQ0 A;  3QPF A;  3OS7 A;  3TF4 A;  1HN1 A;  1NSU A;  1OJP A;  1UG9 A;  3VDA A;  2D73 A;  3T08 A;  3E73 A;  1WU4 A;  5E2J A;  1X1H A;  1SNZ A;  1RWA A;  2JKP A;  3T0D A;  1YQ2 A;  2YIK A;  5CA3 A;  2VN7 A;  5M7Y A;  3QDE A;  3A24 A;  2RI8 A;  3QFZ A;  2D5J A;  3NJX A;  3QXF A;  4XUV A;  2WW3 A;  3VDC A;  1TF4 A;  1LXM A;  1LF6 A;  2Q1F A;  3W7T A;  3WIW A;  3W7W A;  1K1X A;  4AYQ A;  3QT9 A;  1LXK A;  3VD4 A;  3J7H A;  1KSD A;  3NJV A;  1RWF A;  3T09 A;  3WKH A;  3W7S A;  4Q2B A;  1OJO A;  1JZ2 A;  2CIR A;  3QRY A;  3RSY A;  1V7X A;  1FP3 A;  3VD7 A;  1DL2 A;  5GW7 A;  3REN A;  1EGU A;  1VD5 A;  2EAD A;  3EZ8 A;  1L7J A;  3T0A A;  4DOE A;  1KRF A;  3T2O A;  5CD2 A;  2WVX B;  4KTP A;  3H7L A;  3BGA A;  1N7O A;  5MEH A;  1N7N A;  2JF4 A;  1JS4 A;  3RX8 A;  3VXD A;  1JYX A;  3VD9 A;  1F4A A;  3ANJ A;  3W5M A;  1L2A A;  4CJ1 A;  2HTA A;  3WIR A;  1UT9 A;  3EQA A;  1NSX A;  3RX7 A;  1FCE A;  2JJB A;  3VW5 A;  1Z45 A;  2FBA A;  3DYM A;  2JKE A;  1G9J A;  5CZL A;  1RQ5 A;  3QWT A;  3DEC A;  1JYV A;  2WVY A;  5DGR A;  1AGM A;  3SEP A;  2DRS A;  2DRR A;  3MV1 1;  2EAC A;  3VDB A;  3GT5 A;  1NSR A;  1K1W A;  2XSG A;  2FV1 A;  1MN0 A;  3RX5 A;  1MMZ A;  1NSV A;  1KRE A;  1X1I A;  3VD3 A;  1F9G A;  1WU5 A;  3GLY A;  1G87 A;  1OJN A;  2CIS A;  3T2P A;  2WW2 A;  2WVX A;  2WDA A;  2CQT A;  2X03 A;  3NRE A;  1CLC A;  1JOV A;  1FBO A;  3AFJ A;  3I3E A;  3IAQ A;  4FUS A;  1KWF A;  3S4A A;  3I3D A;  1HCU A;  3E6U A;  1V7V A;  2ZQ0 A;  3Q1N A;  3K25 A;  1LF9 A;  1HM2 A;  1H12 A;  3D3I A;  3S4B A;  3MV0 1;  1GLM A;  3WKF A;  4EL8 A;  1TXK A;  2NVP A;  1H14 A;  3CIH A;  1GAH A;  4DOD A;  2BRP A;  1V5C A;  2JG0 A;  1X1J A;  2WW0 A;  2E24 A;  1IS9 A;  3QFY A;  4WVB A;  1C82 A;  3MWX A;  1JZ5 A;  3MUY 1;  2AHG A;  3OB8 A;  1HN0 A;  3WUX A;  3A3V A;  1FMI A;  1DOG A;  4J5T A;  1FO3 A;  1SO0 A;  2GZ6 A;  3ANI A;  3WKG A;  1RWG A;  1F1S A;  4L6X A;  3ANK A;  1NS4 A;  1JZ8 A;  2CQS A;  1NKG A;  1PX3 A;  2P0V A;  1F9O A;  3WFA A;  2DRO A;  2RGK A;  1K1Y A;  1JZ6 A;  5A1A A;  1NS0 A;  3VD5 A;  2BRW A;  3WIQ A;  2XFG A;  2AFA A;  2A8Z A;  3DCD A;  3ACT A;  3GZK A;  4AYO A;  4DUV A;  2D8L A;  5DGQ A;  3H3K A;  4DUX A;  