1NS8A

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with galactose
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGINHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 95
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns8A00
1L7JA 1N7QA 1JZ2A 1K1XA 3CZJA 1RWAA 1LF9A 3T08A 2JKPA 3T09A 1X1IA 1X1HA 1OJNA 1RWCA 2WW1A 1YGAA 1NS7A 3MUZ1 3OBAA 1UG9A 1JZ5A 1RW9A 2JKAA 3DYOA 2HTBA 2WVZA 1JOVA 3T0BA 2XSGA 3MWXA 4TTGA 2Q1FA 2BRWA 3T0DA 3T2OA 3DCDA 1F1SA 1F4AA 1Z45A 1I8QA 1LXMA 1HM3A 2CIRA 3IAQA 1NSXA 1X1JA 2HTAA 1HMWA 3IMHA 2XHNA 1NSVA 3ECQA 1L7KA 3MV01 3VDCA 3OB8A 1JZ3A 1NS0A 4DUXA 3A24A 4BZGA 2BRPA 3K25A 2ZQ0A 3I3EA 3T2PA 3NJXA 3WFAA 1OJPA 1HMUA 3OS7A 2WVYA 3J7HA 4RNLA 1EGUA 1DP0A 1ULVA 1W3YA 1PX3A 4BZFA 4DUVA 2BRVX 1SO0A 1MMXA 1NSMA 5E1QA 4AQ0A 1JZ4A 1OJOA 1JYXA 2WVXB 2WCOA 3VDBA 3NREA 1TXKA 2WZSA 1NSUA 1N7OA 3MUY1 1LXKA 1C82A 3Q1NA 1RWFA 2WVXA 3DECA 3SEPA 3E1F1 3DYPA 1NS4A 4DUWA 3VD9A 3NJVA 2WDAA 1YQ2A 1K1WA 1JYWA 1J0MA 3VD3A 3T0AA 2E22A 2E24A 1NS2A 1NKGA 1NSSA 3VD7A 3T2QA 1JZ8A 1JYNA 3MV11 3DYMA 1N7NA 3VDAA 1CB8A 2JKEA 1NS8A 1NSZA 3IAPA 1NSRA 5A1AA 2D73A 1PX4A 1MMUA 1HN0A 2WW0A 4BZEA 1HN1A 3BGAA 1MMZA 1F4HA 1LOHA 1JZ6A 2ZXQA 1MMYA 1JYVA 1OJMA 1LURA 1RWHA 1N7RA 2WW3A 1SNZA 1MN0A 2X03A 2CIQA 3I3DA 4BZHA 1LF6A 2CISA 1RWGA 1J0NA 1N7PA 1HM2A 3I3BA 1F9GA 2WW2A 3VD4A 1K1YA 3VD5A 1JZ7A
chains in the Genus database with same CATH superfamily
3S4AA 1RWAA 1LF9A 2FUQA 2XN2A 3T09A 1X1HA 3D52A 1IQYA 1RWCA 3BUPA 2F7PA 4FNRA 3EJSA 2BT3A 3E7JA 1LVNA 2CWVA 3AMOB 1UG9A 2EAEA 3BLCA 3T0BA 3T0DA 3T2OA 3DCDA 3A0OA 1LXMA 3EJPA 3IAQA 3BLBA 1O7DD 3EJTA 3BS6A 1IVWA 3ECQA 1L7KA 3OB8A 2CFKA 1JZ3A 3A24A 2BRPA 2ZQ0A 3OS7A 2WVYA 1W7CA 3WIRA 3X3XA 4KFFA 3BUIA 1PX3A 3E80A 1JYXA 4NEIA 2WZSA 1N7OA 1LXKA 1C82A 3ALAA 1UI7A 3VD9A 1A2VA 3NBBA 2F7RA 3VD3A 2E24A 3NBJA 1N7NA 3W7XA 3VDAA 