1NS8A

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with galactose
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGINHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 95
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns8A00
3NJXA 1RWHA 2WW2A 1NSMA 1X1IA 2JKPA 1TXKA 1NS7A 1PX3A 4DUWA 3T0BA 3OB8A 1F9GA 3J7HA 1MMXA 3MV01 1MMUA 1ULVA 3VD9A 1F4AA 1JYWA 1YGAA 1OJNA 1JOVA 1NKGA 2HTAA 1MN0A 1NSXA 2CIRA 1N7OA 3I3BA 2WW0A 1HMWA 2WZSA 2WVXB 2BRVX 1YQ2A 4RNLA 1HN1A 1JZ4A 1HM3A 1MMYA 3DYMA 1JYXA 2ZQ0A 1CB8A 1LURA 1LXMA 1RWCA 3IMHA 2WDAA 3ECQA 4TTGA 1RWGA 1K1XA 2XSGA 1JYNA 1J0NA 2CISA 1LOHA 3VDAA 1NSVA 1LXKA 1NSZA 3I3DA 4AQ0A 2CIQA 2JKAA 1J0MA 1HMUA 1JYVA 2Q1FA 1F1SA 2HTBA 1W3YA 3BGAA 3MUZ1 5E1QA 3SEPA 1NS0A 1RWFA 2WCOA 2XHNA 1EGUA 1X1JA 3IAQA 3DCDA 3DYPA 2WVXA 3A24A 3MV11 1L7KA 1L7JA 2JKEA 4BZGA 4BZHA 1LF6A 3CZJA 1JZ5A 3VD5A 1OJMA 2D73A 1JZ7A 1OJOA 3NREA 1NSSA 3I3EA 4BZFA 1NS4A 3VDBA 1K1YA 3VD4A 3T09A 3NJVA 2ZXQA 1NS2A 3T0DA 1DP0A 2BRWA 2BRPA 2E24A 1SNZA 1I8QA 1Z45A 1NSUA 1X1HA 2WVYA 1PX4A 3WFAA 3OBAA 1SO0A 1N7NA 1K1WA 3IAPA 3OS7A 1JZ6A 1C82A 3T2OA 3T0AA 4DUXA 2WVZA 4BZEA 3T2PA 1MMZA 3VD7A 2WW3A 1RW9A 1JZ8A 1OJPA 1F4HA 3Q1NA 3MWXA 2WW1A 1N7PA 3E1F1 1UG9A 2E22A 1LF9A 1NS8A 1JZ2A 1RWAA 3DECA 3T08A 3T2QA 3VD3A 2X03A 1NSRA 1N7RA 1JZ3A 1HN0A 5A1AA 1N7QA 3MUY1 3K25A 3VDCA 4DUVA 1HM2A 3DYOA
chains in the Genus database with same CATH superfamily
3W7TA 2WW2A 1X1IA 2JKPA 1NS7A 5GW7A 1R34A 2EADA 1MMUA 4NEIA 3QG0A 3VSNA 1F4AA 1NKGA 4KFEA 4MMIA 3I3BA 1N7OA 2CFDA 1WMOA 3AMOA 1HN1A 4FNVA 2ZQ0A 3CV5A 4FNRA 2WDAA 4TTGA 4KTPA 3HIIA 4EV5A 3WA3A 3BVWA 2CISA 1KSIA 1NSZA 3I3DA 4AQ0A 3X3ZA 3NBBA 1W6CA 3BUDA 3D51A 3W7XA 2HTBA 3BGAA 3X41A 3SEPA 2XHNA 1X1JA 3DCDA 3DYPA 3A24A 3MV11 1L7KA 1W7CA 1JZ5A 1IVVA 2D73A 1AV4A 1NSSA 1NS4A 3T09A 2ZXQA 1TQUA 1SPUA 1TQVA 4FNTA 3KN4A 3E80A 