3CZJ A;  1K72 A;  1WZZ A;  1WU6 A;  1X9D A;  3W7X A;  3ACS A;  2EAE A;  1N7Q A;  2HTB A;  4ZG8 A;  3X17 A;  2ZXQ A;  2CIQ A;  3MUZ 1;  4WVA A;  3S4C A;  5M7I A;  2OKX A;  3DYO A;  1IA7 A;  3W5N A;  1YGA A;  1RWC A;  3S4D A;  1N7P A;  1XW2 A;  3RRS A;  1KSC A;  1XWT A;  1NSZ A;  4TF4 A;  1GA2 A;  1RW9 A;  3K11 A;  2B4F A;  4Q88 A;  1V5D A;  2GH4 A;  4TXT A;  1CB8 A;  2ZZR A;  1NSM A;  4BZF A;  1MMU A;  1XWQ A;  2E22 A;  3QSP A;  4AYP A;  3OBA A;  1MMY A;  1IA6 A;  2EAB A;  1FBW A;  3T33 A;  1NS8 A;  1FAE A;  1JZ3 A;  3I3B A;  3QT3 A;  4Z4J A;  3WC3 A;  2VN4 A;  4JJJ A;  2WW1 A;  4AYR A;  1KKT A;  1HMU A;  1L7K A;  1N7R A;  2FUZ A;  3PMM A;  1G9G A;  4KTR A;  4CE7 A;  4CJ0 A;  1L1Y A;  1JZ4 A;  3QXQ A;  4BZE A;  4ZH5 A;  2ZBL A;  2XHN A;  1NXC A;  3H2W A;  1HM3 A;  1DP0 A;  1HMW A;  4DUW A;  1GAI A;  1W3Y A;  4RNL A;  5E1Q A;  2Z07 A;  4BZH A;  3W7U A;  2F6D A;  2FV0 A;  1LOH A;  1JYW A;  2WYN A;  3E1F 1;  3T0B A;  1CEM A;  3IMH A;  4TTG A;  2WZS A;  3T2Q A;  4BZG A;  1PX4 A;  1LUR A;  1J0N A;  1RWH A;  1J0M A;  3ON6 A;  1H54 A;  1V7W A;  3DYP A;  2RI9 A;  5KKB A;  1H13 A;  1KFG A;  2JKA A;  2WCO A;  2DRQ A;  1F4H A;  4WU0 A; 
#chains in the Genus database with same CATH topology
 5GY3 A;  1F9D A;  2BB5 A;  1JZ7 A;  1MMX A;  1NS2 A;  2WVZ A;  1NS7 A;  4GTP B;  4L9P B;  1AYX A;  1N24 A;  3PZ4 B;  1FO2 A;  4OZW A;  3WKI A;  2BRV X;  5JPM B;  1UI7 A;  3IAP A;  3Q73 B;  2XWJ B;  2QNO A;  3ECQ A;  2AHF A;  1JYN A;  1I8Q A;  3M77 A;  2D1W A;  2F18 A;  4K3A A;  2OOV A;  1W4N A;  2F0Y B;  4L0G A;  4WVC A;  1NSS A;  2V8J A;  1QAK A;  3SXX A;  1ULV A;  4FXG B;  1G6I A;  1KS8 A;  2C10 A;  4Z4L A;  4OZV A;  5FO8 B;  2F7P A;  3QG0 A;  4D4D A;  3SDT A;  1NC5 A;  2NOJ A;  3P2C A;  4YCR A;  1OJM A;  4MU9 A;  4AQ0 A;  3NBJ A;  1D8E B;  3QPF A;  2F7O A;  1D6Y A;  3D51 A;  3OS7 A;  3DX4 A;  2H6F B;  3TF4 A;  1HN1 A;  1NSU A;  3D4Y A;  1OJP A;  1UG9 A;  3VDA A;  2D73 A;  3T08 A;  3E73 A;  1TNY B;  1WU4 A;  1X1H A;  3N0F A;  5E2J A;  1SNZ A;  1RWA A;  2JKP A;  3KII A;  5JMD A;  3T0D A;  1YQ2 A;  1TQS A;  1QAF A;  2YIK A;  5CA3 A;  4D4B A;  2VN7 A;  3K7X A;  5M7Y A;  3HXD B;  3QDE A;  3A24 A;  1W2Z A;  2RI8 