1NS8A

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with galactose
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGINHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 95
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns8A00
1MMUA 1L7JA 3SEPA 2JKAA 2HTAA 3VDBA 3VDAA 2Q1FA 1HMWA 3VD5A 4DUWA 1RWCA 1I8QA 3T09A 1JZ5A 1K1YA 1LURA 1SO0A 2WDAA 1JZ6A 1YGAA 5E1QA 2E24A 1RWHA 1N7OA 1NSZA 1RWAA 1ULVA 3A24A 3T2QA 2JKEA 3I3DA 1F9GA 1X1IA 1RWFA 3CZJA 1CB8A 1NKGA 1N7NA 2BRWA 2CIRA 2WW0A 1J0NA 4DUXA 3IAQA 1LF9A 1LOHA 1NSMA 2CIQA 1N7PA 1LXKA 1RWGA 1OJOA 1HMUA 1NS0A 2CISA 2BRVX 1JYNA 1K1XA 1NS8A 1NS2A 3T0BA 1MN0A 2WVZA 1MMZA 1F1SA 2XSGA 1NSUA 1X1JA 1Z45A 2WCOA 3T0AA 3DYMA 4TTGA 1NSRA 3T08A 1JZ8A 3K25A 3J7HA 3MUZ1 1OJPA 2WVXA 3NREA 3VD3A 1SNZA 3DYOA 2JKPA 3T2OA 3NJXA 1JOVA 1OJNA 4RNLA 4BZHA 1OJMA 2X03A 1F4HA 1L7KA 1JZ4A 3VDCA 3E1F1 3T2PA 1W3YA 1NSSA 1MMYA 1N7QA 3WFAA 5A1AA 1JZ3A 1EGUA 3MV11 1X1HA 1JYXA 3DECA 3MUY1 1YQ2A 1LXMA 3OB8A 2D73A 3ECQA 1JZ7A 2WW2A 3OS7A 1RW9A 2WW3A 3BGAA 1LF6A 3NJVA 3VD9A 4AQ0A 2E22A 1K1WA 2WW1A 1TXKA 1N7RA 4BZGA 3MV01 1C82A 1DP0A 1UG9A 4BZFA 2BRPA 3Q1NA 3DCDA 3VD7A 3I3EA 3IAPA 2WVXB 1F4AA 2HTBA 1JYWA 1HN1A 1PX3A 1HM3A 4DUVA 3T0DA 2ZQ0A 3IMHA 1NSVA 3OBAA 2XHNA 1NS4A 2ZXQA 1HN0A 4BZEA 1HM2A 1NSXA 3I3BA 1NS7A 3DYPA 1JZ2A 3VD4A 2WZSA 1PX4A 2WVYA 3MWXA 1JYVA 1J0MA 1MMXA
chains in the Genus database with same CATH superfamily
4K35A 3DDGA 1MMUA 2FYVA 3SEPA 2CFDA 2CWVA 4MMIA 3RRSA 3VDAA 3CV5A 1HMWA 2FUQA 4DUWA 1I8QA 3T09A 3QDEA 1JZ5A 1LURA 3E7JA 3E80A 1JZ6A 3D52A 2E24A 1RWHA 3EJUA 3AMOA 1RWAA 3TY1A 1WMPA 1RWFA 1X1IA 3BVWA 2ZL8A 2BRWA 2OOVC 2XN0A 2OQEA 1OJOA 1NS0A 3X3ZA 3D4ZA 3T0BA 3W7WA 1QAKA 2XSGA 1PU4A 3BVVA 5CA3A 1NSUA 2C10A 3DYMA 2F7PA 1NSRA 3WIRA 3J7HA 3MUZ1 1QAFA 1UI8A 3NREA 3VD3A 2JKPA 2Y74A 2EADA 1JOVA 3RSYA 3ALAA 3MPHA 3VDCA 1TQSA 