1I8QA 1Z45A 3WFAA 3EJTA 3OS7A 5KBPA 3T0AA 3T2PA 3VD7A 1V7XA 1RW9A 1JZ8A 2BT3A 2F18A 1F4HA 2WOFA 3MWXA 3WA2X 2E22A 1IVXA 2CFLA 3RRSA 1D6ZA 4FNUA 3BS6A 4BTYA 3VD3A 2X03A 1JZ3A 5A1AA 3DDFA 2CWVA 3MUY1 3K25A 3VDCA 1N9EA 2ZL8A 1PS3A 1TU5A 1AVKA 3QFZA 3HIGA 3NJXA 1RWHA 2CQTA 1LVNA 3OB8A 1F9GA 3X42A 3S4BA 1JYWA 1JOVA 1MN0A 2CQSA 3BUIA 2CFGA 3MPHA 3ACTA 2WW0A 1HMWA 3D3IA 2WVXB 2BRVX 3EJPA 2WO0A 3NBJA 4BTXA 1TQWA 4OJZA 3DYMA 1CB8A 1LXMA 1UI8A 2Y74A 3WIRA 1UI7A 3BVTA 1K1XA 3KIIA 1IU7A 1JYNA 1QWNA 3CZNA 2CIQA 3BUPA 3CZSA 1JYVA 2Q1FA 1F1SA 3QDEA 1RJOA 1NS0A 1RWFA 2WCOA 1EGUA 1W2ZA 3IAQA 2WVXA 2CG0A 3CZJA 2F1BA 1O7DD 3VD5A 5JMDA 1JZ7A 1OJOA 4BZFA 2FUTA 3VD4A 2OQEA 3T0DA 2E24A 1NSUA 1X1HA 2WVYA 3S4DA 2F7PA 2WGQA 1QALA 1MMZA 2EACA 1D6YA 3DX2A 2OOVC 3DX0A 1W4NA 2CFWA 3DX3A 1UG9A 1LF9A 2YFNA 3BVVA 2F1AA 1JZ2A 2OOVA 3T2QA 3D52A 2OW7A 3LVTA 2FYVA 2XN2A 2OQEC 4DUWA 3T0BA 4K35A 2F7RA 3J7HA 1MMXA 3SXXA 4KFDA 1YGAA 1OJNA 3DX1A 4KFFA 2CIRA 4FNQA 3TY1A 3AFLA 4FNSA 1YQ2A 4RNLA 1LURA 1RWCA 1US1A 3ECQA 1RWGA 1QAFA 2WYIA 1LOHA 3X40A 1NSVA 3AFJA 3S4AA 1LXKA 1W5ZA 3DX4A 1WMNA 3DDGA 4MMHA 4UFCA 3D50A 3E7JA 2CFKA 1QWUA 1W3YA 1A2VA 3PGBA 2WYHA 1H54A 1LF6A 1L7JA 2JKEA 4BZGA 4BZHA 1AVLA 1QX1A 3QFYA 4KTRA 1IQXA 1OJMA 1SIIA 3X3YA 3BUQA 3EJUA 1K1YA 4K3AA 3NJVA 1QAKA 3LOYA 2F7QA 2BRPA 1RKYA 1SNZA 3SX1A 1PX4A 2D1WA 3OBAA 2EAEA 3IAPA 1C82A 3T2OA 2WVZA 4BZEA 3MI6A 3Q1NA 5JMFA 1N7PA 3W7UA 3E1F1 2XN0A 1WMPA 3BUBA 3DECA 3ACSA 1V7VA 1HTYA 3BLBA 2ALWA 3BLCA 1HN0A 3WVFA 3S4CA 4DUVA 1HM2A 3BVUA 2E2UA 2WOHA 1NSMA 1TXKA 1PX3A 1TQSA 2Y73A 2YX9A 3MV01 4OK4A 1ULVA 3VD9A 2E2VA 5CA3A 1W6GA 2OW6A 4EV2A 1HWWA 2PNCA 2FUQA 2HTAA 2CG1A 1D6UA 1NSXA 1TQTA 2C10A 2WZSA 1JZ4A 1HM3A 1MMYA 1JRQA 2E2TA 1JYXA 2YFOA 3IMHA 4OK2A 2XN1A 3AMOB 2XSGA 1J0NA 3VDAA 3WIQA 1V7WA 3T0UA 2W0QA 3ALAA 2JKAA 1J0MA 1HMUA 3MUZ1 5E1QA 1IQYA 2CWTA 2EABA 