A;  4FNU A;  3E34 B;  4EV2 A;  4GTR B;  1QQF A;  5ILH A;  3QFZ A;  2D5J A;  3NJX A;  3QXF A;  3N0G A;  1HV6 A;  2WY8 A;  3DX1 A;  4XUV A;  2XQW A;  3Q79 B;  2WW3 A;  1TF4 A;  3VDC A;  5GZK A;  1X81 B;  1LXM A;  5AGD A;  1N95 B;  1W5Z A;  5ILD A;  2BED B;  3M73 A;  2Q1F A;  1LF6 A;  1TN6 B;  2BB6 A;  3DSS B;  3W7T A;  3BUQ A;  3NFV A;  3WIW A;  1H3A A;  1W6G A;  3DRA B;  3W7W A;  3K5T A;  1K1X A;  2ZL8 A;  4AYQ A;  1QBQ B;  3HIG A;  3QT9 A;  4ZRP A;  1LXK A;  4E1Y A;  2YFO A;  3VD4 A;  3M02 A;  3BVT A;  2H6I B;  1KSD A;  3J7H A;  3D5S A;  3NJV A;  1UMP A;  1RWF A;  3T09 A;  1H3C A;  2ZIR B;  3KSL B;  3D50 A;  3WKH A;  1LVN A;  3W7S A;  4FNR A;  4Q2B A;  2XN1 A;  1LD8 B;  5IKA A;  4KFD A;  4LNG B;  1TQV A;  1O1S B;  1TU5 A;  1OJO A;  4GAX A;  1KSI A;  1JZ2 A;  3RJ3 A;  3SFY B;  1N4P B;  1IQX A;  2CIR A;  4EV5 A;  3QRY A;  3RSY A;  3WA2 X;  1A2V A;  1V7X A;  1TNO B;  1FP3 A;  1TQT A;  2CFL A;  3VD7 A;  3M75 A;  1DL2 A;  1N22 A;  2Y73 A;  4MMH A;  5GW7 A;  1EGU A;  3REN A;  2CFG A;  1VD5 A;  2EAD A;  2J5C A;  2W0Q A;  3EZ8 A;  1L7J A;  3T0A A;  4DOE A;  4ZH1 A;  2FUQ A;  1KRF A;  3X3Z A;  3T2O A;  4BOJ A;  3M71 A;  5CD2 A;  2F7R A;  2WVX B;  1HX9 A;  4KTP A;  3H7L A;  3BGA A;  3E7J A;  1N7O A;  5MEH A;  2XN0 A;  1PS3 A;  1O1R B;  1N7N A;  1IQY A;  2JF4 A;  1KZO B;  1O6H A;  2ZIS B;  1O7D D;  1QWN A;  1JS4 A;  1N9E A;  3RX8 A;  3VXD A;  1JYX A;  2F1A A;  4UFC A;  3E33 B;  3VD9 A;  1HXC A;  1F4A A;  3MI6 A;  3KQ4 A;  4BTY A;  1O1T B;  3ANJ A;  3W5M A;  3SDR A;  1L2A A;  4KFE A;  3X41 A;  4CJ1 A;  2HTA A;  2B39 A;  5FO7 B;  1SIH A;  3WIR A;  2WGQ A;  3BLB A;  1KZP B;  1UT9 A;  2PN5 A;  2IEJ B;  5FOB B;  2BBC A;  3EQA A;  2F7Q A;  1LD7 B;  2CFW A;  3A0O A;  1NSX A;  4ZRQ A;  3RX7 A;  1S64 B;  3BVU A;  4BTW A;  1FCE A;  2JJB A;  1JCS B;  3VW5 A;  2FBA A;  1Z45 A;  3DYM A;  2JKE A;  1G9J A;  3EU8 A;  3Q75 B;  5CZL A;  1RQ5 A;  3E80 A;  3BLC A;  3QWT A;  3DEC A;  1JYV A;  3HXF B;  4V1R A;  2WVY A;  5EAS A;  3DSV B;  1AGM A;  5DGR A;  3SEP A;  5JPN B;  2DRS A;  4GTS B;  2DRR A;  3MV1 1;  2EAC A;  3VDB A;  3GT5 A;  1NSR A;  2CG0 A;  3KN4 A;  2V8K A;  4OJZ A;  3PGB A;  1K1W A;  2OQE A;  2XSG A;  3N9H