1RJOA 1NS8A 3IAPA 1TQUA 2WW0A 3DX3A 1LOHA 1JYVA 2EADA 1IU7A 1TQWA 1DYUA 2CISA 1IVXA 1L7JA 3HIIA 1KSIA 1R34A 1W5ZA 3CZJA 3T08A 1D6UA 1H54A 1X1IA 1OJNA 1YGAA 3CZNA 4FNVA 1PU4A 2C11A 1AVLA 3ACTA 3DYOA 2XN0A 2F7QA 3TY1A 2WVZA 3CZSA 3MWXA 4OK4A 3AMOA 4FNQA 4KTRA 1F1SA 1F4AA 3X40A 1HM3A 2CIRA 3WVFA 3RSYA 1US1A 3ACSA 3BVWA 3WA2X 3LVTA 2CFLA 1NSVA 4FNPA 3MV01 3VDCA 3VSMA 3EJRA 1OJPA 2CWTA 2OOVA 2WOHA 3J7HA 3SX1A 1DP0A 2FUTA 4BZFA 4DUVA 3DDFA 5E1QA 3NREA 3Q1NA 3SEPA 2ALWA 3HIGA 3DYPA 4K3AA 3S4CA 1V7XA 1IQXA 3D3IA 2Y74A 3NJVA 2YX9A 1D6YA 1J0MA 3EJQA 3T0AA 3KN4A 2Y73A 2WYIA 5JMFA 1JZ8A 3QFYA 3MV11 3DYMA 4UFCA 1CB8A 2XN1A 1W6CA 1PS3A 1NSZA 3BVUA 5A1AA 2D73A 1PX4A 2F1AA 1IVVA 1R33A 1TQTA 4MMIA 2CFWA 3BGAA 2WO0A 1JZ6A 3QG0A 3RRSA 1OJMA 3HI7A 4KFEA 1N7RA 1OACA 2WYHA 1TQSA 3I3DA 4BZHA 3X41A 1HM2A 1F9GA 4EV5A 1W6GA 1K1YA 1WMNA 3VD5A 4K35A 1N7QA 2CG0A 3WA3A 1K1XA 3VSNA 2YFNA 1QALA 3MPHA 2EACA 2D1WA 3BUDA 4EV2A 5JMDA 2CQTA 3OBAA 3D4ZA 1RW9A 2JKAA 1V7VA 2HTBA 1JOVA 2XSGA 2Q1FA 2C10A 1NSXA 1X1JA 2FYVA 1HMWA 3IMHA 4BTYA 1V7WA 3BVTA 1N9EA 3QFZA 1NS0A 4BZGA 1TQVA 4BTXA 3K25A 3I3EA 3X42A 3NJXA 3WFAA 1HMUA 4RNLA 1IVUA 5KBPA 1W4NA 1SO0A 4AQ0A 2OQEA 1JZ4A 1OJOA 3KIIA 2WVXB 3VDBA 1TXKA 2OOVC 2CQSA 3MUY1 3AFLA 3WIQA 1RWFA 1AV4A 2F18A 3E1F1 2CG1A 1D6ZA 1NS4A 2F1BA 4DUWA 4MMHA 1K1WA 1JYWA 2E22A 1SIIA 1NS2A 1WMOA 3VD7A 3T2QA 1JYNA 2ZL8A 1AVKA 2E2TA 2CFDA 2JKEA 3N9HA 1HN0A 3BVVA 1HN1A 1SPUA 2ZXQA 3D51A 1LURA 2WW3A 1SNZA 2X03A 1RWGA 3W7TA 1N7PA 3I3BA 1QX1A 3VD4A 1JZ7A 2E2VA 1JZ2A 1JRQA 1EKMA 4FNTA 3PGBA 2WGQA 5CA3A 2JKPA 2YFOA 1HWWA 2WW1A 1NS7A 1QAKA 3MUZ1 3T0UA 1SIHA 2PNCA 3BUBA 3K5TA 2RDYA 4BTWA 4TTGA 2CFGA 2BRWA 3EJUA 1QAFA 4OK2A 1Z45A 1I8QA 2WOFA 3W7SA 5GW7A 3S4DA 2HTAA 2W0QA 3SXXA 2XHNA 4KFDA 4DUXA 3T2PA 3CV5A 3DX2A 1QWNA 2OW6A 1EGUA 1HXKA 1W3YA 1ULVA 2BRVX 1MMXA 1NSMA 2WCOA 3BUQA 1RKYA 3LOYA 