1LF9A

Crystal structure of bacterial glucoamylase complexed with acarbose
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
674
structure length
674
Chain Sequence
b'SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
total genus 246
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf9A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf9A01
1L1YA 4WU0A 5MEHA 1F9GA 3ANJA 1G87A 1X9DA 2HTAA 1NSSA 1V7VA 3IAQA 3QRYA 3WKIA 1CB8A 2WDAA 1SNZA 3WKGA 2P0VA 1JS4A 3VDAA 1V5DA 1V7XA 3D3IA 3GT5A 3BGAA 1JYVA 2WW0A 1Z45A 1L7KA 1JOVA 1F9OA 2Q1FA 5E2JA 1FP3A 4TXTA 1L7JA 1JZ2A 3QFZA 1LF6A 1NS7A 1PX3A 1NSZA 5M7YA 2JG0A 3GLYA 3QWTA 1N7OA 3ANKA 1J0NA 1TF4A 1OJMA 1XWQA 2WVYA 3W7WA 1RWCA 2GZ6A 3OS7A 4TF4A 1XW2A 2FUZA 3T09A 3VD5A 4AQ0A 3QFYA 4CJ1A 2BRPA 3W5NA 1HCUA 3S4CA 3A3VA 1LOHA 4ZH5A 1XWTA 3WIRA 3Q1NA 1LURA 1KWFA 1X1IA 2YIKA 3WKHA 4DUVA 1F1SA 2WZSA 1GLMA 1NXCA 1NKGA 4XUVA 2F6DA 1GAIA 5A1AA 1IA6A 2ZQ0A 1HMWA 1JZ7A 3PMMA 3VD9A 2ZZRA 3ACSA 1V5CA 5E1QA 3VW5A 1N7QA 2JKEA 1C82A 1K1WA 2EACA 1RWGA 1RWHA 1NS2A 1FBOA 4Z4JA 2WW1A 1W3YA 3W7SA 1KRFA 4BZGA 3QXFA 1YQ2A 2B4FA 4AYOA 3K11A 1JZ8A 2JJBA 3RX7A 1KKTA 1JZ4A 2AFAA 3NJVA 2D5JA 2FBAA 1F4HA 3EQAA 3WFAA 3P2CA 2NVPA 1OJNA 1KFGA 2JKAA 2WW2A 3T0BA 1KSDA 2CISA 4BZEA 3OB8A 1N7NA 4FUSA 1X1HA 1K1YA 3VDCA 4TTGA 3DYOA 5GW7A 3VXDA 3W7UA 3WC3A 3I3EA 3WUXA 2AHFA 1RWFA 2ZBLA 1G9GA 2VN7A 1NSUA 2ZXQA 3E1F1 3RSYA 3CZJA 1WU5A 2RI8A 2XFGA 2A8ZA 5M7IA 1K1XA 1FO2A 3DECA 5KKBA 1GA2A 1KS8A 3MUY1 1WU4A 3S4DA 1NS8A 4Q88A 1H54A 1X1JA 3WIQA 3ECQA 1MMZA 5GY3A 3T0AA 4L0GA 3RRSA 3E73A 3VD4A 3QT9A 1LXKA 1JYWA 2QNOA 4Q2BA 1OJPA 2FV1A 4CJ0A 2WVZA 2XHNA 1RW9A 2AHGA 1V7WA 1H13A 1EGUA 1HN1A 3QDEA 5CA3A 3ACTA 2DROA 1HM3A 3ON6A 3AFJA 2D8LA 3T0DA 3S4AA 1FAEA 2DRSA 3MUZ1 1AYXA 3W7TA 3T2QA 1RWAA 3RENA 3NJXA 4Z4LA 3H7LA 3QXQA 4L6XA 1IA7A 1DP0A 3IAPA 4AYRA 4BZFA 3T2PA 1JYNA 1HMUA 2CQTA 1FO3A 1WZZA 1PX4A 1FCEA 3K25A 2BRWA 1JYXA 1VD5A 2JF4A 1JZ6A 1UT9A 2WCOA 3VD3A 3TF4A 1MMUA 1NS0A 1LF9A 3E6UA 5DGQA 3DYMA 2FV0A 3QT3A 1F9DA 1TXKA 2WW3A 3CIHA 2RI9A 2E22A 3RX5A 2RGKA 3J7HA 4KTRA 1HN0A 2EADA 3I3DA 1DL2A 2XSGA 4WVBA 1NS4A 3H2WA 3MWXA 1MN0A 2VN4A 4ZG8A 3T2OA 3QSPA 1DOGA 2WYNA 1HM2A 4DUWA 1MMYA 5CD2A 3QPFA 3VDBA 3T08A 1OJOA 4J5TA 2EAEA 1RQ5A 1K72A 3QG0A 1N7PA 4BZHA 2DRQA 2CQSA 3S4BA 3WIWA 1NC5A 3GZKA 3WKFA 1JZ3A 1YGAA 1J0MA 1CLCA 1GAHA 3DCDA 1H12A 1N7RA 4AYPA 3OBAA 1NSXA 3W5MA 1FMIA 4AYQA 3A24A 2Z07A 2X03A 1KSCA 1NSMA 1L2AA 1NSRA 1SO0A 4DUXA 1G6IA 1F4AA 4JJJA 3X17A 2OKXA 5DGRA 4WVCA 2E24A 4DODA 1CEMA 1JZ5A 1FBWA 1LXMA 1MMXA 3DYPA 3I3BA 2WVXB 1AGMA 2JKPA 3VD7A 4WVAA 3H3KA 4RNLA 3SEPA 1H14A 3NREA 4DOEA 2CIRA 4KTPA 2EABA 4EL8A 5CZLA 2CIQA 3W7XA 3EZ8A 3RX8A 2GH4A 1NSVA 1I8QA 1ULVA 4CE7A 1UG9A 1KREA 2D73A 1G9JA 3IMHA 2DRRA 3ANIA 2BRVX 1IS9A 3MV11 3MV01 1WU6A 2HTBA 3T33A 2WVXA
chains in the Genus database with same CATH superfamily
1LVNA 1L1YA 3PZ2B 2V3NA 1DYUA 4EV2A 4WU0A 5MEHA 1F9GA 3ANJA 1G87A 1X9DA 3SQCA 3AFLA 5EATA 1NSSA 1V7VA 2HTAA 3IAQA 1OACA 3QRYA 1CB8A 4LNBB 3WKIA 1HTYA 3SXXA 2WDAA 2XWBB 1HZFA 3D50A 1SNZA 1N23A 3S9VA 3WKGA 2P0VA 1JS4A 3VDAA 1V5DA 3SDUA 1V7XA 2B39A 3D3IA 4YCRA 2C11A 2OOVC 3GT5A 1QBQB 1WMNA 1HXGA 3BGAA 1JYVA 2WW0A 1Z45A 5AGDA 1L7KA 1JOVA 1F9OA 3E34B 2Q1FA 3KQ4A 1FP3A 5E2JA 4TXTA 1L7JA 1JZ2A 3BUQA 1D6YA 3DX0A 3M02A 3DX3A 3QFZA 1LF6A 1NS7A 1PX3A 2ZL8A 1N21A 1NSZA 1GXOA 5M7YA 5FOBB 1TQVA 3ALAA 2JG0A 3GLYA 1O1SB 4V1RA 1N7OA 3QWTA 3D51A 2G0DA 3ANKA 3SDRA 1J0NA 3EU5B 4RNQA 1OJMA 1TF4A 5DHKA 1XWQA 5IL3A 2WVYA 1RWCA 3W7WA 2BBCA 2GZ6A 3BVXA 5ILJA 3NFVA 3OS7A 4TF4A 1XW2A 1O6QA 2FUZA 5ILYA 2F18A 3T09A 3VD5A 4AQ0A 3QFYA 4CJ1A 2BRPA 3HXFB 3W5NA 4K3AA 4FNVA 3LOYA 1HCUA 1N94B 2CFGA 1O6RA 3HI7A 1EKMA 3S4CA 3A3VA 1SPUA 3E32B 1LOHA 2GOXA 3BLCA 4ZH5A 1XWTA 2WY8A 5GZKA 1TQTA 3WIRA 3DX4A 3Q1NA 