4FNUA

Crystal structure of gh36 alpha-galactosidase agaa a355e d478a from geobacillus stearothermophilus in complex with stachyose
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWAMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELMYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 196
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnuA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnuA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnuA02
3QW3A 3B0VC 3NO5A 1M53A 1ZENA 1GVOA 1H7XA 2QCGA 3G18A 1UH2A 2G3MA 4ZQNA 4Z1BA 2I1OA 3SIZA 3VE7A 2WSRA 3B0PA 3M44A 1S5TA 3TJLA 3GAKA 4IPIA 1OGSA 3PR2A 3BVVA 2Z1KA 1SZEA 2R14A 5HWMA 1DKWA 4FX6M 2WNWA 2QEZA 3WY1A 3N9SA 3GDLA 3WNPA 1PIIA 4HSNA 4UTKA 3U6WA 4MY1A 4TVUA 2Y89A 2OSXA 4B5NA 3EDEA 1AW2A 3BUBA 3QC3A 3LLFA 1I45A 2XN0A 3O63A 3KVJA 2WPBA 3R5EA 3HG2A 4HNVA 3M5ZA 2EAWA 3WNMA 2WPGA 2ZX6A 2E5BA 1C8QA 4WOZA 3G0UA 1X7FA 4K7YA 1GYNA 2WV8A 3LHZA 1TMQA 3GXFA 3STGA 1M6JA 2OSWA 2Y2WA 2GUUA 2X1TA 5KITA 1UJPA 2X1UA 3HPXA 5K4ZA 1E40A 2YDAA 2YCEA 3VGEA 4NJGA 3QSRA 4FX7A 1DTUA 2FGZA 1OHLA 5CGTA 5FESA 3DHUA 3VE9A 2EKCA 3WK1A 2YFNA 4MAZA 2CLOA 4PC8A 4BI5A 5LNVA 5D03A 3L0KA 1MO0A 4Z0SA 1W5OA 1EUAA 2E09A 2EGZA 2HS8A 3QGVA 5AHEA 4DF1A 3PG8A 3HZ3A 1ME7A 4O10A 2WC7A 1FCBA 1WA3A 1WQ5A 3EX1A 3KE0A 2J6XA 1QI4A 1TQSA 5LNUA 4JFUA 2QPSA 3L4XA 2J24A 5HJLA 1TQVA 1WX0A 1FCVA 3N9RA 4LC8A 5AN7A 1UD2A 1VYRA 2VEIA 1SSGA 1KV8A 1H1YA 1DORA 2WSYA 3OG3A 4N9EA 1EA0A 4HA1A 3QFEA 1G4TA 3CEPA 3HPZA 3SFKA 3RILA 3MBDA 2PURA 3HOJA 1QI3A 1YDNA 4PTNA 3QMTA 5CLWA 3LOTA 3SZ8A 4X9YA 3IIZA 5H91A 4K8HA 1LWJA 3M6YA 1L6WA 1GVRA 3VNYA 5DBUA 3VFLA 5CPLA 1SO5A 2PCQA 2DIJA 3LPPA 2E68A 4C1KA 4QJ1A 1B2YA 1TPWA 2G95A 1GTEA 2QJGA 3W76A 1ZS2A 2C0AA 1TRIA 1WOBA 4O18A 4JS3A 1JCNA 1TV7A 4BK9A 4OJYA 3BSHA 3STFA 2V81A 2PRLA 3W38A 4WSKA 4PODA 3N34A 5FF0A 3MW7A 3NL6A 3GBEA 3MI6A 1SMAA 3BAJA 4ADUA 1QPOA 3NPVA 4X0NA 2BHUA 3M43A 3IJ9A 3W07A 1MEHA 1P6WA 5HULA 2A85A 3EXSA 3NQMA 1GCYA 2YSWA 4WXYA 3PUDA 4XTDA 3TAKA 1JUEA 2C1HA 2EHHA 2XN1A 1X1OA 3DFOA 4TMBA 5FI8A 3WK3A 4UTTC 4KKXA 3HPSA 4U28A 5J5RA 1TMHA 2JBMA 4J3VA 4N6EA 2ZBTA 3CEUA 3DX0A 3WEMA 4AXKA 5U4NA 3R89A 4CCCA 4CCDA 1IXPA 3RIKA 1W5QA 1DEDA 3GXMA 4FLQA 1FWSA 2NWSA 1U83A 4O1BA 4N6FA 4GINA 4ORIA 4O16A 1JGIA 2QCDA 3EWXA 3A22A 1LOQA 4JDYA 3EKZA 3P7YA 2ATSA 1LBMA 4J3UA 3P8IA 3PF3A 4ZQPA 4PSPA 3O1NA 