1AVLA 1W7CA 2PNCA 3DECA 1YQ2A 3OB8A 2F7OA 2D73A 1OACA 3N9HA 5GW7A 2WW3A 2D1WA 3BGAA 3NJVA 3S4CA 1K1WA 2F18A 4UFCA 3MV01 3LOYA 3BLBA 3VD7A 3IAPA 3EJRA 4EV5A 1NSVA 3CZNA 1NS4A 1HN0A 1HM2A 1IQYA 3DDFA 3VSMA 3DYPA 1PX4A 1SIHA 2WVYA 2OW7A 1J0MA 1MMXA 3AFLA 3QFZA 4FNTA 4KFEA 2XN2A 2Q1FA 3WA3A 1LVNA 1V7WA 2WDAA 5E1QA 3WA2X 3A24A 4K3AA 1W4NA 3T2QA 4KTRA 1F9GA 4NEIA 3CZJA 2W0QA 2WOFA 2C11A 1TQUA 3EJPA 4MMHA 4FNSA 1J0NA 1V7VA 3MI6A 1RWGA 2OQEC 4OK4A 2OW6A 2BRVX 3D4YA 1JRQA 1NS2A 2FUTA 1SPUA 1F1SA 1R34A 3BVUA 3S4AA 4FNRA 3HIIA 3W7UA 1JZ8A 1OJPA 1QX1A 3BVXA 4BTWA 1H54A 3DYOA 3W7TA 3T2OA 1PS3A 3S4DA 2X03A 3ACTA 3T2PA 1N7QA 1MMYA 1O7DD 1NSSA 2WYIA 3VSNA 1JZ3A 1EGUA 1SIIA 3MV11 3MUY1 1LXMA 3QFYA 1RKYA 2ALWA 1JZ7A 3WIQA 2WW2A 1RW9A 3A0OA 3W7SA 2CFGA 2WW1A 3LVTA 3DX3A 1IVXA 1N7RA 2YFOA 1C82A 1D6UA 1DP0A 2BRPA 3Q1NA 3DCDA 1HTYA 2WVXB 2E2VA 1HN1A 3X42A 2ZQ0A 4FNVA 3OBAA 3X3YA 4BZEA 2CWUA 3PGBA 2Y73A 1NS7A 2CG1A 3VD4A 2WZSA 1JYVA 1IVWA 3CZSA 3VDBA 3BUQA 3VD5A 1RWCA 3BLCA 1K1YA 3ACSA 3DX0A 1RJOA 3EJTA 1N7OA 4BTXA 3BS6A 1ULVA 1N9EA 3NBJA 1V7XA 1W6GA 1DYUA 1N7NA 2WW0A 4DUXA 1LF9A 1LOHA 1LXKA 2EACA 2CISA 1K1XA 2CFLA 1MN0A 2WVZA 2CG0A 3BUPA 1X1JA 4BTYA 4TTGA 2WO0A 3S4BA 3T08A 3HIGA 2WVXA 3D50A 3NJXA 1OJNA 4RNLA 4BZHA 1OJMA 1F4HA 1L7KA 1W2ZA 3BVTA 3T0UA 3QG0A 1D6YA 3X3XA 2CFWA 1W6CA 1X1HA 4OJZA 2YX9A 3EJSA 1KSIA 3OS7A 1LF6A 1QALA 1TXKA 4BZGA 2CQSA 4BZFA 2RDYA 4FNUA 1F4AA 2HTBA 4KFFA 1PX3A 3T0DA 5KBPA 1WMNA 3IMHA 1A2VA 2EAEA 4KFDA 1NSXA 3I3BA 3KIIA 2F1AA 1JZ2A 3MWXA 2WYHA 3X41A 2ZXQA 3DX4A 2F1BA 1L7JA 2F7QA 2JKAA 2HTAA 3SXXA 3EJQA 3AFJA 3D3IA 1WMOA 2WGQA 1SO0A 1YGAA 1NSZA 5JMFA 1R33A 3DX1A 2JKEA 3I3DA 1TQTA 2CQTA 3D51A 1CB8A 2E2TA 2OOVA 1NKGA 2CIRA 3IAQA 1NSMA 2CIQA 1N7PA 3WVFA 1EKMA 4FNQA 1HMUA 1HWWA 1JYNA 1AV4A 3DX2A 1NS8A 3X40A 1MMZA 4KTPA 1Z45A 2WCOA 1AVKA 3W7XA 3T0AA 1TQWA 2BT3A 1TQVA 