1SQCA 4FNUA 4LNGB 3HXCB 4FNTA 4GTPB 4GTMB 4ZH1A 1LURA 2CFDA 1KWFA 2CWUA 1N1ZA 3KSLB 1TQSA 1X1IA 2XN1A 1FT1B 1N20A 2WY7A 2YIKA 3WKHA 4DUVA 1F1SA 2WZSA 3BS6A 3E37B 4D94A 1GLMA 1NXCA 3M7LA 1NKGA 1N9EA 1TQUA 3HXDB 4XUVA 3DX2A 1SIIA 2F6DA 1GAIA 3A0OA 3BUBA 3D5RA 5A1AA 1IA6A 2ZQ0A 1HMWA 2E2VA 1JZ7A 3N0FA 4K35A 2PMVA 3X40A 4D4DA 1QALA 2H6FB 3PMMA 1AV4A 2ZZRA 1O1TB 1V5CA 3ACSA 1UI7A 4OK4A 2YFNA 5E1QA 1RJOA 2R2LB 3EUVB 2E2TA 3VW5A 1JCSB 5JPMB 1N7QA 2CG0A 4LIXA 5ILKA 2JKEA 2WOHA 1W2ZA 4MMHA 1HXAA 3N0GA 1C82A 1K1WA 2EACA 1GXNA 1RWGA 1RWHA 1NS2A 5JPNB 4GAXA 3SDVA 1FBOA 4Z4JA 2WW1A 2NOJA 1SA4B 1W3YA 3W7SA 1HWWA 3P5PA 1PU4A 3Q7AB 2CFWA 2FUTA 3CU7A 1KRFA 3G4DA 4BTXA 2ZIRB 4BZGA 3QXFA 1YQ2A 2B4FA 4AYOA 3K11A 4FNPA 1R76A 2JJBA 3PYAA 2BT3A 1JZ8A 3RX7A 2CG1A 1KKTA 4UFCA 1JZ4A 2WYIA 2AFAA 3NJVA 2D5JA 2FBAA 1F4HA 3X41A 1IVUA 3E33B 3EQAA 4F13A 3M00A 3WFAA 3DRAB 3M77A 3P2CA 4MMIA 4ONTA 1JRQA 2NVPA 1C3DA 1OJNA 1KFGA 2JKAA 3DX1A 4FJQA 2V8KA 5IKHA 2WW2A 3T0BA 1KSDA 2CISA 4BZEA 5ILDA 3X3YA 1H36A 1R34A 1D8EB 5IL8A 3SFYB 3OB8A 1N7NA 4FUSA 1TU5A 3DSUB 1X1HA 4L9PB 1K1YA 3VDCA 4TTGA 3DYOA 5GW7A 2OOVA 2OW6A 3VXDA 3W7UA 3WC3A 3I3EA 1HV6A 3WUXA 2XN2A 1GSZA 1N4PB 2AHFA 1RWFA 3K7XA 2ONHA 2ZBLA 1G9GA 3BUDA 2VN7A 1NSUA 2ZXQA 3E1F1 3RSYA 4OZWA 3CZJA 1WU5A 3Q7FB 2F7RA 4FNQA 3HXEB 1NL4B 3T0UA 2RI8A 2XFGA 4GL3A 4BTYA 2A8ZA 5M7IA 1KZOB 1K1XA 3M74A 2ALWA 1FO2A 4BOKA 3BLBA 3DECA 5KKBA 1GA2A 1R33A 3G6JB 3EU8A 5IK9A 2CFKA 1KS8A 3M71A 1WU4A 3MUY1 3S4DA 2A73B 1NS8A 4EV5A 4OZVA 3SFXB 1W4NA 3D5SA 1N4SB 4Q88A 2OQEC 4OJZA 1QX1A 2E2UA 1W5ZA 3BVWA 1O7DD 2F7PA 2Y74A 3E30B 4MU9A 1H54A 1X1JA 1D6ZA 3SAEA 3PZ3B 3KLSA 3M76A 4GTTB 2V3PA 1FT2B 3WIQA 1MMZA 5GY3A 1QWNA 1W6CA 3ECQA 3T0AA 1W6JA 4L0GA 5DHIA 3RRSA 5JMFA 3E73A 3VD4A 3QT9A 1LXKA 3VSMA 1NI1B 2BB6A 1JYWA 2QNOA 3HXBB 2WGQA 3PZ1B 2IEJB 1OJPA 4Q2BA 2FV1A 4CJ0A 3D52A 1IU7A 2WVZA 1HXCA 2XHNA 1TNZB 1JCRB 1RW9A 2AHGA 2V8IA 3M72A 5EASA 1V7WA 1H13A 2C10A 1EGUA 2FYVA 4DI5A 3PYBA 1HN1A 1H3AA 3QDEA 1QAFA 5CA3A 1W7CA 1TQWA 2D1WA 3E7JA 3ACTA 1KSIA 3M7CA 2DROA 3M7BA 1HM3A 1TNYB 1H35A 2F0YB 3C72B 1QAKA 1PS3A 3ON6A 2F7QA 3AFJA 2D8LA 3T0DA 3BVUA 2F1BA 2H6IB 3S4AA 3NBJA 1FAEA 3SDTA 4OK2A 2DRSA 1IQXA 4QT9A 3MUZ1 1AYXA 1QAZA 2SQCA 3Q75B 4D4CA 3W7TA 4M76A 3DSWB 1WMPA 3Q73B 3T2QA 1RWAA 3LZ9A 3RENA 3AMOA 1US1A 4FNRA 3NJXA 1QQFA 1IVVA 3LVTA 1AVKA 1TNUB 4Z4LA 3HIGA 3H7LA 1N1BA 3QXQA 3EJUA 3NBBA 3D4YA 4L6XA 1LTXB 5ILZA 1IA7A 1DP0A 3IAPA 4AYRA 2CWVA 4FNSA 4BZFA 4F10A 2WYHA 3T2PA 1JYNA 1A2VA 1HMUA 1IVXA 2PNCA 2CQTA 3DDFA 1FO3A 1WZZA 3G4FA 3M75A 1WMOA 4BTWA 4YDOB 4KFFA 3N9HA 1PX4A 1FCEA 3DSSB 3K25A 4V1SA 2BRWA 1S64B 1O1RB 1JYXA 1VD5A 2JF4A 3D4ZA 3WA2X 2YFOA 1JZ6A 1UMPA 1UT9A 3X42A 2WCOA 1N4RB 3DSVB 3TF4A 1MMUA 5FO9B 1NS0A 3EJSA 1LF9A 1LD7B 3VD3A 1GXMA 3E6UA 4LNVA 4GTRB 5DGQA 2FV0A 2RDYA 3QT3A 3DYMA 3DSXB 1F9DA 2ONGA 1GHQA 3BUIA 3KN4A 5ILIA 1TXKA 2WW3A 3EJPA 1SIHA 3CIHA 3MI6A 5IK6A 2RI9A 2E22A 1JCQB 3RX5A 3BVVA 5FO7B 1IVWA 2RGKA 3J7HA 3P5RA 3CZNA 3TY1A 4BOJA 2Y73A 4FXKB 5FO8B 2G02A 4EHMB 4KTRA 2BB5A 2F7OA 3VD9A 1QWUA 3OXUA 2OW7A 1H3CA 2V8JA 1HN0A 2EADA 4GTSB 1QSJA 4D4BA 1O5MB 3I3DA 5C05A 4KFEA 5KBPA 1DL2A 2XSGA 4WVBA 1NS4A 3H2WA 3MWXA 1N9AB 1MN0A 2YX9A 3M78A 2VN4A 1W6KA 4ZG8A 3QSPA 3T2OA 1DOGA 1HM2A 2WYNA 3BVTA 4DUWA 1MMYA 4KKIA 2BEDB 5CD2A 3QPFA 1SA5B 1UI8A 3OEDA 3HIIA 3X3XA 3VDBA 3T08A 1OJOA 4KKJA 4J5TA 1X81B 2EAEA 1RQ5A 1H3BA 1TNBB 1K72A 5IKAA 3QG0A 1N7PA 1HX9A 4BZHA 4KFDA 1LD8B 1MZCB 4GTQB 2DRQA 3DDGA 1H37A 1D6UA 2CQSA 2ZISB 3S4BA 2OQEA 3WIWA 1NC5A 3GZKA 3WKFA 1RKYA 5IK0A 1JZ3A 1YGAA 4ZRPA 4FXGB 1J0MA 4GTOB 5ILHA 2H6GB 1CLCA 1GAHA 3AMOB 3KSQB 3DCDA 1H12A 1N7RA 4D4AA 4AYPA 3OBAA 1NSXA 1TNOB 1N22A 2WINB 2WIIB 3W5MA 3EJQA 2H6HB 1FMIA 3VSNA 4AYQA 3A24A 3NNBA 1S63B 2Z07A 5JMDA 2X03A 1W6GA 2WO0A 1KSCA 1NSMA 1L2AA 