3W7WA 1NSUA 2OW7A 2WVXA 3DECA 2OQEC 3AFJA 3QDEA 4FNUA 2WDAA 1YQ2A 4KTPA 2EABA 3DDGA 1NKGA 1NSSA 3DX4A 3DX1A 1W2ZA 3D4YA 1QWUA 1UI8A 3MI6A 1HTYA 3X3ZA 1NSRA 3S4BA 3BVXA 1MMUA 4OJZA 4BZEA 1MMZA 1F4HA 1MMYA 3D50A 1RWHA 2F7OA 1MN0A 1WMPA 4FNSA 4J5TA 2CIQA 1LF6A 3X3YA 2CWUA 1J0NA 2E2UA 2WW2A 3W7UA 1JZ5A 1TU5A 3DX0A
chains in the Genus database with same CATH topology
1L7JA 1N7QA 1JZ2A 1K1XA 3VSNA 3CZJA 1RWAA 1LF9A 2FUQA 3T08A 2JKPA 3T09A 1X1IA 1X1HA 1OJNA 1RWCA 2WW1A 1YGAA 1NS7A 5JMDA 3MUZ1 4FNVA 3OBAA 3E7JA 1UG9A 1JZ5A 1RW9A 2JKAA 3DYOA 2HTBA 3BLCA 3TY1A 2WVZA 1JOVA 4OK4A 2XSGA 3MWXA 3T0BA 2Q1FA 4TTGA 2BRWA 3T0DA 3T2OA 3DCDA 4OK2A 3A0OA 1F1SA 1F4AA 1Z45A 1I8QA 1LXMA 1HM3A 2CIRA 3IAQA 3WVFA 1NSXA 1X1JA 2HTAA 1HMWA 3IMHA 3BS6A 2XHNA 1NSVA 3ECQA 1L7KA 3MV01 3VDCA 3OB8A 3VSMA 1JZ3A 1NS0A 4DUXA 3A24A 4BZGA 2BRPA 3K25A 2ZQ0A 3I3EA 3T2PA 3NJXA 3WFAA 1OJPA 1HMUA 3OS7A 2WVYA 3J7HA 4RNLA 1EGUA 1DP0A 1ULVA 1W3YA 2FUTA 1PX3A 3E80A 4BZFA 4DUVA 2BRVX 1SO0A 1MMXA 1NSMA 5E1QA 4AQ0A 1JZ4A 1OJOA 1JYXA 2WVXB 2WCOA 3VDBA 3NREA 1TXKA 2WZSA 4NEIA 1NSUA 1N7OA 3MUY1 3AFLA 1LXKA 1C82A 3Q1NA 1RWFA 2WVXA 3DECA 3SEPA 3E1F1 3DYPA 1NS4A 4DUWA 3VD9A 4MMHA 3NJVA 2WDAA 1YQ2A 1K1WA 1JYWA 1J0MA 3VD3A 3T0AA 2E22A 2E24A 1NS2A 5JMFA 1NKGA 1NSSA 3VD7A 3T2QA 1JZ8A 1JYNA 3MV11 3DYMA 1N7NA 3VDAA 1CB8A 2JKEA 1NS8A 1NSZA 3IAPA 1NSRA 5A1AA 2D73A 1PX4A 1MMUA 1HN0A 4MMIA 2WW0A 4OJZA 4BZEA 1HN1A 3BGAA 1MMZA 1F4HA 1LOHA 1JZ6A 2ZXQA 1MMYA 1JYVA 1OJMA 1LURA 1RWHA 1N7RA 2WW3A 1SNZA 1MN0A 4J5TA 2X03A 2CIQA 3I3DA 4BZHA 1LF6A 2CISA 1RWGA 1J0NA 1N7PA 1HM2A 3I3BA 1F9GA 2WW2A 3VD4A 1K1YA 3VD5A 1JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7J A;  1N7Q A;  1JZ2 A;  1K1X A;  3CZJ A;  1RWA A;  1LF9 A;  3T08 A;  2JKP A;  3T09 A;  1X1I A;  1X1H A;  1OJN A;  1RWC A;  2WW1 A;  1YGA A;  1NS7 A;  3MUZ 1;  3OBA A;  1UG9 A;  