3K25A 3BUBA 1SNZA 3AMOB 3K5TA 1W5ZA 5JMDA 4FNPA 2CFKA 1JZ4A 2WOHA 2XN1A 3E1F1 1W3YA 3WFAA 5A1AA 1HXKA 3NBBA 1JYXA 3BUDA 4EV2A 3ECQA 2EABA 1IQXA 3VD9A 1UI7A 4AQ0A 2E22A 3SX1A 1IVUA 2E2UA 1D6ZA 3HI7A 1UG9A 3I3EA 2YFNA 2F7RA 1IU7A 1JYWA 1QWNA 1HM3A 4DUVA 1TU5A 1US1A 1QWUA 2XHNA 4J5TA 3KN4A 3BUIA 2CWTA 4OK2A 1IVVA
chains in the Genus database with same CATH topology
3AFLA 1MMUA 1L7JA 3SEPA 2JKAA 2HTAA 4MMIA 3VDBA 3VDAA 2Q1FA 1HMWA 2FUQA 3VD5A 4DUWA 1RWCA 1I8QA 3BLCA 3T09A 1JZ5A 1K1YA 1LURA 1SO0A 2WDAA 3E7JA 1YGAA 3E80A 2E24A 5E1QA 1JZ6A 1RWHA 1N7OA 1NSZA 5JMFA 3BS6A 1RWAA 1ULVA 3A24A 3T2QA 2JKEA 3TY1A 3I3DA 1F9GA 4NEIA 1X1IA 1RWFA 3CZJA 1CB8A 1NKGA 1N7NA 2BRWA 2CIRA 4MMHA 2WW0A 1J0NA 4DUXA 3IAQA 1LF9A 1LOHA 1NSMA 2CIQA 1N7PA 1LXKA 1RWGA 3WVFA 4OK4A 1OJOA 1HMUA 1NS0A 2CISA 2BRVX 1JYNA 1K1XA 1NS8A 1NS2A 2FUTA 3T0BA 1MN0A 2WVZA 1MMZA 1F1SA 2XSGA 1NSUA 1X1JA 1Z45A 2WCOA 3T0AA 3DYMA 4TTGA 1NSRA 3T08A 1JZ8A 3K25A 3J7HA 3MUZ1 1OJPA 2WVXA 3NREA 3VD3A 1SNZA 3DYOA 2JKPA 3T2OA 3NJXA 1JOVA 1OJNA 4RNLA 4BZHA 1OJMA 2X03A 1F4HA 5JMDA 1L7KA 1JZ4A 3VDCA 3E1F1 3T2PA 1W3YA 1NSSA 1MMYA 1N7QA 3VSNA 3WFAA 5A1AA 1JZ3A 1EGUA 3MV11 1X1HA 1JYXA 3DECA 3MUY1 4OJZA 1YQ2A 1LXMA 3OB8A 2D73A 3ECQA 1JZ7A 2WW2A 3OS7A 1RW9A 2WW3A 3BGAA 1LF6A 3NJVA 3VD9A 4AQ0A 3A0OA 2E22A 1K1WA 2WW1A 1TXKA 1N7RA 4BZGA 3MV01 1C82A 1DP0A 1UG9A 4BZFA 2BRPA 3Q1NA 3DCDA 3VD7A 3I3EA 3IAPA 2WVXB 1F4AA 2HTBA 1JYWA 1HN1A 1PX3A 1HM3A 4DUVA 3T0DA 2ZQ0A 3IMHA 4FNVA 1NSVA 3OBAA 2XHNA 1NS4A 2ZXQA 1HN0A 4J5TA 1HM2A 4BZEA 1NSXA 3I3BA 3VSMA 1NS7A 3DYPA 1JZ2A 3VD4A 2WZSA 1PX4A 2WVYA 3MWXA 1JYVA 4OK2A 1J0MA 1MMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMU A;  1L7J A;  3SEP A;  2JKA A;  2HTA A;  3VDB A;  3VDA A;  2Q1F A;  1HMW A;  3VD5 A;  4DUW A;  1RWC A;  1I8Q A;  3T09 A;  1JZ5 A;  1K1Y A;  1LUR A;  1SO0 A;  2WDA A;  1JZ6 A;  