3VSMA 3RSYA 3NREA 3I3EA 3VDBA 1IVUA 1PU4A 1NS2A 3EJQA 3W7WA 3D4YA 3EJSA 1DP0A 3BVXA 3X3XA 1IVWA 2BRWA 1SO0A 1N7NA 1K1WA 1JZ6A 4BTWA 4DUXA 2CWUA 3EJRA 2WW3A 2RDYA 1OJPA 4FNPA 1HXKA 2WW1A 3HI7A 2C11A 3A0OA 1DYUA 1R33A 3D4ZA 1NS8A 1RWAA 3T08A 1NSRA 1N7RA 1OACA 1SIHA 4J5TA 3N9HA 1N7QA 1EKMA 3K5TA 3W7SA 3DYOA 2F7OA
chains in the Genus database with same CATH topology
3NJXA 1RWHA 2WW2A 1NSMA 1X1IA 2JKPA 1TXKA 1NS7A 1PX3A 4DUWA 3T0BA 3OB8A 1F9GA 3J7HA 1MMXA 3MV01 1MMUA 4OK4A 1ULVA 4NEIA 3VD9A 3VSNA 1F4AA 1JYWA 1YGAA 1OJNA 1JOVA 1NKGA 2FUQA 2HTAA 1MN0A 4MMIA 1NSXA 2CIRA 1N7OA 3I3BA 3AFLA 2WW0A 3TY1A 1HMWA 2WZSA 2WVXB 2BRVX 1YQ2A 4RNLA 1HN1A 1JZ4A 1HM3A 4FNVA 4OJZA 1MMYA 3DYMA 1JYXA 2ZQ0A 1CB8A 1LURA 1LXMA 1RWCA 3IMHA 4OK2A 2WDAA 3ECQA 4TTGA 1RWGA 1K1XA 2XSGA 1JYNA 1J0NA 2CISA 1LOHA 3VDAA 1NSVA 1LXKA 1NSZA 3I3DA 4AQ0A 2CIQA 4MMHA 2JKAA 1J0MA 1HMUA 3E7JA 1JYVA 2Q1FA 1F1SA 2HTBA 1W3YA 3BGAA 3MUZ1 5E1QA 3SEPA 1NS0A 1RWFA 2WCOA 2XHNA 1EGUA 1X1JA 3IAQA 3DCDA 3DYPA 2WVXA 3A24A 3MV11 1L7KA 1L7JA 2JKEA 4BZGA 4BZHA 1LF6A 3CZJA 1JZ5A 3VSMA 3VD5A 5JMDA 1OJMA 2D73A 1JZ7A 1OJOA 3NREA 1NSSA 3I3EA 4BZFA 1NS4A 2FUTA 3VDBA 1K1YA 3VD4A 3T09A 3NJVA 2ZXQA 1NS2A 3T0DA 1DP0A 2BRWA 2BRPA 2E24A 3E80A 1SNZA 1I8QA 1Z45A 1NSUA 1X1HA 2WVYA 1PX4A 3WFAA 3OBAA 1SO0A 1N7NA 1K1WA 3IAPA 3OS7A 1JZ6A 1C82A 3T2OA 3T0AA 4DUXA 2WVZA 4BZEA 3T2PA 1MMZA 3VD7A 2WW3A 1RW9A 1JZ8A 1OJPA 1F4HA 3Q1NA 5JMFA 3MWXA 2WW1A 1N7PA 3E1F1 1UG9A 3A0OA 2E22A 1LF9A 1NS8A 1JZ2A 3BS6A 1RWAA 3DECA 3T08A 3T2QA 3VD3A 2X03A 1NSRA 1N7RA 1JZ3A 3BLCA 1HN0A 4J5TA 3WVFA 5A1AA 1N7QA 3MUY1 3K25A 3VDCA 4DUVA 1HM2A 3DYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NJX A;  1RWH A;  2WW2 A;  1NSM A;  1X1I A;  2JKP A;  1TXK A;  1NS7 A;  1PX3 A;  4DUW A;  3T0B A;  3OB8 A;  1F9G A;  3J7H A;  1MMX A;  3MV0 1;  1MMU A;  1ULV A;  3VD9 A;  1F4A A;  