A;  2FV1 A;  3M7B A;  3DX2 A;  4GL3 A;  1TNZ B;  1MN0 A;  3RX5 A;  1MMZ A;  1N94 B;  1NSV A;  3G6J B;  1TQW A;  2H6G B;  1KRE A;  1X1I A;  3DSX B;  4GTO B;  3VD3 A;  2CWV A;  3PYA A;  1F9G A;  1QAL A;  1QWU A;  1WU5 A;  4BOK A;  1TNU B;  3GLY A;  1AVK A;  1G87 A;  4BTX A;  1OJN A;  2BT3 A;  1HZF A;  1TN7 B;  4MMI A;  2CIS A;  3T2P A;  2WW2 A;  5IL3 A;  4F10 A;  2WVX A;  1HXG A;  2WDA A;  2CQT A;  2X03 A;  3Q7A B;  1UI8 A;  3NRE A;  5ILI A;  1CLC A;  4KKI A;  4MBG B;  5FO9 B;  1OAC A;  3EJU A;  1NI1 B;  1JOV A;  4GTQ B;  2GOX A;  3DSW B;  1FBO A;  3NNB A;  3AFJ A;  2E2U A;  3I3E A;  1N4S B;  3IAQ A;  3G4F A;  4FUS A;  1KWF A;  5IK9 A;  3SDU A;  3PZ2 B;  4F13 A;  3TY1 A;  3S4A A;  1N21 A;  5KBP A;  1W6K A;  4GTT B;  1HCU A;  3I3D A;  3E6U A;  1V7V A;  2ZQ0 A;  3Q1N A;  3M78 A;  2RDY A;  5ILJ A;  1LF9 A;  3K25 A;  4FNQ A;  1W7C A;  2H6H B;  1HM2 A;  2SQC A;  1H12 A;  4FNS A;  3D3I A;  3LOY A;  3S4B A;  1IVU A;  3MV0 1;  1GLM A;  3WKF A;  4EL8 A;  1TXK A;  3HXC B;  2NVP A;  1O6R A;  1WMN A;  1DCE B;  1H14 A;  3CIH A;  1GAH A;  2CWU A;  1SII A;  2ONH A;  4DOD A;  2BRP A;  3EJS A;  1V5C A;  2JG0 A;  1X1J A;  3C72 B;  4FJQ A;  2WW0 A;  2FUT A;  2E24 A;  1IS9 A;  3QFY A;  5DHI A;  1QSJ A;  1C82 A;  4WVB A;  1RKY A;  2OOV C;  3MWX A;  1JZ5 A;  1US1 A;  3X3Y A;  3BVW A;  1HTY A;  1O5M B;  3MUY 1;  2G0D A;  2AHG A;  3VSM A;  3OB8 A;  1O6Q A;  1HN0 A;  1C3D A;  1SQC A;  4KKJ A;  3WUX A;  1SPU A;  3A3V A;  1FMI A;  1DOG A;  4J5T A;  1FO3 A;  1O79 A;  2WOH A;  3M01 A;  3SFX B;  2GZ6 A;  1SO0 A;  3ANI A;  3WKG A;  1D8D B;  1RWG A;  2WYI A;  1F1S A;  5EAU A;  4OK2 A;  5ILY A;  3BVX A;  3EJQ A;  4L6X A;  3ANK A;  3BUP A;  1NS4 A;  1W6J A;  2ALW A;  3OED A;  1JZ8 A;  1IVW A;  2CQS A;  1NKG A;  1PX3 A;  2P0V A;  3Q78 B;  5ILZ A;  1N4Q B;  4D4C A;  1F9O A;  2WY7 A;  1AV4 A;  3WFA A;  2DRO A;  2RGK A;  1K1Y A;  3VSN A;  2WIN B;  1SA4 B;  1JZ6 A;  3E32 B;  2XN2 A;  5A1A A;  1GXN A;  1NS0 A;  1GXO A;  1TNB B;  3AFL A;  3VD5 A;  1AVL A;  3BVV A;  2BRW A;  1H36 A;  1NL4 B;  3WIQ A;  2XFG A;  3M72 A;  2AFA A;  2A8Z A;  1R33 A;  3DCD A;  3ACT A;  1N1Z A;  3GZK A;  5EAT A;  3LZ9 A;  4AYO A;  3DDF A;  2CG1 A;  4DUV