1NSRA 4C1SA 1N4QB 1SO0A 4DUXA 1G6IA 4MBGB 3M7EA 1IQYA 1F4AA 3EJRA 3M73A 4GTVB 1HXKA 3Q79B 4JJJA 3X17A 2OKXA 5DGRA 4WVCA 1DCEB 2E24A 2XN0A 1O79A 4DODA 3CV5A 1CEMA 1JZ5A 1FBWA 4NEIA 4ZRQA 1LXMA 3WA3A 1MMXA 5IM1A 3Q78B 4YDEB 2WOFA 3CZSA 2WVXB 1AGMA 3DYPA 2JKPA 3I3BA 3KIIA 3VD7A 4WVAA 3H3KA 4RNLA 3SEPA 1H14A 3NREA 2XQWA 1N95B 4DOEA 3SDQA 4E1YA 2CIRA 1N24A 2J5CA 3PZ4B 3RJ3A 4KTPA 2EABA 3DSTB 3M01A 5CZLA 4EL8A 1D8DB 2CIQA 3K5TA 3PGBA 3WVFA 3W7XA 1TN8B 3EZ8A 3RX8A 2GH4A 1NSVA 1I8QA 3BUPA 1ULVA 1H39A 1AVLA 4CE7A 1UG9A 1KREA 2D73A 1FPPB 1KZPB 1G9JA 2CFLA 3EJTA 3DPYB 2PN5A 3IMHA 2DRRA 3ANIA 3E80A 2BRVX 1IS9A 1TN7B 3X3ZA 3MV11 2W0QA 3MV01 2CWTA 5EAUA 1WU6A 2F1AA 2HTBA 3T33A 3MPHA 2XWJB 1TN6B 2FUQA 2WVXA 1O6HA 2I07B 3SX1A
chains in the Genus database with same CATH topology
1L1YA 3PZ2B 2V3NA 4WU0A 5MEHA 1F9GA 3ANJA 1G87A 1X9DA 3SQCA 2HTAA 1NSSA 3AFLA 1V7VA 3IAQA 3QRYA 3WKIA 4LNBB 1CB8A 2WDAA 2XWBB 1HZFA 1SNZA 3S9VA 3WKGA 2P0VA 1JS4A 3VDAA 1V5DA 3SDUA 1V7XA 2B39A 3D3IA 4YCRA 3GT5A 1QBQB 3BGAA 1JYVA 2WW0A 1Z45A 5AGDA 1L7KA 1JOVA 1F9OA 3E34B 3KQ4A 5E2JA 1FP3A 2Q1FA 4TXTA 1L7JA 1JZ2A 3QFZA 1LF6A 1NS7A 1PX3A 1NSZA 1GXOA 5M7YA 5FOBB 2JG0A 3GLYA 1O1SB 4V1RA 3QWTA 1N7OA 2G0DA 3ANKA 3SDRA 3EU5B 1J0NA 1TF4A 1OJMA 1XWQA 2WVYA 3W7WA 1RWCA 2BBCA 2GZ6A 3OS7A 4TF4A 1XW2A 1O6QA 2FUZA 3T09A 3VD5A 4AQ0A 3QFYA 4CJ1A 2BRPA 3HXFB 3W5NA 4FNVA 1HCUA 1N94B 1O6RA 3S4CA 3A3VA 3E32B 1LOHA 2GOXA 3BLCA 4ZH5A 1XWTA 2WY8A 5GZKA 3WIRA 3Q1NA 1SQCA 4LNGB 3HXCB 4GTPB 4GTMB 4ZH1A 1LURA 1KWFA 3KSLB 1X1IA 1FT1B 2YIKA 2WY7A 3WKHA 4DUVA 1F1SA 2WZSA 3BS6A 3E37B 4D94A 1GLMA 1NXCA 3M7LA 1NKGA 3HXDB 4XUVA 2F6DA 1GAIA 3A0OA 3D5RA 5A1AA 1IA6A 2ZQ0A 1HMWA 1JZ7A 2PMVA 4D4DA 2H6FB 3PMMA 3VD9A 2ZZRA 1O1TB 1V5CA 3ACSA 4OK4A 5E1QA 2R2LB 3EUVB 3VW5A 1JCSB 5JPMB 1N7QA 4LIXA 2JKEA 4MMHA 1C82A 1K1WA 2EACA 1GXNA 1RWGA 1RWHA 1NS2A 5JPNB 3SDVA 1FBOA 4Z4JA 2WW1A 2NOJA 1SA4B 1W3YA 3W7SA 3P5PA 3Q7AB 3CU7A 2FUTA 1KRFA 2ZIRB 4BZGA 3QXFA 1YQ2A 2B4FA 4AYOA 3K11A 1JZ8A 1R76A 2JJBA 3PYAA 3RX7A 1KKTA 1JZ4A 2AFAA 3NJVA 2D5JA 2FBAA 1F4HA 3E33B 3EQAA 3WFAA 3DRAB 3M77A 3P2CA 4MMIA 4ONTA 2NVPA 1C3DA 1OJNA 1KFGA 2JKAA 2V8KA 2WW2A 3T0BA 1KSDA 2CISA 4BZEA 1H36A 1D8EB 3SFYB 3OB8A 1N7NA 4FUSA 3DSUB 1X1HA 4L9PB 1K1YA 3VDCA 4TTGA 3DYOA 5GW7A 3VXDA 3W7UA 3WC3A 3I3EA 3WUXA 1GSZA 1N4PB 2AHFA 1RWFA 3K7XA 2ZBLA 1G9GA 2VN7A 1NSUA 2ZXQA 3E1F1 3RSYA 3CZJA 1WU5A 3Q7FB 3HXEB 1NL4B 2RI8A 2XFGA 4GL3A 2A8ZA 5M7IA 1KZOB 1K1XA 3M74A 1FO2A 4BOKA 3DECA 5KKBA 1GA2A 3G6JB 3EU8A 1KS8A 3M71A 1WU4A 3MUY1 3S4DA 2A73B 1NS8A 3SFXB 3D5SA 1N4SB 4Q88A 4OJZA 3E30B 4MU9A 1H54A 1X1JA 3SAEA 3PZ3B 4GTTB 3M76A 3KLSA 2V3PA 1FT2B 3WIQA 1MMZA 5GY3A 3ECQA 3T0AA 1W6JA 4L0GA 3RRSA 5JMFA 3E73A 3VD4A 3QT9A 1LXKA 3VSMA 1NI1B 2BB6A 1JYWA 2QNOA 3HXBB 3PZ1B 2IEJB 4Q2BA 1OJPA 2FV1A 4CJ0A 2WVZA 2XHNA 1TNZB 1JCRB 2V8IA 2AHGA 1RW9A 3M72A 1V7WA 1H13A 1EGUA 3PYBA 1HN1A 1H3AA 3QDEA 5CA3A 3E7JA 3ACTA 3M7CA 2DROA 3M7BA 1HM3A 1TNYB 1H35A 2F0YB 3C72B 3ON6A 3AFJA 2D8LA 3T0DA 2H6IB 3S4AA 1FAEA 3SDTA 4OK2A 2DRSA 4QT9A 3MUZ1 1AYXA 2SQCA 4D4CA 3Q75B 3W7TA 4M76A 3DSWB 3Q73B 3T2QA 1RWAA 3RENA 3NJXA 1QQFA 1TNUB 4Z4LA 3H7LA 3QXQA 4L6XA 1LTXB 1IA7A 1DP0A 3IAPA 4AYRA 4BZFA 3T2PA 1JYNA 1HMUA 2CQTA 1FO3A 1WZZA 3M75A 4YDOB 1PX4A 1FCEA 3DSSB 3K25A 4V1SA 2BRWA 1S64B 1O1RB 1JYXA 1VD5A 2JF4A 1JZ6A 1UMPA 1UT9A 2WCOA 1N4RB 3DSVB 3TF4A 1MMUA 5FO9B 1NS0A 3VD3A 1LF9A 1LD7B 1GXMA 3E6UA 4LNVA 4GTRB 5DGQA 2FV0A 3DYMA 3QT3A 3DSXB 1F9DA 1GHQA 1TXKA 2WW3A 3CIHA 2RI9A 2E22A 1JCQB 3RX5A 5FO7B 2RGKA 3J7HA 3P5RA 3TY1A 4BOJA 4FXKB 5FO8B 2G02A 4EHMB 4KTRA 2BB5A 3OXUA 1H3CA 2V8JA 1HN0A 2EADA 4GTSB 1QSJA 4D4BA 1O5MB 3I3DA 1DL2A 2XSGA 4WVBA 1NS4A 3H2WA 3MWXA 1N9AB 1MN0A 3M78A 2VN4A 1W6KA 4ZG8A 3QSPA 3T2OA 1DOGA 2WYNA 1HM2A 4DUWA 1MMYA 4KKIA 2BEDB 5CD2A 3QPFA 