1YGA A;  5E1Q A;  2E24 A;  1RWH A;  1N7O A;  1NSZ A;  1RWA A;  1ULV A;  3A24 A;  3T2Q A;  2JKE A;  3I3D A;  1F9G A;  1X1I A;  1RWF A;  3CZJ A;  1CB8 A;  1NKG A;  1N7N A;  2BRW A;  2CIR A;  2WW0 A;  1J0N A;  4DUX A;  3IAQ A;  1LF9 A;  1LOH A;  1NSM A;  2CIQ A;  1N7P A;  1LXK A;  1RWG A;  1OJO A;  1HMU A;  1NS0 A;  2CIS A;  2BRV X;  1JYN A;  1K1X A;  1NS8 A;  1NS2 A;  3T0B A;  1MN0 A;  2WVZ A;  1MMZ A;  1F1S A;  2XSG A;  1NSU A;  1X1J A;  1Z45 A;  2WCO A;  3T0A A;  3DYM A;  4TTG A;  1NSR A;  3T08 A;  1JZ8 A;  3K25 A;  3J7H A;  3MUZ 1;  1OJP A;  2WVX A;  3NRE A;  3VD3 A;  1SNZ A;  3DYO A;  2JKP A;  3T2O A;  3NJX A;  1JOV A;  1OJN A;  4RNL A;  4BZH A;  1OJM A;  2X03 A;  1F4H A;  1L7K A;  1JZ4 A;  3VDC A;  3E1F 1;  3T2P A;  1W3Y A;  1NSS A;  1MMY A;  1N7Q A;  3WFA A;  5A1A A;  1JZ3 A;  1EGU A;  3MV1 1;  1X1H A;  1JYX A;  3DEC A;  3MUY 1;  1YQ2 A;  1LXM A;  3OB8 A;  2D73 A;  3ECQ A;  1JZ7 A;  2WW2 A;  3OS7 A;  1RW9 A;  2WW3 A;  3BGA A;  1LF6 A;  3NJV A;  3VD9 A;  4AQ0 A;  2E22 A;  1K1W A;  2WW1 A;  1TXK A;  1N7R A;  4BZG A;  3MV0 1;  1C82 A;  1DP0 A;  1UG9 A;  4BZF A;  2BRP A;  3Q1N A;  3DCD A;  3VD7 A;  3I3E A;  3IAP A;  2WVX B;  1F4A A;  2HTB A;  1JYW A;  1HN1 A;  1PX3 A;  1HM3 A;  4DUV A;  3T0D A;  2ZQ0 A;  3IMH A;  1NSV A;  3OBA A;  2XHN A;  1NS4 A;  2ZXQ A;  1HN0 A;  4BZE A;  1HM2 A;  1NSX A;  3I3B A;  1NS7 A;  3DYP A;  1JZ2 A;  3VD4 A;  2WZS A;  1PX4 A;  2WVY A;  3MWX A;  1JYV A;  1J0M A;  1MMX A; 
#chains in the Genus database with same CATH topology
 4K35 A;  3DDG A;  1MMU A;  2FYV A;  3SEP A;  2CFD A;  2CWV A;  4MMI A;  3RRS A;  3VDA A;  3CV5 A;  1HMW A;  2FUQ A;  4DUW A;  1I8Q A;  3T09 A;  3QDE A;  1JZ5 A;  1LUR A;  3E7J A;  3E80 A;  1JZ6 A;  3D52 A;  2E24 A;  1RWH A;  3EJU A;  3AMO A;  1RWA A;  3TY1 A;  1WMP A;  1RWF A;  1X1I A;  3BVW A;  2ZL8 A;  2BRW A;  