1JYW A;  1YGA A;  1OJN A;  1JOV A;  1NKG A;  2HTA A;  1MN0 A;  1NSX A;  2CIR A;  1N7O A;  3I3B A;  2WW0 A;  1HMW A;  2WZS A;  2WVX B;  2BRV X;  1YQ2 A;  4RNL A;  1HN1 A;  1JZ4 A;  1HM3 A;  1MMY A;  3DYM A;  1JYX A;  2ZQ0 A;  1CB8 A;  1LUR A;  1LXM A;  1RWC A;  3IMH A;  2WDA A;  3ECQ A;  4TTG A;  1RWG A;  1K1X A;  2XSG A;  1JYN A;  1J0N A;  2CIS A;  1LOH A;  3VDA A;  1NSV A;  1LXK A;  1NSZ A;  3I3D A;  4AQ0 A;  2CIQ A;  2JKA A;  1J0M A;  1HMU A;  1JYV A;  2Q1F A;  1F1S A;  2HTB A;  1W3Y A;  3BGA A;  3MUZ 1;  5E1Q A;  3SEP A;  1NS0 A;  1RWF A;  2WCO A;  2XHN A;  1EGU A;  1X1J A;  3IAQ A;  3DCD A;  3DYP A;  2WVX A;  3A24 A;  3MV1 1;  1L7K A;  1L7J A;  2JKE A;  4BZG A;  4BZH A;  1LF6 A;  3CZJ A;  1JZ5 A;  3VD5 A;  1OJM A;  2D73 A;  1JZ7 A;  1OJO A;  3NRE A;  1NSS A;  3I3E A;  4BZF A;  1NS4 A;  3VDB A;  1K1Y A;  3VD4 A;  3T09 A;  3NJV A;  2ZXQ A;  1NS2 A;  3T0D A;  1DP0 A;  2BRW A;  2BRP A;  2E24 A;  1SNZ A;  1I8Q A;  1Z45 A;  1NSU A;  1X1H A;  2WVY A;  1PX4 A;  3WFA A;  3OBA A;  1SO0 A;  1N7N A;  1K1W A;  3IAP A;  3OS7 A;  1JZ6 A;  1C82 A;  3T2O A;  3T0A A;  4DUX A;  2WVZ A;  4BZE A;  3T2P A;  1MMZ A;  3VD7 A;  2WW3 A;  1RW9 A;  1JZ8 A;  1OJP A;  1F4H A;  3Q1N A;  3MWX A;  2WW1 A;  1N7P A;  3E1F 1;  1UG9 A;  2E22 A;  1LF9 A;  1NS8 A;  1JZ2 A;  1RWA A;  3DEC A;  3T08 A;  3T2Q A;  3VD3 A;  2X03 A;  1NSR A;  1N7R A;  1JZ3 A;  1HN0 A;  5A1A A;  1N7Q A;  3MUY 1;  3K25 A;  3VDC A;  4DUV A;  1HM2 A;  3DYO A; 
#chains in the Genus database with same CATH topology
 3W7T A;  2WW2 A;  1X1I A;  2JKP A;  1NS7 A;  5GW7 A;  1R34 A;  2EAD A;  1MMU A;  4NEI A;  3QG0 A;  3VSN A;  1F4A A;  1NKG A;  4KFE A;  4MMI A;  3I3B A;  1N7O A;  2CFD A;  1WMO A;  3AMO A;  1HN1 A;  4FNV A;  2ZQ0 A;  3CV5 A;  4FNR A;  2WDA A;  4TTG A;  4KTP A;  3HII A;  4EV5 A;  3WA3 A;  3BVW A;  2CIS A;  1KSI A;  