1SA5B 3OEDA 3VDBA 3T08A 4KKJA 1OJOA 4J5TA 1X81B 2EAEA 1RQ5A 1H3BA 1TNBB 1K72A 3QG0A 1N7PA 4BZHA 1LD8B 1MZCB 4GTQB 2DRQA 1H37A 2CQSA 2ZISB 3S4BA 3WIWA 1NC5A 3GZKA 3WKFA 1JZ3A 1YGAA 4ZRPA 4FXGB 4GTOB 1J0MA 2H6GB 1CLCA 1GAHA 3KSQB 3DCDA 1H12A 4D4AA 1N7RA 4AYPA 3OBAA 1NSXA 1TNOB 2WINB 2WIIB 3W5MA 2H6HB 1FMIA 3VSNA 4AYQA 3A24A 1S63B 2Z07A 5JMDA 2X03A 1KSCA 1NSMA 1L2AA 1NSRA 4C1SA 1N4QB 1SO0A 4DUXA 1G6IA 4MBGB 3M7EA 1F4AA 3M73A 4GTVB 3Q79B 4JJJA 3X17A 2OKXA 5DGRA 4WVCA 1DCEB 2E24A 1O79A 4DODA 1CEMA 1JZ5A 1FBWA 4ZRQA 4NEIA 1LXMA 1MMXA 3Q78B 4YDEB 3DYPA 3I3BA 2WVXB 1AGMA 2JKPA 3VD7A 4WVAA 3H3KA 4RNLA 3SEPA 1H14A 3NREA 2XQWA 1N95B 4DOEA 3SDQA 2CIRA 3PZ4B 3RJ3A 4KTPA 2EABA 3DSTB 5CZLA 4EL8A 1D8DB 2CIQA 3WVFA 3W7XA 1TN8B 3EZ8A 3RX8A 2GH4A 1NSVA 1I8QA 1ULVA 1H39A 4CE7A 1UG9A 1KREA 2D73A 1FPPB 1KZPB 1G9JA 3DPYB 2PN5A 3IMHA 2DRRA 3ANIA 3E80A 2BRVX 1IS9A 1TN7B 3MV11 3MV01 1WU6A 2HTBA 3T33A 2XWJB 1TN6B 2FUQA 2WVXA 1O6HA 2I07B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1Y A;  4WU0 A;  5MEH A;  1F9G A;  3ANJ A;  1G87 A;  1X9D A;  2HTA A;  1NSS A;  1V7V A;  3IAQ A;  3QRY A;  3WKI A;  1CB8 A;  2WDA A;  1SNZ A;  3WKG A;  2P0V A;  1JS4 A;  3VDA A;  1V5D A;  1V7X A;  3D3I A;  3GT5 A;  3BGA A;  1JYV A;  2WW0 A;  1Z45 A;  1L7K A;  1JOV A;  1F9O A;  2Q1F A;  5E2J A;  1FP3 A;  4TXT A;  1L7J A;  1JZ2 A;  3QFZ A;  1LF6 A;  1NS7 A;  1PX3 A;  1NSZ A;  5M7Y A;  2JG0 A;  3GLY A;  3QWT A;  1N7O A;  3ANK A;  1J0N A;  1TF4 A;  1OJM A;  1XWQ A;  2WVY A;  3W7W A;  1RWC A;  2GZ6 A;  3OS7 A;  4TF4 A;  1XW2 A;  2FUZ A;  3T09 A;  3VD5 A;  4AQ0 A;  3QFY A;  4CJ1 A;  2BRP A;  3W5N A;  1HCU A;  3S4C A;  3A3V A;  1LOH A;  4ZH5 A;  1XWT A;  3WIR A;  3Q1N A;  1LUR A;  1KWF A;  1X1I A;  2YIK A;  3WKH A;  4DUV A;  1F1S A;  2WZS A;  1GLM A;  1NXC A;  1NKG A;  4XUV A;  2F6D A;  1GAI A;  5A1A A;  1IA6 A;  2ZQ0 A;  1HMW A;  1JZ7 A;  3PMM A;  3VD9 A;  2ZZR A;  3ACS A;  1V5C A;  5E1Q A;  3VW5 A;  1N7Q A;  2JKE A;  1C82 A;  1K1W A;  2EAC A;  1RWG A;  1RWH A;  1NS2 A;  1FBO A;  4Z4J A;  2WW1 A;  1W3Y A;  3W7S A;  1KRF A;  4BZG A;  3QXF A;  1YQ2 A;  2B4F A;  4AYO A;  3K11 A;  1JZ8 A;  2JJB A;  3RX7 A;  1KKT A;  1JZ4 A;  2AFA A;  3NJV A;  2D5J A;  2FBA A;  1F4H A;  3EQA A;  3WFA A;  3P2C A;  2NVP A;  1OJN A;  1KFG A;  2JKA A;  2WW2 A;  3T0B A;  1KSD A;  2CIS A;  4BZE A;  3OB8 A;  1N7N A;  4FUS A;  1X1H A;  1K1Y A;  3VDC A;  4TTG A;  3DYO A;  5GW7 A;  3VXD A;  3W7U A;  3WC3 A;  3I3E A;  3WUX A;  2AHF A;  1RWF A;  2ZBL A;  1G9G A;  2VN7 A;  1NSU A;  2ZXQ A;  3E1F 1;  3RSY A;  3CZJ A;  1WU5 A;  2RI8 A;  2XFG A;  2A8Z A;  5M7I A;  1K1X A;  1FO2 A;  3DEC A;  5KKB A;  1GA2 A;  1KS8 A;  3MUY 1;  1WU4 A;  3S4D A;  1NS8 A;  4Q88 A;  1H54 A;  1X1J A;  3WIQ A;  3ECQ A;  1MMZ A;  5GY3 A;  3T0A A;  4L0G A;  3RRS A;  3E73 A;  3VD4 A;  3QT9 A;  1LXK A;  1JYW A;  2QNO A;  4Q2B A;  1OJP A;  2FV1 A;  4CJ0 A;  2WVZ A;  2XHN A;  1RW9 A;  2AHG A;  1V7W A;  1H13 A;  1EGU A;  1HN1 A;  3QDE A;  5CA3 A;  3ACT A;  2DRO A;  1HM3 A;  3ON6 A;  3AFJ A;  2D8L A;  3T0D A;  3S4A A;  1FAE A;  2DRS A;  3MUZ 1;  1AYX A;  3W7T A;  3T2Q A;  1RWA A;  3REN A;  3NJX A;  4Z4L A;  3H7L A;  3QXQ A;  4L6X A;  1IA7 A;  1DP0 A;  3IAP A;  4AYR A;  4BZF A;  3T2P A;  1JYN A;  1HMU A;  2CQT A;  1FO3 A;  1WZZ A;  1PX4 A;  1FCE A;  3K25 A;  2BRW A;  1JYX A;  1VD5 A;  2JF4 A;  1JZ6 A;  1UT9 A;  2WCO A;  3VD3 A;  3TF4 A;  1MMU A;  1NS0 A;  1LF9 A;  3E6U A;  5DGQ A;  3DYM A;  2FV0 A;  3QT3 A;  1F9D A;  1TXK A;  2WW3 A;  3CIH A;  2RI9 A;  2E22 A;  3RX5 A;  2RGK A;  3J7H A;  4KTR A;  1HN0 A;  2EAD A;  3I3D A;  1DL2 A;  2XSG A;  4WVB A;  1NS4 A;  3H2W A;  3MWX A;  1MN0 A;  2VN4 A;  4ZG8 A;  3T2O A;  3QSP A;  1DOG A;  2WYN A;  1HM2 A;  4DUW A;  1MMY A;  5CD2 A;  3QPF A;  3VDB A;  3T08 