2OOV C;  2XN0 A;  2OQE A;  1OJO A;  1NS0 A;  3X3Z A;  3D4Z A;  3T0B A;  3W7W A;  1QAK A;  2XSG A;  1PU4 A;  3BVV A;  5CA3 A;  1NSU A;  2C10 A;  3DYM A;  2F7P A;  1NSR A;  3WIR A;  3J7H A;  3MUZ 1;  1QAF A;  1UI8 A;  3NRE A;  3VD3 A;  2JKP A;  2Y74 A;  2EAD A;  1JOV A;  3RSY A;  3ALA A;  3MPH A;  3VDC A;  1TQS A;  1AVL A;  1W7C A;  2PNC A;  3DEC A;  1YQ2 A;  3OB8 A;  2F7O A;  2D73 A;  1OAC A;  3N9H A;  5GW7 A;  2WW3 A;  2D1W A;  3BGA A;  3NJV A;  3S4C A;  1K1W A;  2F18 A;  4UFC A;  3MV0 1;  3LOY A;  3BLB A;  3VD7 A;  3IAP A;  3EJR A;  4EV5 A;  1NSV A;  3CZN A;  1NS4 A;  1HN0 A;  1HM2 A;  1IQY A;  3DDF A;  3VSM A;  3DYP A;  1PX4 A;  1SIH A;  2WVY A;  2OW7 A;  1J0M A;  1MMX A;  3AFL A;  3QFZ A;  4FNT A;  4KFE A;  2XN2 A;  2Q1F A;  3WA3 A;  1LVN A;  1V7W A;  2WDA A;  5E1Q A;  3WA2 X;  3A24 A;  4K3A A;  1W4N A;  3T2Q A;  4KTR A;  1F9G A;  4NEI A;  3CZJ A;  2W0Q A;  2WOF A;  2C11 A;  1TQU A;  3EJP A;  4MMH A;  4FNS A;  1J0N A;  1V7V A;  3MI6 A;  1RWG A;  2OQE C;  4OK4 A;  2OW6 A;  2BRV X;  3D4Y A;  1JRQ A;  1NS2 A;  2FUT A;  1SPU A;  1F1S A;  1R34 A;  3BVU A;  3S4A A;  4FNR A;  3HII A;  3W7U A;  1JZ8 A;  1OJP A;  1QX1 A;  3BVX A;  4BTW A;  1H54 A;  3DYO A;  3W7T A;  3T2O A;  1PS3 A;  3S4D A;  2X03 A;  3ACT A;  3T2P A;  1N7Q A;  1MMY A;  1O7D D;  1NSS A;  2WYI A;  3VSN A;  1JZ3 A;  1EGU A;  1SII A;  3MV1 1;  3MUY 1;  1LXM A;  3QFY A;  1RKY A;  2ALW A;  1JZ7 A;  3WIQ A;  2WW2 A;  1RW9 A;  3A0O A;  3W7S A;  2CFG A;  2WW1 A;  3LVT A;  3DX3 A;  1IVX A;  1N7R A;  2YFO A;  1C82 A;  1D6U A;  1DP0 A;  2BRP A;  3Q1N A;  3DCD A;  1HTY A;  2WVX B;  2E2V A;  1HN1 A;  3X42 A;  2ZQ0 A;  4FNV A;  3OBA A;  3X3Y A;  4BZE A;  2CWU A;  3PGB A;  2Y73 A;  1NS7 A;  2CG1 A;  3VD4 A;  2WZS A;  1JYV A;  1IVW A;  3CZS A;  3VDB A;  3BUQ A;  3VD5 A;  1RWC A;  3BLC A;  1K1Y A;  3ACS A;  3DX0 A;  