1G9HA 3QW4B 1FXPA 2ZDRA 2ZZ2A 3MJYA 2Z0IA 3LB0A 3TUUA 3NQ7A 1PZ3A 7TIMA 2YFOA 3SSJA 2V3FA 2CLHA 1R2RA 3CIXA 3S9YA 2CXGA 4JX4A 1TJPA 3O06A 5L9FA 1RVGA 4J3SA 3NDOA 4WD0A 4Y8FA 1XM3A 4U2ZA 2F7FA 4CQ9A 4UQAA 3WJWA 3NL5A 2BY2A 3C6CA 3P60A 4M8UA 1O95A 5CSSA 1SZGA 4GO9A 3QEZA 3H55A 3TNOA 3WJXA 3VGGA 2GJLA 1CLVA 1DJQA 1H50A 1K3UA 3WNLA 4MLJA 2Y85A 3NGJA 2ZCGA 4KWWA 3F4WA 4J7RA 2YXGA 3PS7A 4QISA 3HF3A 3JRKA 4FXSA 3UXDA 1UD8A 4UTJA 1OABA 3S2CA 3R8RA 3WJZA 1XKYA 3C61A 3O6DA 3DBPA 3KOFA 3TU9A 1Q45A 3JR2A 3UPBA 4AW7A 1SO3A 2W79A 2V9DA 4IXXA 3W70A 4MFEA 1ZY9A 2J9XA 4EVZA 4JTLA 3BO9A 4QNWA 2YA2A 2QCEA 4AIEA 4H7VA 5KTLA 5HUOA 1ICPA 1LOSA 4O15A 4M56A 1MEWA 4CLMA 1TPDA 3Q37A 4E38A 5CGMA 3ABSA 4UTHA 3CLMA 1A5SA 3C4UA 3I68A 3A21A 3BG9A 2QDGA 4IXHA 1PPIA 4GKLA 3RU6A 3VGBA 3K30A 4FNQA 2H90A 1W0MA 4LPCA 2VRQA 1HWWA 3LRLA 4CNPA 1W5NA 1TPH1 3D52A 3L21A 3P74A 2V30A 3AXHA 3UWYA 1K7FA 5I3FA 2NX3A 5K9CA 1UASA 1K02A 1U5JA 5HNRA 4XB3A 3S0CA 1P4CA 1OFOA 4JTIA 3UZJA 1TPEA 2A2IA 4GWEA 3CB8A 4OHQA 5AYZA 4K6AA 1J5TA 4P2VA 1VJIA 5HR6A 4O1CA 4OT7A 5EA9A 1LLZA 4KWUA 3QRHA 4S1FA 3P62A 2VNCA 1HNYA 1IF2A 2OYKA 3OVPA 1H5YA 5AHNA 2XWDA 4UFKA 2QMKA 1QO2A 1L0PA 4FLRA 2E6YA 3P84A 5K3VA 2QCFA 4OKDA 4TX9A 2NZLA 3NAVA 5AC7A 1WV2A 1THFD 1PIGA 2F7QA 3LXBA 1GPWA 1ZHAA 1I8JA 1OF6A 3S42A 2E6DA 5H2ZA 5HR7A 3KXQA 5CPOA 1CGWA 4XKYB 3C2FA 2CZ5A 2CZFA 4BWLC 3FAWA 3FYOA 3V1PA 3NQVA 3BCFA 2ZA3A 2H8ZA 3IIOA 5DELA 1JCYA 3GAYA 5G2HA 3L4VA 2X1SA 1KTNA 3T40A 2H6RA 4JN6A 2A5HA 2QMJA 1S5VA 1S5WA 3G1FA 3C56A 3M5VA 4R34A 3TFXA 1W8SA 2JGQA 4AYSA 3FJ6A 1S3HA 2X2JA 4M19A 4M6PA 4DF0A 4JTGA 5D04C 3P67A 1H7RA 2V3DA 4ATWA 3WJSA 1PCWA 1A47A 2Y62A 3PG9A 4MJMA 1W54A 1JJKA 4IMDA 2F2HA 4ORMA 4LVBA 4JYEA 4WUIA 4JIPA 3BC9A 3EDKA 4MKNA 1VRDA 4Q32A 1XBXA 1OFAA 1HO4A 3EJSA 1KV5A 1IGSA 3BUIA 4MIMA 2GJNA 1G4EA 1TQXA 3RNDA 4O54A 1VZWA 1WZAA 3BG5A 4XTIA 3ECQA 3TFCA 2Z2UA 2Z6JA 1LBFA 4S2BA 3NM1A 1LZOA 2V2DA 1VFUA 4A21A 3UWQA 1AVAA 3BW3A 1PE1A 1AL7A 1RP9A 2FHFA 3CGTA 4EWND 2NSXA 2WSKA 4HP5A 3ZWSA 1PL9A 2E5CA 4H8VA 4QNEA 3W1AA 1LM1A 1OFBA 3F1QA 4FMVA 5AHFA 3KVMA 3WK0A 2FIQA 3U8GA 1Q6RA 4OV9A 1VJSA 2JKEA 1BSIA 3KVLA 4AIOA 4JX5A 1R33A 3OBKA 4LU0A 4ZQRA 1QOPA 3T78A 2PRHA 4PEKA 1GYLA 3PUEA 3KL3A 2GPTA 4IX2A 5TBOA 3Q94A 3BLEA 2F7RA 4HNNA 4AMXA 3SR7A 3BAKA 5F2IA 1I75A 1XV8A 2ZX9A 5CLTA 1H7NA 1HVXA 1K8XA 1PZ2A 3P5YA 1VLWA 2RHGA 1VC4A 1FDZA 2Y5EA 