A;  5JMF A;  2D8L A;  2G02 A;  2CWT A;  5DGQ A;  1WMP A;  3H3K A;  3DSU B;  2I07 B;  2PMV A;  3M7L A;  4QT9 A;  1K72 A;  3CZJ A;  3LVT A;  4DUX A;  3EU5 B;  1N23 A;  3EJR A;  1D6Z A;  1WZZ A;  3M74 A;  3P5P A;  1WU6 A;  1PU4 A;  3ALA A;  1X9D A;  3W7X A;  3ACS A;  1N4R B;  2EAE A;  3DST B;  1N7Q A;  2WOF A;  4KFF A;  3DPY B;  2HTB A;  1QAZ A;  4ZG8 A;  3X17 A;  2FYV A;  2ZXQ A;  2CFK A;  2CIQ A;  5C05 A;  3MUZ 1;  5IK6 A;  1FT2 B;  1W6C A;  4WVA A;  1GXM A;  3S4C A;  2OKX A;  5M7I A;  3EJT A;  1GHQ A;  2R2L B;  3M76 A;  3DYO A;  1H39 A;  1IA7 A;  3W5N A;  1HWW A;  1YGA A;  2WYH A;  2Y74 A;  1H3B A;  1RWC A;  5ILK A;  1HXK A;  3E37 B;  3S4D A;  1H37 A;  3SDV A;  1N7P A;  1XW2 A;  3DDG A;  3T0U A;  3BUD A;  2ONG A;  5IL8 A;  4LIX A;  3RRS A;  3AMO B;  3HII A;  1KSC A;  1XWT A;  1NSZ A;  3X3X A;  4TF4 A;  1N20 A;  4FNP A;  1GA2 A;  1MZC B;  1RW9 A;  1TN8 B;  3K11 A;  5IKH A;  3PZ1 B;  5IK0 A;  2B4F A;  3PZ3 B;  1IVX A;  2V8I A;  1V5D A;  4Q88 A;  2GH4 A;  1FT1 B;  4TXT A;  1WMO A;  1CB8 A;  4C1S A;  4GTM B;  1DYU A;  2ZZR A;  1HXA A;  1NSM A;  4BZF A;  1MMU A;  1XWQ A;  3CU7 A;  2E22 A;  2F1B A;  4LNB B;  3CV5 A;  3QSP A;  1JCQ B;  3CZS A;  4FNV A;  4AYP A;  3OBA A;  1MMY A;  3KLS A;  1IA6 A;  2WO0 A;  1TQU A;  2EAB A;  3SQC A;  1FBW A;  3HI7 A;  4YDE B;  3DX3 A;  3P5R A;  3T33 A;  3SAE A;  1NS8 A;  1FAE A;  2PNC A;  1JZ3 A;  2WII B;  3E30 B;  3QT3 A;  4Z4J A;  3WC3 A;  2VN4 A;  4LNV A;  3I3B A;  3WA3 A;  1SA5 B;  4JJJ A;  2WW1 A;  4AYR A;  4D94 A;  1KKT A;  1HMU A;  1L7K A;  1D6U A;  3NBB A;  3PYB A;  3M7E A;  1N7R A;  4GTV B;  2FUZ A;  3PMM A;  4D4A A;  5IM1 A;  3G4D A;  4OK4 A;  1N9A B;  1G9G A;  4FXK B;  4KTR A;  3HXB B;  1IVV A;  1FPP B;  2V3N A;  4CE7 A;  4CJ0 A;  3D4Z A;  1L1Y A;  5DHK A;  1JZ4 A;  3QXQ A;  4RNQ A;  4ONT A;  4BZE A;  2OQE C;  4ZH5 A;  1JCR B;  2ZBL A;  2YFN A;  1GSZ A;  2XHN A;  1NXC A;  2C11 A;  3BUI A;  2A73 B;  2V3P A;  3H2W A;  1HM3 A;  2CFD A;  3DX0 A;  3SDQ A;  3MPH A;  1HMW A;  1DP0 A;  4DUW A;  2XWB B;  3KSQ B;  4K35 A;  1JRQ A;  3SX1 A;  1GAI A;  1W3Y A;  4RNL A;  5E1Q A;  4NEI A;  2Z07 A;  4BZH A;  1IU7 A;  3AMO A;  3W7U A;  1RJO A;  3BUB A;  2F6D A;  