1NSZ A;  3I3D A;  4AQ0 A;  3X3Z A;  3NBB A;  1W6C A;  3BUD A;  3D51 A;  3W7X A;  2HTB A;  3BGA A;  3X41 A;  3SEP A;  2XHN A;  1X1J A;  3DCD A;  3DYP A;  3A24 A;  3MV1 1;  1L7K A;  1W7C A;  1JZ5 A;  1IVV A;  2D73 A;  1AV4 A;  1NSS A;  1NS4 A;  3T09 A;  2ZXQ A;  1TQU A;  1SPU A;  1TQV A;  4FNT A;  3KN4 A;  3E80 A;  1I8Q A;  1Z45 A;  3WFA A;  3EJT A;  3OS7 A;  5KBP A;  3T0A A;  3T2P A;  3VD7 A;  1V7X A;  1RW9 A;  1JZ8 A;  2BT3 A;  2F18 A;  1F4H A;  2WOF A;  3MWX A;  3WA2 X;  2E22 A;  1IVX A;  2CFL A;  3RRS A;  1D6Z A;  4FNU A;  3BS6 A;  4BTY A;  3VD3 A;  2X03 A;  1JZ3 A;  5A1A A;  3DDF A;  2CWV A;  3MUY 1;  3K25 A;  3VDC A;  1N9E A;  2ZL8 A;  1PS3 A;  1TU5 A;  1AVK A;  3QFZ A;  3HIG A;  3NJX A;  1RWH A;  2CQT A;  1LVN A;  3OB8 A;  1F9G A;  3X42 A;  3S4B A;  1JYW A;  1JOV A;  1MN0 A;  2CQS A;  3BUI A;  2CFG A;  3MPH A;  3ACT A;  2WW0 A;  1HMW A;  3D3I A;  2WVX B;  2BRV X;  3EJP A;  2WO0 A;  3NBJ A;  4BTX A;  1TQW A;  4OJZ A;  3DYM A;  1CB8 A;  1LXM A;  1UI8 A;  2Y74 A;  3WIR A;  1UI7 A;  3BVT A;  1K1X A;  3KII A;  1IU7 A;  1JYN A;  1QWN A;  3CZN A;  2CIQ A;  3BUP A;  3CZS A;  1JYV A;  2Q1F A;  1F1S A;  3QDE A;  1RJO A;  1NS0 A;  1RWF A;  2WCO A;  1EGU A;  1W2Z A;  3IAQ A;  2WVX A;  2CG0 A;  3CZJ A;  2F1B A;  1O7D D;  3VD5 A;  5JMD A;  1JZ7 A;  1OJO A;  4BZF A;  2FUT A;  3VD4 A;  2OQE A;  3T0D A;  2E24 A;  1NSU A;  1X1H A;  2WVY A;  3S4D A;  2F7P A;  2WGQ A;  1QAL A;  1MMZ A;  2EAC A;  1D6Y A;  3DX2 A;  2OOV C;  3DX0 A;  1W4N A;  2CFW A;  3DX3 A;  1UG9 A;  1LF9 A;  2YFN A;  3BVV A;  2F1A A;  1JZ2 A;  2OOV A;  3T2Q A;  3D52 A;  2OW7 A;  3LVT A;  2FYV A;  2XN2 A;  2OQE C;  4DUW A;  3T0B A;  4K35 A;  2F7R A;  3J7H A;  1MMX A;  3SXX A;  4KFD A;  1YGA A;  1OJN A;  3DX1 A;  4KFF A;  2CIR A;  4FNQ A;  3TY1 A;  3AFL A;  4FNS A;  1YQ2 A;  4RNL A;  1LUR A;  1RWC A;  1US1 A;  