1UCWA 4CN4A 3M41A 4AWSA 3K1DA 3W7GA 5E93A 1V5XA 3THAA 3CZGA 4UTLA 1GZGA 4O1DA 1QHOA 5D09A 3QYQA 3CV5A 3BCDA 5G5IA 3TXVA 4DBEA 1GVIA 5E0FA 1ZAJA 2WSQA 2QJHA 3TC7A 1SSDA 3O05A 3W1XA 1Q6LA 3NQAA 2D73A 2G96A 4D2JA 1OX4A 5D2TA 1XSKA 3M5YA 3B04A 2XVKA 3CQ0A 1FWTA 2CU0A 1EH9A 4AEFA 2DZXA 3HIJA 3BGJA 1CDGA 4JFSA 2ZRVA 1W56A 1F74A 3BPWA 1EP1A 1GWJA 5EPDA 3A5FA 3R13A 5K9XA 5E1QA 3C8FA 1QWNA 1Z32X 1G6CA 2E5DA 2Y61A 4O53A 5G4EA 5EYWA 2B7PA 3OHIA 2VFHA 5CZJA 1NVMA 2Y7GA 3DH7A 3F4NA 5AC8A 1OJXA 3EJTA 1HO1A 3L4WA 1EEPA 1XC4A 1QPKA 3S6DA 4RR4A 1JR1A 4KMQA 4M6QA 3LDVA 5E6ZA 3W7HA 3C2EA 1I2NA 2XIIA 1G94A 1BVNP 4FNSA 3STEA 2Q3OA 5T26A 1A5AA 4HSOA 3MI2A 5MHBA 1XCXA 1TTIA 2WCGA 1KB3A 1HG3A 1NF0A 1NM9A 3DFNA 4PCFA 3WY4A 2TMDA 1GOXA 3GDTA 4N2YA 2FB3A 3FYPA 2I9EA 1A5CA 3TCEA 1ML1A 3T7VA 3A9IA 2ZYFA 2ZICA 1RP8A 1F2JA 1K7XA 1T0OA 3IJ8A 1CX9A 3TW7A 1CPUA 5AYYA 2EJ1A 1GJWA 2V2HA 4O4WA 1JF5A 3LPOA 5A6LA 1AL8A 5F2LA 3W84A 4GFSA 3G1DA 4FO4A 1L2UA 3UQNA 1L9WA 3LCGA 3NEVA 4H3DA 1SFLA 1VCFA 4O14A 3VX0A 5HDRA 1TQUA 1H51A 1JI1A 5I3GA 1QDSA 4Y96A 1B57A 1AQHA 3C2VA 3GR8A 1ZALA 5L6UA 3EWYA 3O07A 5AC6A 3ZSTA 1GG0A 2AAAA 3WFZA 1MXGA 3M0ZA 4QM1A 4NNBA 4U4MA 1OT1A 1KFKA 3THQA 1HL2A 4I9AA 1DBTA 2H3DA 5BRPA 3NYZA 1KM6A 2YW4A 4OU1A 1FUYA 3IK2A 3FOKA 4EIVA 1K03A 4MJZA 1N7KA 1QO5A 2C7FA 1QX1A 4ZMGA 5KINA 1CXFA 4K39A 3HB9A 4RJEA 4I7UA 3TQ0A 3PBVA 1FCUA 4FF7A 4GUGA 4OWGA 3FS2A 2GVGA 1AQMA 5CZ0A 1N8FA 1F76A 4R7JA 1U30A 1YPFA 4J9JA 4UMAA 4JIQA 3BAXA 2FH8A 4UOQA 1OF8A 4ML9A 4UZUA 1RQEA 1SR9A 1WYIA 3CZNA 4JYFA 3W7IA 1XSIA 3CZKA 3MHUA 1NOFA 5DO8A 1R47A 2O7QA 4GQQA 4XKYA 2JKPA 2W0UA 3W7JA 2WOQA 1LLWA 4N9BA 4O11A 5D05A 3WELA 3G1SA 5SWUA 5FEXA 2XWEA 3E02A 3L2MA 5KZDA 3EWWA 2NV2A 4JXCA 2G5WA 1BLIA 3UY7A 1R2SA 3NNTA 3DI0A 4CKQA 5AYXA 2BSLA 2NX9A 3NQFA 4MVAA 4GI8A 3BVWA 4CGTA 2ABAA 5IBXA 1G7UA 4LV4A 2GVLA 3TOPA 3LHVA 2A7PA 4JTTA 5DXXA 3W1TA 1TTQA 4LS0A 2WNQA 3TAOA 3W1NA 1C9DA 3E9AA 3A5VA 3MYOA 1EO7A 2OT0A 3S5YA 3WDJA 3EJQA 4DF2A 1DHKA 3L9CA 3NXFA 3W71A 2BXZA 3W9ZA 3LXCA 5DCDA 4UFMA 3S1UA 1W5PA 1KA9F 4H6KA 4K36A 4FHAA 4UFIA 1ZJBA 3NL3A 1J0HA 2ZXQA 1XCFA 1EO5A 2RH9A 3TSMA 4HNTA 1TPUA 1J0JA 1K7EA 1TTPA 3JS3A 4UZSA 5J5DA 2B7OA 4NNCA 2Y4SA 2WVTA 2A4AA 1JAEA 3CU2A 4PH6A 2ZFAA 3WFAA 5A6MA 1YADA 3OIXA 3HGOA 2NUXA 3GKFA 1KFCA 1KTBA 2Q3RA 4OBTA 4M5PA 5CGQA 2V5BA 3VGFA 3FKRA 4AF0B 1OX5A 1ZFJA 4LS1A 3TQKA 5I24A 