3HXE B;  2FV0 A;  1S63 B;  1LOH A;  4V1S A;  1JYW A;  2WYN A;  1R34 A;  2E2T A;  4M76 A;  1H35 A;  3OXU A;  2YX9 A;  3WVF A;  3EUV B;  3E1F 1;  1QX1 A;  3D52 A;  3T0B A;  1CEM A;  3IMH A;  3BS6 A;  4TTG A;  3D5R A;  4EHM B;  3M7C A;  2WZS A;  4YDO B;  3CZN A;  3T2Q A;  4BZG A;  1PX4 A;  1LUR A;  3S9V A;  3X40 A;  1J0N A;  1RWH A;  1J0M A;  2E2V A;  3ON6 A;  1H54 A;  1V7W A;  3DYP A;  1LTX B;  1N1B A;  2RI9 A;  1H13 A;  4DI5 A;  1R76 A;  3M00 A;  5KKB A;  4FNT A;  1KFG A;  2OW6 A;  1EKM A;  3Q7F B;  2JKA A;  3EJP A;  2WCO A;  2DRQ A;  1F4H A;  4WU0 A;  2OW7 A;  3X42 A; 
#chains in the Genus database with same CATH homology
 5GY3 A;  1F9D A;  2BB5 A;  1JZ7 A;  1MMX A;  1NS2 A;  2WVZ A;  1NS7 A;  4GTP B;  4L9P B;  1AYX A;  3PZ4 B;  3WKI A;  1FO2 A;  5JPM B;  2BRV X;  3IAP A;  3Q73 B;  2XWJ B;  2QNO A;  3ECQ A;  2AHF A;  1JYN A;  3M77 A;  1I8Q A;  2F0Y B;  4L0G A;  4WVC A;  1NSS A;  2V8J A;  1ULV A;  4FXG B;  1G6I A;  1KS8 A;  4Z4L A;  5FO8 B;  3QG0 A;  4D4D A;  3SDT A;  1NC5 A;  2NOJ A;  3P2C A;  4YCR A;  1OJM A;  4MU9 A;  4AQ0 A;  1D8E B;  3QPF A;  3OS7 A;  2H6F B;  3TF4 A;  1HN1 A;  1NSU A;  1OJP A;  1UG9 A;  3VDA A;  2D73 A;  3T08 A;  3E73 A;  1TNY B;  1WU4 A;  5E2J A;  1X1H A;  1SNZ A;  1RWA A;  2JKP A;  5JMD A;  3T0D A;  1YQ2 A;  2YIK A;  5CA3 A;  4D4B A;  2VN7 A;  3K7X A;  5M7Y A;  3HXD B;  3QDE A;  3A24 A;  2RI8 A;  3E34 B;  4GTR B;  1QQF A;  3QFZ A;  2D5J A;  3NJX A;  3QXF A;  2WY8 A;  4XUV A;  2XQW A;  3Q79 B;  2WW3 A;  1TF4 A;  3VDC A;  5GZK A;  1X81 B;  1LXM A;  5AGD A;  1N95 B;  2BED B;  3M73 A;  1LF6 A;  2Q1F A;  1TN6 B;  2BB6 A;  3DSS B;  3W7T A;  3WIW A;  1H3A A;  3DRA B;  3W7W A;  1K1X A;  4AYQ A;  1QBQ B;  3QT9 A;  4ZRP A;  1LXK A;  3VD4 A;  2H6I B;  1KSD A;  3J7H A;  3D5S A;  3NJV A;  1UMP A;  1RWF A;  3T09 A;  1H3C A;  2ZIR B;  3KSL B;  3WKH A;  3W7S A;  4Q2B A;  1LD8 B;  4LNG B;  1O1S B;  1OJO A;  1JZ2 A;  3RJ3 A;  3SFY B;  1N4P B;  2CIR A;  3QRY A;  3RSY A;  1V7X A;  1TNO B;  1FP3 A;  3VD7 A;  3M75 A;  1DL2 A;  4MMH A;  5GW7 A;  3REN A;  1EGU A;  1VD5 A;  2EAD A;  3EZ8 A;  1L7J A;  3T0A A;  4DOE A;  4ZH1 A;  2FUQ A;  1KRF A;  3T2O A;  4BOJ A;  3M71 A;  5CD2 A;  2WVX B;  