1JZ5 A;  1RW9 A;  2JKA A;  3DYO A;  2HTB A;  2WVZ A;  1JOV A;  3T0B A;  2XSG A;  3MWX A;  4TTG A;  2Q1F A;  2BRW A;  3T0D A;  3T2O A;  3DCD A;  1F1S A;  1F4A A;  1Z45 A;  1I8Q A;  1LXM A;  1HM3 A;  2CIR A;  3IAQ A;  1NSX A;  1X1J A;  2HTA A;  1HMW A;  3IMH A;  2XHN A;  1NSV A;  3ECQ A;  1L7K A;  3MV0 1;  3VDC A;  3OB8 A;  1JZ3 A;  1NS0 A;  4DUX A;  3A24 A;  4BZG A;  2BRP A;  3K25 A;  2ZQ0 A;  3I3E A;  3T2P A;  3NJX A;  3WFA A;  1OJP A;  1HMU A;  3OS7 A;  2WVY A;  3J7H A;  4RNL A;  1EGU A;  1DP0 A;  1ULV A;  1W3Y A;  1PX3 A;  4BZF A;  4DUV A;  2BRV X;  1SO0 A;  1MMX A;  1NSM A;  5E1Q A;  4AQ0 A;  1JZ4 A;  1OJO A;  1JYX A;  2WVX B;  2WCO A;  3VDB A;  3NRE A;  1TXK A;  2WZS A;  1NSU A;  1N7O A;  3MUY 1;  1LXK A;  1C82 A;  3Q1N A;  1RWF A;  2WVX A;  3DEC A;  3SEP A;  3E1F 1;  3DYP A;  1NS4 A;  4DUW A;  3VD9 A;  3NJV A;  2WDA A;  1YQ2 A;  1K1W A;  1JYW A;  1J0M A;  3VD3 A;  3T0A A;  2E22 A;  2E24 A;  1NS2 A;  1NKG A;  1NSS A;  3VD7 A;  3T2Q A;  1JZ8 A;  1JYN A;  3MV1 1;  3DYM A;  1N7N A;  3VDA A;  1CB8 A;  2JKE A;  1NS8 A;  1NSZ A;  3IAP A;  1NSR A;  5A1A A;  2D73 A;  1PX4 A;  1MMU A;  1HN0 A;  2WW0 A;  4BZE A;  1HN1 A;  3BGA A;  1MMZ A;  1F4H A;  1LOH A;  1JZ6 A;  2ZXQ A;  1MMY A;  1JYV A;  1OJM A;  1LUR A;  1RWH A;  1N7R A;  2WW3 A;  1SNZ A;  1MN0 A;  2X03 A;  2CIQ A;  3I3D A;  4BZH A;  1LF6 A;  2CIS A;  1RWG A;  1J0N A;  1N7P A;  1HM2 A;  3I3B A;  1F9G A;  2WW2 A;  3VD4 A;  1K1Y A;  3VD5 A;  1JZ7 A; 
#chains in the Genus database with same CATH topology
 3S4A A;  1RWA A;  1LF9 A;  2FUQ A;  2XN2 A;  3T09 A;  1X1H A;  3D52 A;  1IQY A;  1RWC A;  3BUP A;  2F7P A;  4FNR A;  3EJS A;  2BT3 A;  3E7J A;  1LVN A;  2CWV A;  3AMO B;  1UG9 A;  2EAE A;  3BLC A;  3T0B A;  3T0D A;  3T2O A;  3DCD A;  3A0O A;  1LXM A;  3EJP A;  3IAQ A;  3BLB A;  1O7D D;  3EJT A;  3BS6 A;  1IVW A;  