A;  1OJO A;  4J5T A;  2EAE A;  1RQ5 A;  1K72 A;  3QG0 A;  1N7P A;  4BZH A;  2DRQ A;  2CQS A;  3S4B A;  3WIW A;  1NC5 A;  3GZK A;  3WKF A;  1JZ3 A;  1YGA A;  1J0M A;  1CLC A;  1GAH A;  3DCD A;  1H12 A;  1N7R A;  4AYP A;  3OBA A;  1NSX A;  3W5M A;  1FMI A;  4AYQ A;  3A24 A;  2Z07 A;  2X03 A;  1KSC A;  1NSM A;  1L2A A;  1NSR A;  1SO0 A;  4DUX A;  1G6I A;  1F4A A;  4JJJ A;  3X17 A;  2OKX A;  5DGR A;  4WVC A;  2E24 A;  4DOD A;  1CEM A;  1JZ5 A;  1FBW A;  1LXM A;  1MMX A;  3DYP A;  3I3B A;  2WVX B;  1AGM A;  2JKP A;  3VD7 A;  4WVA A;  3H3K A;  4RNL A;  3SEP A;  1H14 A;  3NRE A;  4DOE A;  2CIR A;  4KTP A;  2EAB A;  4EL8 A;  5CZL A;  2CIQ A;  3W7X A;  3EZ8 A;  3RX8 A;  2GH4 A;  1NSV A;  1I8Q A;  1ULV A;  4CE7 A;  1UG9 A;  1KRE A;  2D73 A;  1G9J A;  3IMH A;  2DRR A;  3ANI A;  2BRV X;  1IS9 A;  3MV1 1;  3MV0 1;  1WU6 A;  2HTB A;  3T33 A;  2WVX A; 
#chains in the Genus database with same CATH topology
 1LVN A;  1L1Y A;  3PZ2 B;  2V3N A;  1DYU A;  4EV2 A;  4WU0 A;  5MEH A;  1F9G A;  3ANJ A;  1G87 A;  1X9D A;  3SQC A;  3AFL A;  5EAT A;  1NSS A;  1V7V A;  2HTA A;  3IAQ A;  1OAC A;  3QRY A;  1CB8 A;  4LNB B;  3WKI A;  1HTY A;  3SXX A;  2WDA A;  2XWB B;  1HZF A;  3D50 A;  1SNZ A;  1N23 A;  3S9V A;  3WKG A;  2P0V A;  1JS4 A;  3VDA A;  1V5D A;  3SDU A;  1V7X A;  2B39 A;  3D3I A;  4YCR A;  2C11 A;  2OOV C;  3GT5 A;  1QBQ B;  1WMN A;  1HXG A;  3BGA A;  1JYV A;  2WW0 A;  1Z45 A;  5AGD A;  1L7K A;  1JOV A;  1F9O A;  3E34 B;  2Q1F A;  3KQ4 A;  1FP3 A;  5E2J A;  4TXT A;  1L7J A;  1JZ2 A;  3BUQ A;  1D6Y A;  3DX0 A;  3M02 A;  3DX3 A;  3QFZ A;  1LF6 A;  1NS7 A;  1PX3 A;  2ZL8 A;  1N21 A;  1NSZ A;  1GXO A;  5M7Y A;  5FOB B;  1TQV A;  3ALA A;  2JG0 A;  3GLY A;  1O1S B;  4V1R A;  1N7O A;  3QWT A;  3D51 A;  2G0D A;  3ANK A;  3SDR A;  1J0N A;  3EU5 B;  4RNQ A;  1OJM A;  1TF4 A;  5DHK A;  1XWQ A;  5IL3 A;  2WVY A;  1RWC A;  3W7W A;  2BBC A;  2GZ6 A;  3BVX A;  5ILJ A;  3NFV A;  3OS7 A;  4TF4 A;  1XW2 A;  1O6Q A;  2FUZ A;  5ILY A;  2F18 A;  3T09 A;  3VD5 A;  4AQ0 A;  3QFY A;  4CJ1 A;  2BRP A;  3HXF B;  3W5N A;  4K3A A;  4FNV A;  3LOY A;  1HCU A;  1N94 B;  2CFG A;  1O6R A;  3HI7 A;  1EKM A;  3S4C A;  3A3V A;  1SPU A;  3E32 B;  1LOH A;  2GOX A;  3BLC A;  4ZH5 A;  1XWT A;  2WY8 A;  5GZK A;  1TQT A;  3WIR A;  3DX4 A;  3Q1N A;  1SQC A;  4FNU A;  4LNG B;  3HXC B;  4FNT A;  4GTP B;  4GTM B;  4ZH1 A;  1LUR A;  2CFD A;  1KWF A;  2CWU A;  1N1Z A;  3KSL B;  1TQS A;  1X1I A;  2XN1 A;  1FT1 B;  1N20 A;  2WY7 A;  2YIK A;  3WKH A;  4DUV A;  1F1S A;  2WZS A;  3BS6 A;  3E37 B;  4D94 A;  1GLM A;  1NXC A;  3M7L A;  1NKG A;  1N9E A;  1TQU A;  3HXD B;  4XUV A;  3DX2 A;  1SII A;  2F6D A;  1GAI A;  3A0O A;  3BUB A;  3D5R A;  5A1A A;  1IA6 A;  2ZQ0 A;  1HMW A;  2E2V A;  1JZ7 A;  3N0F A;  4K35 A;  2PMV A;  3X40 A;  4D4D A;  1QAL A;  2H6F B;  3PMM A;  1AV4 A;  2ZZR A;  1O1T B;  1V5C A;  3ACS A;  1UI7 A;  4OK4 A;  2YFN A;  5E1Q A;  1RJO A;  2R2L B;  3EUV B;  2E2T A;  3VW5 A;  1JCS B;  5JPM B;  1N7Q A;  2CG0 A;  4LIX A;  5ILK A;  2JKE A;  2WOH A;  1W2Z A;  4MMH A;  1HXA A;  3N0G A;  1C82 A;  1K1W A;  2EAC A;  1GXN A;  1RWG A;  1RWH A;  1NS2 A;  5JPN B;  4GAX A;  3SDV A;  1FBO A;  4Z4J A;  2WW1 A;  2NOJ A;  1SA4 B;  1W3Y A;  3W7S A;  1HWW A;  3P5P A;  1PU4 A;  3Q7A B;  2CFW A;  2FUT A;  3CU7 A;  1KRF A;  3G4D A;  4BTX A;  2ZIR B;  4BZG A;  3QXF A;  1YQ2 A;  2B4F A;  4AYO A;  3K11 A;  4FNP A;  1R76 A;  2JJB A;  3PYA A;  2BT3 A;  1JZ8 A;  3RX7 A;  2CG1 A;  1KKT A;  4UFC A;  1JZ4 A;  2WYI A;  2AFA A;  3NJV A;  2D5J A;  2FBA A;  1F4H A;  3X41 A;  1IVU A;  3E33 B;  3EQA A;  4F13 A;  3M00 A;  3WFA A;  3DRA B;  3M77 A;  3P2C A;  4MMI A;  4ONT A;  1JRQ A;  2NVP A;  1C3D A;  1OJN A;  1KFG A;  2JKA A;  3DX1 A;  4FJQ A;  2V8K A;  5IKH A;  2WW2 A;  