3ECQ A;  1RWG A;  1QAF A;  2WYI A;  1LOH A;  3X40 A;  1NSV A;  3AFJ A;  3S4A A;  1LXK A;  1W5Z A;  3DX4 A;  1WMN A;  3DDG A;  4MMH A;  4UFC A;  3D50 A;  3E7J A;  2CFK A;  1QWU A;  1W3Y A;  1A2V A;  3PGB A;  2WYH A;  1H54 A;  1LF6 A;  1L7J A;  2JKE A;  4BZG A;  4BZH A;  1AVL A;  1QX1 A;  3QFY A;  4KTR A;  1IQX A;  1OJM A;  1SII A;  3X3Y A;  3BUQ A;  3EJU A;  1K1Y A;  4K3A A;  3NJV A;  1QAK A;  3LOY A;  2F7Q A;  2BRP A;  1RKY A;  1SNZ A;  3SX1 A;  1PX4 A;  2D1W A;  3OBA A;  2EAE A;  3IAP A;  1C82 A;  3T2O A;  2WVZ A;  4BZE A;  3MI6 A;  3Q1N A;  5JMF A;  1N7P A;  3W7U A;  3E1F 1;  2XN0 A;  1WMP A;  3BUB A;  3DEC A;  3ACS A;  1V7V A;  1HTY A;  3BLB A;  2ALW A;  3BLC A;  1HN0 A;  3WVF A;  3S4C A;  4DUV A;  1HM2 A;  3BVU A;  2E2U A;  2WOH A;  1NSM A;  1TXK A;  1PX3 A;  1TQS A;  2Y73 A;  2YX9 A;  3MV0 1;  4OK4 A;  1ULV A;  3VD9 A;  2E2V A;  5CA3 A;  1W6G A;  2OW6 A;  4EV2 A;  1HWW A;  2PNC A;  2FUQ A;  2HTA A;  2CG1 A;  1D6U A;  1NSX A;  1TQT A;  2C10 A;  2WZS A;  1JZ4 A;  1HM3 A;  1MMY A;  1JRQ A;  2E2T A;  1JYX A;  2YFO A;  3IMH A;  4OK2 A;  2XN1 A;  3AMO B;  2XSG A;  1J0N A;  3VDA A;  3WIQ A;  1V7W A;  3T0U A;  2W0Q A;  3ALA A;  2JKA A;  1J0M A;  1HMU A;  3MUZ 1;  5E1Q A;  1IQY A;  2CWT A;  2EAB A;  3VSM A;  3RSY A;  3NRE A;  3I3E A;  3VDB A;  1IVU A;  1PU4 A;  1NS2 A;  3EJQ A;  3W7W A;  3D4Y A;  3EJS A;  1DP0 A;  3BVX A;  3X3X A;  1IVW A;  2BRW A;  1SO0 A;  1N7N A;  1K1W A;  1JZ6 A;  4BTW A;  4DUX A;  2CWU A;  3EJR A;  2WW3 A;  2RDY A;  1OJP A;  4FNP A;  1HXK A;  2WW1 A;  3HI7 A;  2C11 A;  3A0O A;  1DYU A;  1R33 A;  3D4Z A;  1NS8 A;  1RWA A;  3T08 A;  1NSR A;  1N7R A;  1OAC A;  1SIH A;  4J5T A;  3N9H A;  1N7Q A;  1EKM A;  3K5T A;  3W7S A;  3DYO A;  2F7O A; 
#chains in the Genus database with same CATH homology