3ECQ A;  1L7K A;  3OB8 A;  2CFK A;  1JZ3 A;  3A24 A;  2BRP A;  2ZQ0 A;  3OS7 A;  2WVY A;  1W7C A;  3WIR A;  3X3X A;  4KFF A;  3BUI A;  1PX3 A;  3E80 A;  1JYX A;  4NEI A;  2WZS A;  1N7O A;  1LXK A;  1C82 A;  3ALA A;  1UI7 A;  3VD9 A;  1A2V A;  3NBB A;  2F7R A;  3VD3 A;  2E24 A;  3NBJ A;  1N7N A;  3W7X A;  3VDA A;  1RJO A;  1NS8 A;  3IAP A;  1TQU A;  2WW0 A;  3DX3 A;  1LOH A;  1JYV A;  2EAD A;  1IU7 A;  1TQW A;  1DYU A;  2CIS A;  1IVX A;  1L7J A;  3HII A;  1KSI A;  1R34 A;  1W5Z A;  3CZJ A;  3T08 A;  1D6U A;  1H54 A;  1X1I A;  1OJN A;  1YGA A;  3CZN A;  4FNV A;  1PU4 A;  2C11 A;  1AVL A;  3ACT A;  3DYO A;  2XN0 A;  2F7Q A;  3TY1 A;  2WVZ A;  3CZS A;  3MWX A;  4OK4 A;  3AMO A;  4FNQ A;  4KTR A;  1F1S A;  1F4A A;  3X40 A;  1HM3 A;  2CIR A;  3WVF A;  3RSY A;  1US1 A;  3ACS A;  3BVW A;  3WA2 X;  3LVT A;  2CFL A;  1NSV A;  4FNP A;  3MV0 1;  3VDC A;  3VSM A;  3EJR A;  1OJP A;  2CWT A;  2OOV A;  2WOH A;  3J7H A;  3SX1 A;  1DP0 A;  2FUT A;  4BZF A;  4DUV A;  3DDF A;  5E1Q A;  3NRE A;  3Q1N A;  3SEP A;  2ALW A;  3HIG A;  3DYP A;  4K3A A;  3S4C A;  1V7X A;  1IQX A;  3D3I A;  2Y74 A;  3NJV A;  2YX9 A;  1D6Y A;  1J0M A;  3EJQ A;  3T0A A;  3KN4 A;  2Y73 A;  2WYI A;  5JMF A;  1JZ8 A;  3QFY A;  3MV1 1;  3DYM A;  4UFC A;  1CB8 A;  2XN1 A;  1W6C A;  1PS3 A;  1NSZ A;  3BVU A;  5A1A A;  2D73 A;  1PX4 A;  2F1A A;  1IVV A;  1R33 A;  1TQT A;  4MMI A;  2CFW A;  3BGA A;  2WO0 A;  1JZ6 A;  3QG0 A;  3RRS A;  1OJM A;  3HI7 A;  4KFE A;  1N7R A;  1OAC A;  2WYH A;  1TQS A;  3I3D A;  4BZH A;  3X41 A;  1HM2 A;  1F9G A;  4EV5 A;  1W6G A;  1K1Y A;  1WMN A;  3VD5 A;  4K35 A;  1N7Q A;  2CG0 A;  3WA3 A;  1K1X A;  3VSN A;  2YFN A;  1QAL A;  3MPH A;  2EAC A;  2D1W A;  3BUD A;  4EV2 A;  5JMD A;  2CQT A;  3OBA A;  3D4Z A;  1RW9 A;  2JKA A;  1V7V A;  2HTB A;  1JOV A;  2XSG A;  2Q1F A;  2C10 A;  1NSX A;  