3T0B A;  1KSD A;  2CIS A;  4BZE A;  5ILD A;  3X3Y A;  1H36 A;  1R34 A;  1D8E B;  5IL8 A;  3SFY B;  3OB8 A;  1N7N A;  4FUS A;  1TU5 A;  3DSU B;  1X1H A;  4L9P B;  1K1Y A;  3VDC A;  4TTG A;  3DYO A;  5GW7 A;  2OOV A;  2OW6 A;  3VXD A;  3W7U A;  3WC3 A;  3I3E A;  1HV6 A;  3WUX A;  2XN2 A;  1GSZ A;  1N4P B;  2AHF A;  1RWF A;  3K7X A;  2ONH A;  2ZBL A;  1G9G A;  3BUD A;  2VN7 A;  1NSU A;  2ZXQ A;  3E1F 1;  3RSY A;  4OZW A;  3CZJ A;  1WU5 A;  3Q7F B;  2F7R A;  4FNQ A;  3HXE B;  1NL4 B;  3T0U A;  2RI8 A;  2XFG A;  4GL3 A;  4BTY A;  2A8Z A;  5M7I A;  1KZO B;  1K1X A;  3M74 A;  2ALW A;  1FO2 A;  4BOK A;  3BLB A;  3DEC A;  5KKB A;  1GA2 A;  1R33 A;  3G6J B;  3EU8 A;  5IK9 A;  2CFK A;  1KS8 A;  3M71 A;  1WU4 A;  3MUY 1;  3S4D A;  2A73 B;  1NS8 A;  4EV5 A;  4OZV A;  3SFX B;  1W4N A;  3D5S A;  1N4S B;  4Q88 A;  2OQE C;  4OJZ A;  1QX1 A;  2E2U A;  1W5Z A;  3BVW A;  1O7D D;  2F7P A;  2Y74 A;  3E30 B;  4MU9 A;  1H54 A;  1X1J A;  1D6Z A;  3SAE A;  3PZ3 B;  3KLS A;  3M76 A;  4GTT B;  2V3P A;  1FT2 B;  3WIQ A;  1MMZ A;  5GY3 A;  1QWN A;  1W6C A;  3ECQ A;  3T0A A;  1W6J A;  4L0G A;  5DHI A;  3RRS A;  5JMF A;  3E73 A;  3VD4 A;  3QT9 A;  1LXK A;  3VSM A;  1NI1 B;  2BB6 A;  1JYW A;  2QNO A;  3HXB B;  2WGQ A;  3PZ1 B;  2IEJ B;  1OJP A;  4Q2B A;  2FV1 A;  4CJ0 A;  3D52 A;  1IU7 A;  2WVZ A;  1HXC A;  2XHN A;  1TNZ B;  1JCR B;  1RW9 A;  2AHG A;  2V8I A;  3M72 A;  5EAS A;  1V7W A;  1H13 A;  2C10 A;  1EGU A;  2FYV A;  4DI5 A;  3PYB A;  1HN1 A;  1H3A A;  3QDE A;  1QAF A;  5CA3 A;  1W7C A;  1TQW A;  2D1W A;  3E7J A;  3ACT A;  1KSI A;  3M7C A;  2DRO A;  3M7B A;  1HM3 A;  1TNY B;  1H35 A;  2F0Y B;  3C72 B;  1QAK A;  1PS3 A;  3ON6 A;  2F7Q A;  3AFJ A;  2D8L A;  3T0D A;  3BVU A;  2F1B A;  2H6I B;  3S4A A;  3NBJ A;  1FAE A;  3SDT A;  4OK2 A;  2DRS A;  1IQX A;  4QT9 A;  3MUZ 1;  1AYX A;  1QAZ A;  2SQC A;  3Q75 B;  4D4C A;  3W7T A;  4M76 A;  3DSW B;  1WMP A;  3Q73 B;  3T2Q A;  1RWA A;  3LZ9 A;  3REN A;  3AMO A;  1US1 A;  4FNR A;  3NJX A;  1QQF A;  1IVV A;  3LVT A;  1AVK A;  1TNU B;  4Z4L A;  3HIG A;  3H7L A;  1N1B A;  3QXQ A;  3EJU A;  3NBB A;  3D4Y A;  4L6X A;  1LTX B;  5ILZ A;  1IA7 A;  1DP0 A;  3IAP A;  4AYR A;  2CWV A;  4FNS A;  4BZF A;  4F10 A;  2WYH A;  3T2P A;  1JYN A;  1A2V A;  1HMU A;  1IVX A;  2PNC A;  2CQT A;  3DDF A;  1FO3 A;  1WZZ A;  3G4F A;  3M75 A;  1WMO A;  4BTW A;  4YDO B;  4KFF A;  3N9H A;  1PX4 A;  1FCE A;  3DSS B;  3K25 A;  4V1S A;  2BRW A;  1S64 B;  1O1R B;  1JYX A;  1VD5 A;  2JF4 A;  3D4Z A;  3WA2 X;  2YFO A;  1JZ6 A;  1UMP A;  1UT9 A;  3X42 A;  2WCO A;  1N4R B;  3DSV B;  3TF4 A;  1MMU A;  5FO9 B;  1NS0 A;  3EJS A;  1LF9 A;  1LD7 B;  3VD3 A;  1GXM A;  3E6U A;  4LNV A;  4GTR B;  5DGQ A;  2FV0 A;  2RDY A;  3QT3 A;  3DYM A;  3DSX B;  1F9D A;  2ONG A;  1GHQ A;  3BUI A;  3KN4 A;  5ILI A;  1TXK A;  2WW3 A;  3EJP A;  1SIH A;  3CIH A;  3MI6 A;  5IK6 A;  2RI9 A;  2E22 A;  1JCQ B;  3RX5 A;  3BVV A;  5FO7 B;  1IVW A;  2RGK A;  3J7H A;  3P5R A;  3CZN A;  3TY1 A;  4BOJ A;  2Y73 A;  4FXK B;  5FO8 B;  2G02 A;  4EHM B;  4KTR A;  2BB5 A;  2F7O A;  3VD9 A;  1QWU A;  3OXU A;  2OW7 A;  1H3C A;  2V8J A;  1HN0 A;  2EAD A;  4GTS B;  1QSJ A;  4D4B A;  1O5M B;  3I3D A;  5C05 A;  4KFE A;  5KBP A;  1DL2 A;  2XSG A;  4WVB A;  1NS4 A;  3H2W A;  3MWX A;  1N9A B;  1MN0 A;  2YX9 A;  3M78 A;  2VN4 A;  1W6K A;  4ZG8 A;  3QSP A;  3T2O A;  1DOG A;  1HM2 A;  2WYN A;  3BVT A;  4DUW A;  1MMY A;  4KKI A;  2BED B;  5CD2 A;  3QPF A;  1SA5 B;  1UI8 A;  3OED A;  3HII A;  3X3X A;  3VDB A;  3T08 A;  1OJO A;  4KKJ A;  4J5T A;  1X81 B;  2EAE A;  1RQ5 A;  1H3B A;  1TNB B;  1K72 A;  5IKA A;  3QG0 A;  1N7P A;  1HX9 A;  4BZH A;  4KFD A;  1LD8 B;  1MZC B;  4GTQ B;  2DRQ A;  3DDG A;  1H37 A;  1D6U A;  2CQS A;  2ZIS B;  3S4B A;  2OQE A;  3WIW