1ZNNA 3MP5A 4E0CA 3W1RA 1UOKA 4O19A 3EJPA 1W3IA 2HSAA 3TR2A 2BHZA 1ONRA 2GVJA 4LRSA 1XUZA 2R8WA 2X2HA 3NQ8A 2GQ8A 3BGGA 1KBJA 2ZXAA 4FIRA 5LHEA 3R12A 3CIWA 3VNZA 4GI6A 2VR5A 1XDMA 1GQNA 1XUUA 1AMYA 2P0OA 1EHAA 1NFBA 4LNYA 3BG3A 1LDCA 3A4AA 2FFCA 2JKAA 4JFVA 3L4TA 2FHCA 2OW7A 1J2WA 2AAMA 1PIFA 1UBSA 3L0NA 3TA6A 5F4XA 4J27A 1XH2A 2QAPA 4CN6A 3AJXA 2WVSA 3LM7A 3L4UA 3P5ZA 1VQTA 4K8EA 3QJAA 1B9BA 5EY5A 4MOZA 3LHYA 1QW9A 1D9EA 4NT0A 3W7NA 2BXYA 1R75A 4MYAA 3E96A 2WANA 1FXQA 3D51A 2A7NA 3VMPA 1JUKA 4MUZA 4Z1AA 4FLSA 3MYPA 5BW6A 4GJ1A 5U7SA 1UA3A 3W7RA 3KHJA 3ATYA 3DZ1A 4GQRA 1IIHA 4XZ9A 4RXGA 4A2SA 5D02A 3GYEA 1TQTA 4YCPA 1KM4A 4C1LA 1KBBA 4HHPA 3TTYA 4POCA 1JFHA 1UA7A 1TO3A 3GNNA 3F03K 4NX5A 1OFPA 1YLVA 2V3EA 1SUXA 2QCMA 1H60A 1PV8A 3G3DA 1F5ZA 2V5LA 2TSYA 2VOMA 2CLMA 7CGTA 2EACA 2F18A 4LY8A 1CYGA 3IV3A 4AHPA 1DHPA 2IGTA 4JTHA 1U33A 3UWZA 3VI2A 3NA8A 3M1ZA 4HOXA 4K38A 2B0MA 1LBLA 3FKKA 3PUOA 2BTMA 4ALDA 5BNKA 2G3NA 3LHUA 4NJJA 1MXSA 3PSVA 4KFPA 3C52A 1O5XA 2DZPA 2D3NA 3Q2DA 3WMSA 4MY9A 1ZJAA 4RLIA 4B9YA 2ABBA 1H7PA 4NI3A 4UTWA 3ZR6A 2FPVA 3EWUA 3HQ1A 4UMBA 4NVTA 1LRTA 1NEYA 2A7RA 2YYTA 3LCWA 2YR1A 3L67A 3W7CA 2WVVB 4GNJA 2A0NA 3PWAA 3E49A 1ICQA 2WJZA 5LKYA 1G4PA 2DZWA 5TIMA 2NUYA 3IGXA 3W7LA 4UCGA 2ZRWA 2C15A 3M9YA 4GBUA 2PWEA 1YPIA 3P8JA 3ZQ9A 2PRMA 1YDVA 1ZAHA 4MZYA 4IUOA 1JF6A 4O8RA 1NSJA 1AG1O 4XWUA 1EPXA 2D2OA 3CWNA 1W1ZA 4WQ6A 1TPVA 3W1MA 4JTKA 3W23A 3QPYA 1QR7A 4GXMA 1L6SA 1MFUA 4Z1CA 1MXDA 3C2RA 2ZWZA 1FY6A 4ZQOA 4IMGA 3PC0A 1IV8A 1I2OA 4LQ1A 3HJEA 4GO8A 1XBVA 3HJZA 2BHYA 4NNAA 3UWUA 3KLKA 3WDIA 3S5OA 3GDKA 2F7OA 1CW2A 4MPQA 4E2DA 2DORA 5AB3A 3AO0A 2Q8LA 2ZUUA 1EB3A 2PC4A 2QR6A 4WX2A 3NPXA 1RD5A 3A24A 1UUMA 1VR6A 5CZSA 2J9ZA 2ZX8A 3VKJA 2ZE0A 3B05A 3BLIA 1QI5A 2Y70A 1YDOA 2EEXA 4Q4KA 3TJXA 1GVFA 3B0UX 4RV8A 3CM4A 1TB3A 1P5BA 1JXJA 1UUOA 2GQ9A 4CQAA 1FBAA 2HMCA 2X30A 2QCNA 1PS9A 3I7RA 2FJKA 1OYCA 2ZA2A 4AVFA 2CW6A 1TCMA 2FYVA 3GXDA 3O16A 3VMOA 4Y9AA 1ZAIA 3M47A 2ZRUA 1KXHA 1YTKA 2E1DA 4MY8A 3DDFA 3EX6A 5F1VA 1XH1A 2DU2A 3P61A 3HGRA 2JGYA 1V3JA 4BZYA 3VU2A 4FNRA 4HN4A 3UNDA 2OX1A 2Z6IA 5DY2A 5HWJA 4H4IA 2D0FA 4O0KA 3ZR5A 4DELA 3EKLA 3IIVA 4DPQA 2NT1A 2QV4A 5EL1A 2QJIA 1HL8A 3N2XA 5C2XA 1SO6A 1UKSA 4U2YA 1MEIA 3LXAA 1GEQA 1UKQA 3SGZA 3WNKA 4DO6A 4DPPA 3GIYA 4HKPA 4PFMA 5EMYA 1SW3A 5LZLA 2VRKA 3DX4A 4TMCA 1ICSA 3P81A 2O7SA 2FE0A 3OA3A 2LLEA 2CLKA 