4KTP A;  3H7L A;  3BGA A;  3E7J A;  1N7O A;  5MEH A;  1O1R B;  1N7N A;  2JF4 A;  1KZO B;  1O6H A;  2ZIS B;  1JS4 A;  3RX8 A;  3VXD A;  1JYX A;  3E33 B;  3VD9 A;  1F4A A;  3KQ4 A;  1O1T B;  3ANJ A;  3W5M A;  3SDR A;  1L2A A;  4CJ1 A;  2HTA A;  2B39 A;  5FO7 B;  3WIR A;  1KZP B;  1UT9 A;  2PN5 A;  2IEJ B;  5FOB B;  2BBC A;  3EQA A;  1LD7 B;  3A0O A;  1NSX A;  4ZRQ A;  3RX7 A;  1S64 B;  1FCE A;  2JJB A;  1JCS B;  3VW5 A;  2FBA A;  1Z45 A;  3DYM A;  2JKE A;  1G9J A;  3EU8 A;  3Q75 B;  5CZL A;  1RQ5 A;  3BLC A;  3E80 A;  3QWT A;  3DEC A;  1JYV A;  3HXF B;  4V1R A;  2WVY A;  3DSV B;  1AGM A;  5DGR A;  3SEP A;  5JPN B;  2DRS A;  4GTS B;  2DRR A;  3MV1 1;  2EAC A;  3VDB A;  3GT5 A;  1NSR A;  2V8K A;  4OJZ A;  1K1W A;  2XSG A;  2FV1 A;  3M7B A;  4GL3 A;  1TNZ B;  1MN0 A;  3RX5 A;  1MMZ A;  1N94 B;  1NSV A;  3G6J B;  2H6G B;  1KRE A;  1X1I A;  3DSX B;  4GTO B;  3VD3 A;  3PYA A;  1F9G A;  1WU5 A;  4BOK A;  1TNU B;  3GLY A;  1G87 A;  1OJN A;  2CIS A;  1HZF A;  1TN7 B;  4MMI A;  3T2P A;  2WW2 A;  2WVX A;  2WDA A;  2CQT A;  2X03 A;  3Q7A B;  3NRE A;  1CLC A;  4KKI A;  4MBG B;  5FO9 B;  1NI1 B;  1JOV A;  4GTQ B;  2GOX A;  3DSW B;  1FBO A;  3AFJ A;  3I3E A;  1N4S B;  3IAQ A;  4FUS A;  1KWF A;  3SDU A;  3PZ2 B;  3TY1 A;  3S4A A;  1W6K A;  4GTT B;  1HCU A;  3I3D A;  3E6U A;  1V7V A;  2ZQ0 A;  3Q1N A;  3M78 A;  3K25 A;  1LF9 A;  2H6H B;  1HM2 A;  2SQC A;  1H12 A;  3D3I A;  3S4B A;  3MV0 1;  1GLM A;  3WKF A;  4EL8 A;  1TXK A;  3HXC B;  2NVP A;  1O6R A;  1DCE B;  1H14 A;  3CIH A;  1GAH A;  4DOD A;  2BRP A;  1V5C A;  2JG0 A;  3C72 B;  1X1J A;  2WW0 A;  2FUT A;  2E24 A;  1IS9 A;  3QFY A;  1QSJ A;  4WVB A;  1C82 A;  3MWX A;  1JZ5 A;  1O5M B;  3MUY 1;  2G0D A;  2AHG A;  3VSM A;  3OB8 A;  1O6Q A;  1SQC A;  1C3D A;  1HN0 A;  4KKJ A;  3WUX A;  3A3V A;  1FMI A;  1DOG A;  4J5T A;  1FO3 A;  1O79 A;  3SFX B;  1SO0 A;  2GZ6 A;  3ANI A;  3WKG A;  1D8D B;  1RWG A;  1F1S A;  4OK2 A;  4L6X A;  3ANK A;  1NS4 A;  1W6J A;  3OED A;  1JZ8 A;  2CQS A;  1NKG A;  1PX3 A;  2P0V A;  3Q78 B;  1N4Q B;  4D4C A;  1F9O A;  2WY7 A;  3WFA A;  2DRO A;  2RGK A;  1K1Y A;  3VSN A;  2WIN B;  1SA4 B;  1JZ6 A;  3E32 B;  5A1A A;  1GXN A;  1NS0 