A;  1NC5 A;  3GZK A;  3WKF A;  1RKY A;  5IK0 A;  1JZ3 A;  1YGA A;  4ZRP A;  4FXG B;  1J0M A;  4GTO B;  5ILH A;  2H6G B;  1CLC A;  1GAH A;  3AMO B;  3KSQ B;  3DCD A;  1H12 A;  1N7R A;  4D4A A;  4AYP A;  3OBA A;  1NSX A;  1TNO B;  1N22 A;  2WIN B;  2WII B;  3W5M A;  3EJQ A;  2H6H B;  1FMI A;  3VSN A;  4AYQ A;  3A24 A;  3NNB A;  1S63 B;  2Z07 A;  5JMD A;  2X03 A;  1W6G A;  2WO0 A;  1KSC A;  1NSM A;  1L2A A;  1NSR A;  4C1S A;  1N4Q B;  1SO0 A;  4DUX A;  1G6I A;  4MBG B;  3M7E A;  1IQY A;  1F4A A;  3EJR A;  3M73 A;  4GTV B;  1HXK A;  3Q79 B;  4JJJ A;  3X17 A;  2OKX A;  5DGR A;  4WVC A;  1DCE B;  2E24 A;  2XN0 A;  1O79 A;  4DOD A;  3CV5 A;  1CEM A;  1JZ5 A;  1FBW A;  4NEI A;  4ZRQ A;  1LXM A;  3WA3 A;  1MMX A;  5IM1 A;  3Q78 B;  4YDE B;  2WOF A;  3CZS A;  2WVX B;  1AGM A;  3DYP A;  2JKP A;  3I3B A;  3KII A;  3VD7 A;  4WVA A;  3H3K A;  4RNL A;  3SEP A;  1H14 A;  3NRE A;  2XQW A;  1N95 B;  4DOE A;  3SDQ A;  4E1Y A;  2CIR A;  1N24 A;  2J5C A;  3PZ4 B;  3RJ3 A;  4KTP A;  2EAB A;  3DST B;  3M01 A;  5CZL A;  4EL8 A;  1D8D B;  2CIQ A;  3K5T A;  3PGB A;  3WVF A;  3W7X A;  1TN8 B;  3EZ8 A;  3RX8 A;  2GH4 A;  1NSV A;  1I8Q A;  3BUP A;  1ULV A;  1H39 A;  1AVL A;  4CE7 A;  1UG9 A;  1KRE A;  2D73 A;  1FPP B;  1KZP B;  1G9J A;  2CFL A;  3EJT A;  3DPY B;  2PN5 A;  3IMH A;  2DRR A;  3ANI A;  3E80 A;  2BRV X;  1IS9 A;  1TN7 B;  3X3Z A;  3MV1 1;  2W0Q A;  3MV0 1;  2CWT A;  5EAU A;  1WU6 A;  2F1A A;  2HTB A;  3T33 A;  3MPH A;  2XWJ B;  1TN6 B;  2FUQ A;  2WVX A;  1O6H A;  2I07 B;  3SX1 A; 
#chains in the Genus database with same CATH homology
 1L1Y A;  3PZ2 B;  2V3N A;  4WU0 A;  5MEH A;  1F9G A;  3ANJ A;  1G87 A;  1X9D A;  3SQC A;  2HTA A;  1NSS A;  3AFL A;  1V7V A;  3IAQ A;  3QRY A;  3WKI A;  4LNB B;  1CB8 A;  2WDA A;  2XWB B;  1HZF A;  1SNZ A;  3S9V A;  3WKG A;  2P0V A;  1JS4 A;  3VDA A;  1V5D A;  3SDU A;  1V7X A;  2B39 A;  3D3I A;  4YCR A;  3GT5 A;  1QBQ B;  3BGA A;  1JYV A;  2WW0 A;  1Z45 A;  5AGD A;  1L7K A;  1JOV A;  1F9O A;  3E34 B;  3KQ4 A;  5E2J A;  1FP3 A;  2Q1F A;  4TXT A;  1L7J A;  1JZ2 A;  3QFZ A;  1LF6 A;  1NS7 A;  1PX3 A;  1NSZ A;  1GXO A;  5M7Y A;  5FOB B;  2JG0 A;  3GLY A;  1O1S B;  4V1R A;  3QWT A;  1N7O A;  2G0D A;  3ANK A;  3SDR A;  3EU5 B;  1J0N A;  1TF4 A;  1OJM A;  1XWQ A;  2WVY A;  3W7W A;  1RWC A;  2BBC A;  2GZ6 A;  3OS7 A;  4TF4 A;  1XW2 A;  1O6Q A;  2FUZ A;  3T09 A;  3VD5 A;  4AQ0 A;  3QFY A;  4CJ1 A;  2BRP A;  3HXF B;  3W5N A;  4FNV A;  1HCU A;  1N94 B;  1O6R A;  3S4C A;  3A3V A;  3E32 B;  1LOH A;  2GOX A;  3BLC A;  4ZH5 A;  1XWT A;  2WY8 A;  5GZK A;  3WIR A;  3Q1N A;  1SQC A;  4LNG B;  3HXC B;  4GTP B;  4GTM B;  4ZH1 A;  1LUR A;  1KWF A;  3KSL B;  1X1I A;  1FT1 B;  2YIK A;  2WY7 A;  3WKH A;  4DUV A;  1F1S A;  2WZS A;  3BS6 A;  3E37 B;  4D94 A;  1GLM A;  1NXC A;  3M7L A;  1NKG A;  3HXD B;  4XUV A;  2F6D A;  1GAI A;  3A0O A;  3D5R A;  5A1A A;  1IA6 A;  2ZQ0 A;  1HMW A;  1JZ7 A;  2PMV A;  4D4D A;  2H6F B;  3PMM A;  3VD9 A;  2ZZR A;  1O1T B;  1V5C A;  3ACS A;  4OK4 A;  5E1Q A;  2R2L B;  3EUV B;  3VW5 A;  1JCS B;  5JPM B;  1N7Q A;  4LIX A;  2JKE A;  4MMH A;  1C82 A;  1K1W A;  2EAC A;  1GXN A;  1RWG A;  1RWH A;  1NS2 A;  5JPN B;  3SDV A;  1FBO A;  4Z4J A;  2WW1 A;  2NOJ A;  1SA4 B;  1W3Y A;  3W7S A;  3P5P A;  3Q7A B;  3CU7 A;  2FUT A;  1KRF A;  2ZIR B;  4BZG A;  3QXF A;  1YQ2 A;  2B4F A;  4AYO A;  3K11 A;  1JZ8 A;  1R76 A;  2JJB A;  3PYA A;  3RX7 A;  1KKT A;  1JZ4 A;  2AFA A;  3NJV A;  2D5J A;  2FBA A;  1F4H A;  3E33 B;  3EQA A;  3WFA A;  3DRA B;  3M77 A;  3P2C A;  4MMI A;  4ONT A;  2NVP A;  1C3D A;  1OJN A;  1KFG A;  2JKA A;  2V8K A;  2WW2 A;  3T0B A;  1KSD A;  2CIS A;  4BZE A;  1H36 A;  1D8E B;  3SFY B;  3OB8 A;  1N7N A;  4FUS A;  3DSU B;  1X1H A;  4L9P B;  1K1Y A;  3VDC A;  