1X1J A;  2FYV A;  1HMW A;  3IMH A;  4BTY A;  1V7W A;  3BVT A;  1N9E A;  3QFZ A;  1NS0 A;  4BZG A;  1TQV A;  4BTX A;  3K25 A;  3I3E A;  3X42 A;  3NJX A;  3WFA A;  1HMU A;  4RNL A;  1IVU A;  5KBP A;  1W4N A;  1SO0 A;  4AQ0 A;  2OQE A;  1JZ4 A;  1OJO A;  3KII A;  2WVX B;  3VDB A;  1TXK A;  2OOV C;  2CQS A;  3MUY 1;  3AFL A;  3WIQ A;  1RWF A;  1AV4 A;  2F18 A;  3E1F 1;  2CG1 A;  1D6Z A;  1NS4 A;  2F1B A;  4DUW A;  4MMH A;  1K1W A;  1JYW A;  2E22 A;  1SII A;  1NS2 A;  1WMO A;  3VD7 A;  3T2Q A;  1JYN A;  2ZL8 A;  1AVK A;  2E2T A;  2CFD A;  2JKE A;  3N9H A;  1HN0 A;  3BVV A;  1HN1 A;  1SPU A;  2ZXQ A;  3D51 A;  1LUR A;  2WW3 A;  1SNZ A;  2X03 A;  1RWG A;  3W7T A;  1N7P A;  3I3B A;  1QX1 A;  3VD4 A;  1JZ7 A;  2E2V A;  1JZ2 A;  1JRQ A;  1EKM A;  4FNT A;  3PGB A;  2WGQ A;  5CA3 A;  2JKP A;  2YFO A;  1HWW A;  2WW1 A;  1NS7 A;  1QAK A;  3MUZ 1;  3T0U A;  1SIH A;  2PNC A;  3BUB A;  3K5T A;  2RDY A;  4BTW A;  4TTG A;  2CFG A;  2BRW A;  3EJU A;  1QAF A;  4OK2 A;  1Z45 A;  1I8Q A;  2WOF A;  3W7S A;  5GW7 A;  3S4D A;  2HTA A;  2W0Q A;  3SXX A;  2XHN A;  4KFD A;  4DUX A;  3T2P A;  3CV5 A;  3DX2 A;  1QWN A;  2OW6 A;  1EGU A;  1HXK A;  1W3Y A;  1ULV A;  2BRV X;  1MMX A;  1NSM A;  2WCO A;  3BUQ A;  1RKY A;  3LOY A;  3W7W A;  1NSU A;  2OW7 A;  2WVX A;  3DEC A;  2OQE C;  3AFJ A;  3QDE A;  4FNU A;  2WDA A;  1YQ2 A;  4KTP A;  2EAB A;  3DDG A;  1NKG A;  1NSS A;  3DX4 A;  3DX1 A;  1W2Z A;  3D4Y A;  1QWU A;  1UI8 A;  3MI6 A;  1HTY A;  3X3Z A;  1NSR A;  3S4B A;  3BVX A;  1MMU A;  4OJZ A;  4BZE A;  1MMZ A;  1F4H A;  1MMY A;  3D50 A;  1RWH A;  2F7O A;  1MN0 A;  1WMP A;  4FNS A;  4J5T A;  2CIQ A;  1LF6 A;  3X3Y A;  2CWU A;  1J0N A;  2E2U A;  2WW2 A;  3W7U A;  1JZ5 A;  1TU5 A;  3DX0 A; 
#chains in the Genus database with same CATH homology