A;  1GXO A;  1TNB B;  3AFL A;  3VD5 A;  2BRW A;  1H36 A;  1NL4 B;  3WIQ A;  2XFG A;  3M72 A;  2AFA A;  2A8Z A;  3DCD A;  3ACT A;  3GZK A;  4AYO A;  4DUV A;  5JMF A;  2D8L A;  2G02 A;  5DGQ A;  3H3K A;  3DSU B;  2I07 B;  2PMV A;  3M7L A;  4QT9 A;  1K72 A;  3CZJ A;  4DUX A;  3EU5 B;  1WZZ A;  3M74 A;  3P5P A;  1WU6 A;  1X9D A;  3W7X A;  3ACS A;  1N4R B;  2EAE A;  3DST B;  1N7Q A;  3DPY B;  2HTB A;  4ZG8 A;  3X17 A;  2ZXQ A;  2CIQ A;  3MUZ 1;  1FT2 B;  4WVA A;  1GXM A;  3S4C A;  2OKX A;  5M7I A;  1GHQ A;  2R2L B;  3M76 A;  3DYO A;  1H39 A;  1IA7 A;  3W5N A;  1YGA A;  1H3B A;  1RWC A;  3E37 B;  3S4D A;  1H37 A;  3SDV A;  1N7P A;  1XW2 A;  3RRS A;  4LIX A;  1KSC A;  1XWT A;  1NSZ A;  4TF4 A;  1GA2 A;  1MZC B;  1TN8 B;  3K11 A;  1RW9 A;  3PZ1 B;  2B4F A;  3PZ3 B;  2V8I A;  1V5D A;  4Q88 A;  2GH4 A;  1FT1 B;  4TXT A;  1CB8 A;  4C1S A;  4GTM B;  2ZZR A;  1NSM A;  4BZF A;  1MMU A;  1XWQ A;  3CU7 A;  2E22 A;  4LNB B;  3QSP A;  1JCQ B;  4AYP A;  4FNV A;  3OBA A;  1MMY A;  3KLS A;  1IA6 A;  2EAB A;  3SQC A;  1FBW A;  4YDE B;  3P5R A;  3T33 A;  3SAE A;  1NS8 A;  1FAE A;  1JZ3 A;  2WII B;  3E30 B;  3QT3 A;  4Z4J A;  3WC3 A;  2VN4 A;  4LNV A;  3I3B A;  1SA5 B;  4JJJ A;  2WW1 A;  4AYR A;  4D94 A;  1KKT A;  1HMU A;  1L7K A;  3PYB A;  3M7E A;  1N7R A;  4GTV B;  2FUZ A;  3PMM A;  4D4A A;  4OK4 A;  1N9A B;  1G9G A;  4FXK B;  4KTR A;  3HXB B;  1FPP B;  2V3N A;  4CE7 A;  4CJ0 A;  1L1Y A;  1JZ4 A;  3QXQ A;  4ONT A;  4BZE A;  4ZH5 A;  1JCR B;  2ZBL A;  1GSZ A;  2XHN A;  1NXC A;  2A73 B;  2V3P A;  3H2W A;  1HM3 A;  3SDQ A;  1DP0 A;  1HMW A;  4DUW A;  2XWB B;  3KSQ B;  1GAI A;  1W3Y A;  4RNL A;  5E1Q A;  4NEI A;  2Z07 A;  4BZH A;  3W7U A;  2F6D A;  3HXE B;  2FV0 A;  1S63 B;  4V1S A;  1LOH A;  1JYW A;  2WYN A;  4M76 A;  1H35 A;  3OXU A;  3WVF A;  3EUV B;  3E1F 1;  3T0B A;  1CEM A;  3IMH A;  3BS6 A;  4TTG A;  3D5R A;  4EHM B;  3M7C A;  2WZS A;  4YDO B;  3T2Q A;  4BZG A;  1PX4 A;  1LUR A;  3S9V A;  1J0N A;  1RWH A;  1J0M A;  3ON6 A;  1H54 A;  1V7W A;  3DYP A;  1LTX B;  2RI9 A;  5KKB A;  1H13 A;  1R76 A;  1KFG A;  3Q7F B;  2JKA A;  2WCO A;  2DRQ A;  1F4H A;  4WU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...