1RJO A;  3EJT A;  1N7O A;  4BTX A;  3BS6 A;  1ULV A;  1N9E A;  3NBJ A;  1V7X A;  1W6G A;  1DYU A;  1N7N A;  2WW0 A;  4DUX A;  1LF9 A;  1LOH A;  1LXK A;  2EAC A;  2CIS A;  1K1X A;  2CFL A;  1MN0 A;  2WVZ A;  2CG0 A;  3BUP A;  1X1J A;  4BTY A;  4TTG A;  2WO0 A;  3S4B A;  3T08 A;  3HIG A;  2WVX A;  3D50 A;  3NJX A;  1OJN A;  4RNL A;  4BZH A;  1OJM A;  1F4H A;  1L7K A;  1W2Z A;  3BVT A;  3T0U A;  3QG0 A;  1D6Y A;  3X3X A;  2CFW A;  1W6C A;  1X1H A;  4OJZ A;  2YX9 A;  3EJS A;  1KSI A;  3OS7 A;  1LF6 A;  1QAL A;  1TXK A;  4BZG A;  2CQS A;  4BZF A;  2RDY A;  4FNU A;  1F4A A;  2HTB A;  4KFF A;  1PX3 A;  3T0D A;  5KBP A;  1WMN A;  3IMH A;  1A2V A;  2EAE A;  4KFD A;  1NSX A;  3I3B A;  3KII A;  2F1A A;  1JZ2 A;  3MWX A;  2WYH A;  3X41 A;  2ZXQ A;  3DX4 A;  2F1B A;  1L7J A;  2F7Q A;  2JKA A;  2HTA A;  3SXX A;  3EJQ A;  3AFJ A;  3D3I A;  1WMO A;  2WGQ A;  1SO0 A;  1YGA A;  1NSZ A;  5JMF A;  1R33 A;  3DX1 A;  2JKE A;  3I3D A;  1TQT A;  2CQT A;  3D51 A;  1CB8 A;  2E2T A;  2OOV A;  1NKG A;  2CIR A;  3IAQ A;  1NSM A;  2CIQ A;  1N7P A;  3WVF A;  1EKM A;  4FNQ A;  1HMU A;  1HWW A;  1JYN A;  1AV4 A;  3DX2 A;  1NS8 A;  3X40 A;  1MMZ A;  4KTP A;  1Z45 A;  2WCO A;  1AVK A;  3W7X A;  3T0A A;  1TQW A;  2BT3 A;  1TQV A;  3K25 A;  3BUB A;  1SNZ A;  3AMO B;  3K5T A;  1W5Z A;  5JMD A;  4FNP A;  2CFK A;  1JZ4 A;  2WOH A;  2XN1 A;  3E1F 1;  1W3Y A;  3WFA A;  5A1A A;  1HXK A;  3NBB A;  1JYX A;  3BUD A;  4EV2 A;  3ECQ A;  2EAB A;  1IQX A;  3VD9 A;  1UI7 A;  4AQ0 A;  2E22 A;  3SX1 A;  1IVU A;  2E2U A;  1D6Z A;  3HI7 A;  1UG9 A;  3I3E A;  2YFN A;  2F7R A;  1IU7 A;  1JYW A;  1QWN A;  1HM3 A;  4DUV A;  1TU5 A;  1US1 A;  1QWU A;  2XHN A;  4J5T A;  3KN4 A;  3BUI A;  2CWT A;  4OK2 A;  1IVV A; 
#chains in the Genus database with same CATH homology