 3NJX A;  1RWH A;  2WW2 A;  1NSM A;  1X1I A;  2JKP A;  1TXK A;  1NS7 A;  1PX3 A;  4DUW A;  3T0B A;  3OB8 A;  1F9G A;  3J7H A;  1MMX A;  3MV0 1;  1MMU A;  4OK4 A;  1ULV A;  4NEI A;  3VD9 A;  3VSN A;  1F4A A;  1JYW A;  1YGA A;  1OJN A;  1JOV A;  1NKG A;  2FUQ A;  2HTA A;  1MN0 A;  4MMI A;  1NSX A;  2CIR A;  1N7O A;  3I3B A;  3AFL A;  2WW0 A;  3TY1 A;  1HMW A;  2WZS A;  2WVX B;  2BRV X;  1YQ2 A;  4RNL A;  1HN1 A;  1JZ4 A;  1HM3 A;  4FNV A;  4OJZ A;  1MMY A;  3DYM A;  1JYX A;  2ZQ0 A;  1CB8 A;  1LUR A;  1LXM A;  1RWC A;  3IMH A;  4OK2 A;  2WDA A;  3ECQ A;  4TTG A;  1RWG A;  1K1X A;  2XSG A;  1JYN A;  1J0N A;  2CIS A;  1LOH A;  3VDA A;  1NSV A;  1LXK A;  1NSZ A;  3I3D A;  4AQ0 A;  2CIQ A;  4MMH A;  2JKA A;  1J0M A;  1HMU A;  3E7J A;  1JYV A;  2Q1F A;  1F1S A;  2HTB A;  1W3Y A;  3BGA A;  3MUZ 1;  5E1Q A;  3SEP A;  1NS0 A;  1RWF A;  2WCO A;  2XHN A;  1EGU A;  1X1J A;  3IAQ A;  3DCD A;  3DYP A;  2WVX A;  3A24 A;  3MV1 1;  1L7K A;  1L7J A;  2JKE A;  4BZG A;  4BZH A;  1LF6 A;  3CZJ A;  1JZ5 A;  3VSM A;  3VD5 A;  5JMD A;  1OJM A;  2D73 A;  1JZ7 A;  1OJO A;  3NRE A;  1NSS A;  3I3E A;  4BZF A;  1NS4 A;  2FUT A;  3VDB A;  1K1Y A;  3VD4 A;  3T09 A;  3NJV A;  2ZXQ A;  1NS2 A;  3T0D A;  1DP0 A;  2BRW A;  2BRP A;  2E24 A;  3E80 A;  1SNZ A;  1I8Q A;  1Z45 A;  1NSU A;  1X1H A;  2WVY A;  1PX4 A;  3WFA A;  3OBA A;  1SO0 A;  1N7N A;  1K1W A;  3IAP A;  3OS7 A;  1JZ6 A;  1C82 A;  3T2O A;  3T0A A;  4DUX A;  2WVZ A;  4BZE A;  3T2P A;  1MMZ A;  3VD7 A;  2WW3 A;  1RW9 A;  1JZ8 A;  1OJP A;  1F4H A;  3Q1N A;  5JMF A;  3MWX A;  2WW1 A;  1N7P A;  3E1F 1;  1UG9 A;  3A0O A;  2E22 A;  1LF9 A;  1NS8 A;  1JZ2 A;  3BS6 A;  1RWA A;  3DEC A;  3T08 A;  3T2Q A;  3VD3 A;  2X03 A;  1NSR A;  1N7R A;  1JZ3 A;  3BLC A;  1HN0 A;  4J5T A;  3WVF A;  5A1A A;  1N7Q A;  3MUY 1;  3K25 A;  3VDC A;  4DUV A;  1HM2 A;  3DYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...