4JNMA 4S2CA 3VGHA 3DHPA 2V0TA 3TX9A 3NQCA 2RFGA 2BY0A 3RK8A 2VFFA 2ZXDA 3QMSA 1XGZA 3BV4A 3BW2A 1MSSA 3LHTA 5D2XA 2ZRXA 3E12A 2OJPA 1JCLA 1VFOA 3M07A 2ZA1A 3SECA 2XVLA 3SY5A 3UCQA 5DN1A 3NQDA 1WOAA 4GUHA 4CCEA 5LNRA 2QKFA 5A5WA 3VM5A 1BAGA 4AHOA 2CZEA 3UPWA 3WNNA 4GRSA 4IMCA 3W1UA 4RX0A 1OFQA 1J0IA 2OYMA 1YXYA 2V82A 3VSTA 1O5KA 2EABA 1SW7A 4PA8A 1SZFA 2BY1A 3NG3A 3SW6A 3DX2A 4JTUA 5DXYA 3EJUA 3FLUA 1OYAA 3D4ZA 4KWVA 5C54A 4U3CA 2F1BA 1F6KA 4ZVJA 3BVUA 3ZS4A 2FDSA 3W22A 3O6YX 3VMNA 2D3LA 3KAOA 4JL1A 5KZEA 4M7SA 1E51A 3L0GA 2OYLA 2PWDA 2NXIA 4ZZ9A 2BLEA 3VSVA 2NLIA 3BLFA 4LT9A 3W1QA 1D3GA 4OE7A 4UMCA 4HPXA 1JCMP 3UYCA 2C16A 3L68A 3CWOX 3C0JA 4JYDA 1PCKA 2ZUWA 1FX6A 3EWBX 4CN1A 2TYSA 3DI1A 4UTIA 4UQCA 4LVFA 4KFNA 1J0KA 4RZ5A 4FB7A 3L5LA 3LBCA 4JDBA 1VB9A 3TKFA 2YPIA 4AWUA 1KFEA 1H3GA 2QUTA 2R91A 3PM6A 3WDHA 1XL9A 2X16A 1Q4NX 4FXRA 2BXVA 3LGEA 4GC4A 3LV6A 4AB4A 1ADOA 1HUVA 1G1YA 1KFBA 4WZHA 1DJNA 2E4TA 4FNTA 3UG5A 1BG9A 4JFTA 5A2AA 1KGXA 4X22A 2BZNA 1WDWA 2NUWA 8CGTA 3DFPA 4ADSA 3PBYA 3IGUA 2DH3A 2W6RA 1I2QA 1K8YA 1QWGA 3P82A 1H1ZA 1MW1A 5A8GA 4E2BA 1JCXA 3L2IA 3EX4A 2F1AA 3TTSA 3EDJA 2ZZ1A 4IMEA 1KCLA 3II1A 4TIMA 1IIGA 2YYUA 1PEZA 5CPNA 1JD7A 4FLOA 1A5BA 2FTPA 2VEMA 4O52A 2ZUTA 4UR7A 5CG7A 1KXQA 1SPQA 1WXJA 4BF9A 3M5XA 3GVGA 2ALDA 1L6YA 3E0IA 4WXZA 2B4GA 2NXHA 1KLYA 2EADA 4GI9A 1VIWA 1BVZA 3OLEA 1ME8A 3QSTA 3PULA 1LOLA 4JCMA 2PWGA 2QCHA 2VELA 5FF2A 3D50A 3OLGA 2ZRZA 4OQVA 1HFBA 4AYGA 5K7JA 1EWDA 3BLKA 2ZXBA 5DBTA 3BVJA 4XQ6A 3LRMA 1JDDA 1XD1A 1JCJA 5LNWA 2CHNA 4WY0F 4WLCA 4GUFA 1H61A 3GLCA 5BMXA 2ISVA 1KGUA 5D2VA 1EUNA 4LVGA 3M16A 2GUYA 1KTCA 4CNOA 2KZHA 3USBA 5C5YA 4XBSA 2YOCA 3NQEA 3DC0A 4GIAA 1F7BA 5K2ZA 2WVVA 4EF9A 3ZR4A 1VPXA 2YA0A 3GB6A 4DO5A 4RXFA 3ZT6A 1JRBA 3IVTA 2C8NA 3CLWA 3W2MA 4Y90A 3A6OA 3BUDA 2CLIA 2EQDA 2H8XA 3G1AA 4YXGA 3GNDA 4MFDA 4A2RA 4YCOA 4UIOA 3BAIA 2ZUVA 4UQDA 6TAAA 4A3UA 1IZJA 1CGUA 5LGXA 1QW8A 3GXIA 2YGYA 1PS3A 1RZMA 1VYPX 1M7PA 4GUIA 2UV8G 1VFMA 1KW1A 3WENA 1W3NA 2A1YA 5K9DA 1CXHA 3TW6A 1QHPA 5EKYA 3BVTA 1SFJA 3DFSA 3B03A 3L2LA 4FNPA 1VS1A 2QCLA 4AH7A 2FLIA 2C6QA 3GX9A 4R33A 3MHGA 5I5RA 4JD4A 5TD4A 1CI1A 2OZ0A 4N02A 3W2NA 1JDCA 4JCLA 6CGTA 5I0DA 1RPKA 1F05A 1Q3NA 1TSIA 3DENA 1KGWA 1UD4A 3DFTA 1QPRA 4H2CA 5BOOA 3GBDA 5D38A 4PCTA 3W2LA 4R53A 3FFSA 3WNOA 4JTFA 3GXPA 2CZDA 3LRKA 4O50A 2VFGA 3INPA 1O4UA 2YX0A 2DIEA 2Y24A 