4TTG A;  3DYO A;  5GW7 A;  3VXD A;  3W7U A;  3WC3 A;  3I3E A;  3WUX A;  1GSZ A;  1N4P B;  2AHF A;  1RWF A;  3K7X A;  2ZBL A;  1G9G A;  2VN7 A;  1NSU A;  2ZXQ A;  3E1F 1;  3RSY A;  3CZJ A;  1WU5 A;  3Q7F B;  3HXE B;  1NL4 B;  2RI8 A;  2XFG A;  4GL3 A;  2A8Z A;  5M7I A;  1KZO B;  1K1X A;  3M74 A;  1FO2 A;  4BOK A;  3DEC A;  5KKB A;  1GA2 A;  3G6J B;  3EU8 A;  1KS8 A;  3M71 A;  1WU4 A;  3MUY 1;  3S4D A;  2A73 B;  1NS8 A;  3SFX B;  3D5S A;  1N4S B;  4Q88 A;  4OJZ A;  3E30 B;  4MU9 A;  1H54 A;  1X1J A;  3SAE A;  3PZ3 B;  4GTT B;  3M76 A;  3KLS A;  2V3P A;  1FT2 B;  3WIQ A;  1MMZ A;  5GY3 A;  3ECQ A;  3T0A A;  1W6J A;  4L0G A;  3RRS A;  5JMF A;  3E73 A;  3VD4 A;  3QT9 A;  1LXK A;  3VSM A;  1NI1 B;  2BB6 A;  1JYW A;  2QNO A;  3HXB B;  3PZ1 B;  2IEJ B;  4Q2B A;  1OJP A;  2FV1 A;  4CJ0 A;  2WVZ A;  2XHN A;  1TNZ B;  1JCR B;  2V8I A;  2AHG A;  1RW9 A;  3M72 A;  1V7W A;  1H13 A;  1EGU A;  3PYB A;  1HN1 A;  1H3A A;  3QDE A;  5CA3 A;  3E7J A;  3ACT A;  3M7C A;  2DRO A;  3M7B A;  1HM3 A;  1TNY B;  1H35 A;  2F0Y B;  3C72 B;  3ON6 A;  3AFJ A;  2D8L A;  3T0D A;  2H6I B;  3S4A A;  1FAE A;  3SDT A;  4OK2 A;  2DRS A;  4QT9 A;  3MUZ 1;  1AYX A;  2SQC A;  4D4C A;  3Q75 B;  3W7T A;  4M76 A;  3DSW B;  3Q73 B;  3T2Q A;  1RWA A;  3REN A;  3NJX A;  1QQF A;  1TNU B;  4Z4L A;  3H7L A;  3QXQ A;  4L6X A;  1LTX B;  1IA7 A;  1DP0 A;  3IAP A;  4AYR A;  4BZF A;  3T2P A;  1JYN A;  1HMU A;  2CQT A;  1FO3 A;  1WZZ A;  3M75 A;  4YDO B;  1PX4 A;  1FCE A;  3DSS B;  3K25 A;  4V1S A;  2BRW A;  1S64 B;  1O1R B;  1JYX A;  1VD5 A;  2JF4 A;  1JZ6 A;  1UMP A;  1UT9 A;  2WCO A;  1N4R B;  3DSV B;  3TF4 A;  1MMU A;  5FO9 B;  1NS0 A;  3VD3 A;  1LF9 A;  1LD7 B;  1GXM A;  3E6U A;  4LNV A;  4GTR B;  5DGQ A;  2FV0 A;  3DYM A;  3QT3 A;  3DSX B;  1F9D A;  1GHQ A;  1TXK A;  2WW3 A;  3CIH A;  2RI9 A;  2E22 A;  1JCQ B;  3RX5 A;  5FO7 B;  2RGK A;  3J7H A;  3P5R A;  3TY1 A;  4BOJ A;  4FXK B;  5FO8 B;  2G02 A;  4EHM B;  4KTR A;  2BB5 A;  3OXU A;  1H3C A;  2V8J A;  1HN0 A;  2EAD A;  4GTS B;  1QSJ A;  4D4B A;  1O5M B;  3I3D A;  1DL2 A;  2XSG A;  4WVB A;  1NS4 A;  3H2W A;  3MWX A;  1N9A B;  1MN0 A;  3M78 A;  2VN4 A;  1W6K A;  4ZG8 A;  3QSP A;  3T2O A;  1DOG A;  2WYN A;  1HM2 A;  4DUW A;  1MMY A;  4KKI A;  2BED B;  5CD2 A;  3QPF A;  1SA5 B;  3OED A;  3VDB A;  3T08 A;  4KKJ A;  1OJO A;  4J5T A;  1X81 B;  2EAE A;  1RQ5 A;  1H3B A;  1TNB B;  1K72 A;  3QG0 A;  1N7P A;  4BZH A;  1LD8 B;  1MZC B;  4GTQ B;  2DRQ A;  1H37 A;  2CQS A;  2ZIS B;  3S4B A;  3WIW A;  1NC5 A;  3GZK A;  3WKF A;  1JZ3 A;  1YGA A;  4ZRP A;  4FXG B;  4GTO B;  1J0M A;  2H6G B;  1CLC A;  1GAH A;  3KSQ B;  3DCD A;  1H12 A;  4D4A A;  1N7R A;  4AYP A;  3OBA A;  1NSX A;  1TNO B;  2WIN B;  2WII B;  3W5M A;  2H6H B;  1FMI A;  3VSN A;  4AYQ A;  3A24 A;  1S63 B;  2Z07 A;  5JMD A;  2X03 A;  1KSC A;  1NSM A;  1L2A A;  1NSR A;  4C1S A;  1N4Q B;  1SO0 A;  4DUX A;  1G6I A;  4MBG B;  3M7E A;  1F4A A;  3M73 A;  4GTV B;  3Q79 B;  4JJJ A;  3X17 A;  2OKX A;  5DGR A;  4WVC A;  1DCE B;  2E24 A;  1O79 A;  4DOD A;  1CEM A;  1JZ5 A;  1FBW A;  4ZRQ A;  4NEI A;  1LXM A;  1MMX A;  3Q78 B;  4YDE B;  3DYP A;  3I3B A;  2WVX B;  1AGM A;  2JKP A;  3VD7 A;  4WVA A;  3H3K A;  4RNL A;  3SEP A;  1H14 A;  3NRE A;  2XQW A;  1N95 B;  4DOE A;  3SDQ A;  2CIR A;  3PZ4 B;  3RJ3 A;  4KTP A;  2EAB A;  3DST B;  5CZL A;  4EL8 A;  1D8D B;  2CIQ A;  3WVF A;  3W7X A;  1TN8 B;  3EZ8 A;  3RX8 A;  2GH4 A;  1NSV A;  1I8Q A;  1ULV A;  1H39 A;  4CE7 A;  1UG9 A;  1KRE A;  2D73 A;  1FPP B;  1KZP B;  1G9J A;  3DPY B;  2PN5 A;  3IMH A;  2DRR A;  3ANI A;  3E80 A;  2BRV X;  1IS9 A;  1TN7 B;  3MV1 1;  3MV0 1;  1WU6 A;  2HTB A;  3T33 A;  2XWJ B;  1TN6 B;  2FUQ A;  2WVX A;  1O6H A;  2I07 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...