 3AFL A;  1MMU A;  1L7J A;  3SEP A;  2JKA A;  2HTA A;  4MMI A;  3VDB A;  3VDA A;  2Q1F A;  1HMW A;  2FUQ A;  3VD5 A;  4DUW A;  1RWC A;  1I8Q A;  3BLC A;  3T09 A;  1JZ5 A;  1K1Y A;  1LUR A;  1SO0 A;  2WDA A;  3E7J A;  1YGA A;  3E80 A;  2E24 A;  5E1Q A;  1JZ6 A;  1RWH A;  1N7O A;  1NSZ A;  5JMF A;  3BS6 A;  1RWA A;  1ULV A;  3A24 A;  3T2Q A;  2JKE A;  3TY1 A;  3I3D A;  1F9G A;  4NEI A;  1X1I A;  1RWF A;  3CZJ A;  1CB8 A;  1NKG A;  1N7N A;  2BRW A;  2CIR A;  4MMH A;  2WW0 A;  1J0N A;  4DUX A;  3IAQ A;  1LF9 A;  1LOH A;  1NSM A;  2CIQ A;  1N7P A;  1LXK A;  1RWG A;  3WVF A;  4OK4 A;  1OJO A;  1HMU A;  1NS0 A;  2CIS A;  2BRV X;  1JYN A;  1K1X A;  1NS8 A;  1NS2 A;  2FUT A;  3T0B A;  1MN0 A;  2WVZ A;  1MMZ A;  1F1S A;  2XSG A;  1NSU A;  1X1J A;  1Z45 A;  2WCO A;  3T0A A;  3DYM A;  4TTG A;  1NSR A;  3T08 A;  1JZ8 A;  3K25 A;  3J7H A;  3MUZ 1;  1OJP A;  2WVX A;  3NRE A;  3VD3 A;  1SNZ A;  3DYO A;  2JKP A;  3T2O A;  3NJX A;  1JOV A;  1OJN A;  4RNL A;  4BZH A;  1OJM A;  2X03 A;  1F4H A;  5JMD A;  1L7K A;  1JZ4 A;  3VDC A;  3E1F 1;  3T2P A;  1W3Y A;  1NSS A;  1MMY A;  1N7Q A;  3VSN A;  3WFA A;  5A1A A;  1JZ3 A;  1EGU A;  3MV1 1;  1X1H A;  1JYX A;  3DEC A;  3MUY 1;  4OJZ A;  1YQ2 A;  1LXM A;  3OB8 A;  2D73 A;  3ECQ A;  1JZ7 A;  2WW2 A;  3OS7 A;  1RW9 A;  2WW3 A;  3BGA A;  1LF6 A;  3NJV A;  3VD9 A;  4AQ0 A;  3A0O A;  2E22 A;  1K1W A;  2WW1 A;  1TXK A;  1N7R A;  4BZG A;  3MV0 1;  1C82 A;  1DP0 A;  1UG9 A;  4BZF A;  2BRP A;  3Q1N A;  3DCD A;  3VD7 A;  3I3E A;  3IAP A;  2WVX B;  1F4A A;  2HTB A;  1JYW A;  1HN1 A;  1PX3 A;  1HM3 A;  4DUV A;  3T0D A;  2ZQ0 A;  3IMH A;  4FNV A;  1NSV A;  3OBA A;  2XHN A;  1NS4 A;  2ZXQ A;  1HN0 A;  4J5T A;  1HM2 A;  4BZE A;  1NSX A;  3I3B A;  3VSM A;  1NS7 A;  3DYP A;  1JZ2 A;  3VD4 A;  2WZS A;  1PX4 A;  2WVY A;  3MWX A;  1JYV A;  4OK2 A;  1J0M A;  1MMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...