1TYGA 2VXNA 5F4SA 3IGSA 1Z48A 2RDTA 1M5WA 4BFAA 5IM51 3KLLA 3GDRA 1WP6A 4RZ6A 2OT1A 1GVQA 4IOTA 2PWFA 1VHNA 3KX6A 3ZWTA 1ALDA 3CPRA 3CPUA 4UNLA 4UXDA 3BLBA 1IXOA 3ZFHA 1UKTA 3W7EA 1C8VA 2XVGA 3CZEA 2BX7A 3BK0A 3CHVA 2CPUA 3W7OA 3B4UA 3KL0A 2XN2A 2ISWA 1JXKA 3VSUA 3D0CA 3W2KA 4ADTA 3KRZA 3RLUA 1AMKA 3G8EA 3AXIA 4OIFA 4MLRA 3TC6A 2OMAA 2XIBA 1G4SA 2RDWA 4N4PA 4UOZA 1KXTA 1UD3A 2C19A 3L5MA 3TROA 2E9BA 1Q6QA 3TSDA 3L4ZA 4UNKA 3BMVA 2DZVA 3LHWA 4UR8A 3NL2A 3BAYA 1UH3A 3I7SA 3LTYA 1S46A 3AMLA 1SZNA 1D3HA 3WJYA 1UD6A 2OSYA 1XBZA 2VT0A 4JGDA 4OGZA 5CXPA 4UTWC 4O17A 4IX0A 1X6UA 4CVWA 4QQ3A 2D0GA 3PAJA 5C55A 5DCEA 3ZT5A 3UG3A 4O13A 1GG1A 4UCFA 4YLWA 1VCVA 1K8ZA 2Y7DA 3CZSA 3NQGA 3BLPX 4X3ZA 4BI7A 4IJBA 1GTHA 3EEGA 4N9CA 2CWNA 4DO4A 1YTDA 4H8HA 3EDFA 3LTSA 2VFEA 1CIUA 2GQAA 3H54A 4RKAA 3WY3A 2C14A 5BRQA 3DXIA 1HTIA 1LRQA 1WAUA 3YPIA 3DX1A 4JEQA 5G1TA 3N19B 1ZJIA 2RDUA 4UQ9A 2YW3A 2F61A 1YTEA 3MUXA 1EP2A 3S1WA 2HS6A 5E6YA 3EX3A 3T55A 5G2IA 4HPHA 2RKXA 3I65A 4FIQA 3W72A 4LWWA 4GE8A 2WKLA 3STCA 3NR0A 3O6CA 1JDAA 5FEWA 1LTDA 4AMAA 2DZTA 4O0ZA 1E3ZA 1OFDA 3FIGA 3LTPA 5I3JA 1TPC1 3MWAA 3HGSA 4WF7A 3M7WA 3W7PA 1XCWA 4LW7A 3MMTA 4DEFA 1CXEA 7TAAA 3LI1A 5DLCA 1ODUA 4UTMA 3VM7A 3BARA 3NQ6A 3UG4A 3NM3A 2I14A 5HQEA 1LYXA 1MZHA 2FQIA 3GKAA 3I7QA 6ALDA 4O1AA 1CGVA 3GK0A 3RLVA 3W83A 5I3IA 4LVAA 2GVYA 5A2CA 1BWLA 3VNDA 4J3TA 3W86A 3QM3A 3FAXA 2NT0A 3EDDA 4BI6A 3W1LA 2CLLA 3W1PA 4MZ1A 3DU0A 3S8HA 1W31A 2FPTA 4FX8A 5KSWA 5FF4A 3ZO9A 1UH4A 1WBJA 2VC6A 4LUIA 2BY3A 3G24A 3BSGA 2ZRYA 2ZZ4A 3H53A 3G1HA 3FW6A 1XSJA 2DH2A 4O28A 2B7QA 5CZTA 1ME9A 3HG4A 1F73A 1GVSA 4RZ4A 3EXTA 4RCXA 2DJXA 3DGRA 3BMWA 4J3XA 3N73A 3VGDA 1MW0A 3C3NA 4RK8A 1VHCA 2WO5A 3DFQA 4UUIA 2ZTKA 2FB2A 2CLFA 3W87A 1TIMA 4P61A 1O7DC 2E6AA 1SO4A 1V3LA 3QF0A 5I3HA 2XFWA 4Z08A 2ZUSA 3NZRA 1FCQA 4I7VA 4EOUA 4XBKA 1CXIA 3UWVA 3WY2A 3TH6A 4WOQA 2WKJA 3S1VA 3CZLA 2FH6A 2QPUA 1KM5A 5HWNA 1KFLA 1JI2A 1WPCA 4JTEA 1OG0A 3W7DA 1HXKA 4ICNA 4AWTA 3MP3A 3HG5A 1C29A 3I6RA 4HT3A 5LHFA 1KM2A 1P0NA 4AEOA 5D2WA 3W7KA 2C13A 5E0KA 1HT6A 3KEHA 1HTYA 1G7VA 3VX1A 2ZX7A 1OX4B 1E43A 1Y7VA 4PCSA 1TREA 1O94A 5K4XA 3G1YA 1BF2A 3ZT7A 4A22A 2TAAA 4FNUA 1G69A 2NX1A 3CC1A 1G5AA 2ZZ5A 3KRSA 3U2OA 3KFTA 1PJ9A 4W9TA 2HTMA 1GJPA 3S1XA 3TMQA 3LCIA 3HBLA 3QZEA 5BMWA 1R46A 5AFDA 4FEZA 6TIMA 4JL2A 4HOZA 2TRSA 4Y6GA 1TCDA 2YA1A 4MZ8A 2DZUA 2WKGA 1M7XA 3G0SA 