 1L7J A;  1N7Q A;  1JZ2 A;  1K1X A;  3VSN A;  3CZJ A;  1RWA A;  1LF9 A;  2FUQ A;  3T08 A;  2JKP A;  3T09 A;  1X1I A;  1X1H A;  1OJN A;  1RWC A;  2WW1 A;  1YGA A;  1NS7 A;  5JMD A;  3MUZ 1;  4FNV A;  3OBA A;  3E7J A;  1UG9 A;  1JZ5 A;  1RW9 A;  2JKA A;  3DYO A;  2HTB A;  3BLC A;  3TY1 A;  2WVZ A;  1JOV A;  4OK4 A;  2XSG A;  3MWX A;  3T0B A;  2Q1F A;  4TTG A;  2BRW A;  3T0D A;  3T2O A;  3DCD A;  4OK2 A;  3A0O A;  1F1S A;  1F4A A;  1Z45 A;  1I8Q A;  1LXM A;  1HM3 A;  2CIR A;  3IAQ A;  3WVF A;  1NSX A;  1X1J A;  2HTA A;  1HMW A;  3IMH A;  3BS6 A;  2XHN A;  1NSV A;  3ECQ A;  1L7K A;  3MV0 1;  3VDC A;  3OB8 A;  3VSM A;  1JZ3 A;  1NS0 A;  4DUX A;  3A24 A;  4BZG A;  2BRP A;  3K25 A;  2ZQ0 A;  3I3E A;  3T2P A;  3NJX A;  3WFA A;  1OJP A;  1HMU A;  3OS7 A;  2WVY A;  3J7H A;  4RNL A;  1EGU A;  1DP0 A;  1ULV A;  1W3Y A;  2FUT A;  1PX3 A;  3E80 A;  4BZF A;  4DUV A;  2BRV X;  1SO0 A;  1MMX A;  1NSM A;  5E1Q A;  4AQ0 A;  1JZ4 A;  1OJO A;  1JYX A;  2WVX B;  2WCO A;  3VDB A;  3NRE A;  1TXK A;  2WZS A;  4NEI A;  1NSU A;  1N7O A;  3MUY 1;  3AFL A;  1LXK A;  1C82 A;  3Q1N A;  1RWF A;  2WVX A;  3DEC A;  3SEP A;  3E1F 1;  3DYP A;  1NS4 A;  4DUW A;  3VD9 A;  4MMH A;  3NJV A;  2WDA A;  1YQ2 A;  1K1W A;  1JYW A;  1J0M A;  3VD3 A;  3T0A A;  2E22 A;  2E24 A;  1NS2 A;  5JMF A;  1NKG A;  1NSS A;  3VD7 A;  3T2Q A;  1JZ8 A;  1JYN A;  3MV1 1;  3DYM A;  1N7N A;  3VDA A;  1CB8 A;  2JKE A;  1NS8 A;  1NSZ A;  3IAP A;  1NSR A;  5A1A A;  2D73 A;  1PX4 A;  1MMU A;  1HN0 A;  4MMI A;  2WW0 A;  4OJZ A;  4BZE A;  1HN1 A;  3BGA A;  1MMZ A;  1F4H A;  1LOH A;  1JZ6 A;  2ZXQ A;  1MMY A;  1JYV A;  1OJM A;  1LUR A;  1RWH A;  1N7R A;  2WW3 A;  1SNZ A;  1MN0 A;  4J5T A;  2X03 A;  2CIQ A;  3I3D A;  4BZH A;  1LF6 A;  2CIS A;  1RWG A;  1J0N A;  1N7P A;  1HM2 A;  3I3B A;  1F9G A;  2WW2 A;  3VD4 A;  1K1Y A;  3VD5 A;  1JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...