2WNZA 1XD0A 3BUPA 3TONA 5F1UA 1CGTA 1LP6A 2CLEA 1Q6OA 2P10A 3W2UA 4E2OA 4O4VA 3IIPA 3K8LA 2AGKA 4LXFA 3G1XA 4OV4A 5AHIA 1TV5A 4LUJA 4W93A 2J9YA 2X2IA 2Q8ZA 1SW0A 2QCCA 4J28A 2YKKA 5F7UA 2E6FA 3TV8A 1GJUA 1YYAA 3TQVA 2YIHA 2H3BA 4ZL1A 1EA9C 3LLDA 3OLIA 3OLDA 3MI3A 1BEUA 3FJLA 1KXVA 4NQ1A 5HUPA 3UEQA 1DQWA 2ZZ6A 1NF7A 1FWRA 2VEPA 3TXZA 1JQXA 3W88A 1VLIA 2ZWYA 3AMKA 4LVDA 5AHLA 9CGTA 3TIMA 3KVKA 3UERA 1SU5A 5E9AA 1PAMA 1Z41A 4EF8A 1OSEA 1OFEA 3MO7A 4O12A 4UNIA 2DJLA 2EPHA 3EWZA 1BTMA 1JVNA 3A23A 1V3MA 3HG3A 3BVXA 2QUUA 3FA5A 5FEZA 3T44A 3W7MA 1FQ0A 3QPZA 2F7PA 1JIBA 1KBKA 3W73A 3PBWA 3GZ3A 3BH4A 4IMFA 1OX6A 4U31A 1MW2A 4WY0B 4LS2A 4YL2A 1IXQA 1TQWA 2IQTA 2QF7A 3DHFA 3BAWA 1GT8A 3MHFA 4U33A 1KWKA 3SGUA 1P0KA 1AK5A 3G0XA 5D32A 2EO7A 2YZRA 3LCXA 3PVFA 2NV1A 1I2RA 3RMJA 1I2PA 2ZIDA 3N14A 1ZCOA 2J25A 4WSJA 1OK6A 1T8XA 2CFFA 2JK2A 2NXGA 3UY8A 1OT2A 5E70A 3RF9A 1VH7A 3HMJG 1FWWA 4UQBA 1IZKA 1TRDA 1QWUA 2D0HA 3G3MA 1QCWA 4H8UA 4TO8A 8TIMA 2PWHA 3QMRA 3S5NA 3DX3A 1H62A 3ATZA 2Y7FA 1BWKA 4HPJA 4NXSA 3NVTA 1JG9A 4BA0A 2QUVA 2VFDA 4UC5A 4IWWA 4QSHA 1H7WA 4JX6A 3O8AA 5DFAA 3EXRA 3VCRA 1KFJA 2A6NA 3EB2A 1QPNA 2GJRA 5F4WA 1B3OA 2AMGA 3NPWA 3DDGA 4JR5A 1KBIA 1UB3A 5AHMA 2WSPA 1QMLA 3D4YA 2GOUA 2TPSA 3EX2A 4TU1A 1WBHA 5KMYA 3UXAA 1JUBA 4WJEA 5F2GA 1XXXA 1XH0A 3W3OA 3LCHA 1H7OA 3BUQA 5G2WA 1UD5A 4UTTA 2VENA 1KM1A 3ABQA 1KM3A 1FDJA 4LOCA 4JFWA 4G1KA 5FF3A 4UFLA 1AW5A 3IJ7A 5FEPA 1F6PA 5KZMA 5HINA 1RPXA 2B7NA 3W85A 1JULA 4M7TA 4NX0A 1XFBA 3K8MA 1Z42A 3ANYA 3KL5A 1XBYA 3LCFA 3W2JA 4LV9A 5HXMA 4AF0A 1FDYA 5CKSA 3NQ2A 1A53A 2ZQ0A 5A2BA 3V75A 1X1ZA 3ZSSA 5F2MA 1LWHA 1CXKA 3WEOA 4L4MA 1JL8A 1OYBA 1B0IA 2WCSA 4NZJA 3N2MA 4PL2A 4LRTA 3LI0A 4B9ZA 3QH2A 1NAL1 4NUWA 3LCLA 5FF7A 3IRDA 2C18A 3NOEA 4QITA 4CNNA 4QIUA 3TDFA 3EJRA 1BKSA 3CTLA 3PY2A 4NJKA 4K7VA 1H63A 2DP3A 4Z1DA 1KLZA 4IPJA 4AMWA 5GVJA 5D33A 1OVDA 4X9SA 1W37A 4AHQA 4JY8A 2WNNA 4YWIA 2QLYA 3KWXA 4Q33A 1RQHA 4L4LA 1X8FA 3VO0A 4I7WA 3L5AA 4N9DA 3C2OA 2E0PA 2VFIA 1B4EA 1XDLA 1A50A 3WK2A 2OW6A 5HPOA 2QAFA 1DQXA 4NU7A 1M7OA 1N55A 3OEXA 2ATMA 5AOUA 1O60A 1MFVA 3WN6A 2Y88A 1I4NA 3TMLA 1LROA 4JY9A 2WQPA 5KEZA 1Z44A 4JICA 1W5MA 1MVYA 1QOQA 3IVSA 5I3KA 1VCGA 1DOSA 1PHWA 4CQ8A 4BR1A 2A6LA 1TPB1 4AAJA 3W74A 1E3XA 3CTTA 1PVNA 1R2TA 2GJPA 4JTJA 3LX9A 1OFRA 1JRCA 3L4YA 5I23A 4UTUA 5IBXC 4ZQMA 3MP4A 1TQJA 1VGAA 1EIXA 2V2CA 4NZFA 1KCKA 2J88A 3IIXA 1AW1A 2F84A 3HO8A 1MW3A 4ZQCA 3OVQA 3UD6A 4UFJA 2BWGA 4YMZA 2WVUA 1QNVA 3ABOA 4QAWA 4Z0JA 3W75A 2AQWA 1VAHA 3W37A 5DY3A 1R34A 3P80A 1DL3A 3DKJA 1J4EA 2YJQA 2X1RA 3N3MA 2ISSA 3GDMA 3QQ0A 4DBDA 5BRBA 1BPLB 3DAQA 3LERA 3W6YA 1KM0A 1P1XA 3GTNA 3W7QA 4TR9A 3K8KA 1YXCA 2P1FA 3LV5A 1B4KA 5D30A 4ONVA 1PHQA 1CXLA 1VYSX 5G4WA 1JQVA 2J27A 4X2RA 3NZ1A 1JD9A 1OB0A 4AEEA 2ZTJA 3B06A 4IQLA 2EF9A 2ZZ3A 4A29A 3ABRA 4N4QA 1W9XA 3B8DA 2QCDB 4IGHA 3PB2A 1D3CA 3TE9A 3G22A 5HMSA 1DVJA 1TPFA 4BWLA 3L66A 3L65A 1WZKA 4MYXA 2QDHA 3AJ7A 1OK4A 1XI3A 4KFOA 3LBMA 4M6VA 2E8YA 1RQBA 3QQ1A 5CPMA 1CGYA 1DV7A 3PSWA 2FHBA 3T4CA 3BW4A 4PSRA 3DKLA 3R2GA 1MWOA 4QAIA 5LSMA 5LNSA 4NXKA 3GR7A 4JTSA 5ABTA 2R94A 3PBUA 4HIBA 1T96A 3FEMA 1KWGA 1EP3A 4GUJA 1R30A 3TK7A 1WO2A 1YXDA 1D7FA 2OCZA 2A21A 3OVRA 2ALWA 5DCBA 2VEKA 1HL9A 1LORA 3GXNA 2ZZ7A 3G8RA 1IXNA 3Q58A 2Z1BA 2X2GA 1RR2A 2Y63A 4PEEA 2PE4A 3SI9A 5G1YA 4DQWA 3IVUA 1G67A 1W3TA 3IEBA 5CSRA 1EX5A 4NJHA 1SQ7A 4DXVA 3GXTA 5C6MA 1FWNA 3G1VA 1LRNA 2Y6ZA 2Y7EA 3RFAA 2VUYA 5TQLA 4UQEA 1HX0A 4LC6A 4XUGA 4WY0A 1QPQA 3ZOAA 3UZ5A 1SMDA 3A47A 1TJRA 2NWRA 4J3WA 3S5ZA 4UFHA 1T99A 2G97A 4PL1A 1Y0EA 3KRUA 1EWEA 1RV8A 2FPYA 3HGJA 2V8ZA 3MBFA 1WZMA 1TTJA 2E77A 3DHDA 3O15A 1CGXA 5D2YA 5EBUA 1QFEA 2ZX5A 2VKZG 3SJ3A 3PB0A 4K37A 1U2YA 3UWWA 3ELFA 4LTSA 1V7YA 1WE5A 1TV8A 1WZLA 5D37A 4NJIA 4HOWA 3NPUA 4HNUA 2C3ZA 2DZSA 1LCOA 5EMUA 1V3KA 4MB1A 4O57A 3TSBA 1QAPA 5LGZA 2EAEA 2E8ZA 3CT7A
chains in the Genus database with same CATH superfamily
2PGRA 5J57B 3NO5A 1HCZA 2H2PC 2P3ZA 2QHAA 2BVQB 2EC8A 1X1NA 5FR3A 3RCMA 1YAIA 4JFHD 2JKSA 4E8GA 3VD0A 2Y89A 4O1EA 3TTEA 1B31A 2P7TA 3R10A 1E1CA 4K15A 1FKWA 3AQXA 5FWRA 3MSRA 4LL1A 1K5WA 2ZX6A 2WV8A 2ZOWA 2V6HA 5HOSA 1BJ8A 1DXIA 4I9XA 2QVKA 3NEEA 3VE9A 4IQEA 4MAZA 1A5LC 5LNVA 1XGYH 1VBJA 3PK7A 1BFVL 2Z26A 4I2XA 2VJ0A 1N12A 3T0ED 1EUAA 3QGVA 5AHEA 4H25B 4HK0A 3O8XB 3EMQA 4AYDC 3RDKA 1CFVL 4TUOB 3GSRA 1DL7H 3G6JE 3V4VH 4U49A 4P4KA 1QO3A 3QXDA 4BWUA 2H6PB 1OP5K 2E9MA 3GO2A 2FGWH 1A1NA 3CAFA 3MBDA 4G8EA 2VERN 3RITA 3ZL4H 1CLXA 4NAFB 3LOTA 2XIOA 2XFRA 5H91A 1VENA 2AK4D 1L6WA 3VNYA 1EC8A 1GGUA 1X7QA 4QJ1A 4YVUA 2HVOA 3EYFB 3GBNL 4B9PA 5KOMC 1OCRB 2E3VA 4UNTA 4L48A 1NGYA 2VUKA 1XWVA 3MI6A 2HVNA 1RZJH 4LCVA 5F97E 3QUYC 1AH1A 4WENB 3UC0L 1YO4A 4XTDA 2C1HA 2XN1A 5JNYA 2LFEA 2VAJA 4KMTL 1QRNE 2Q1EA 3B2VH 3MYJA 3T6CA 1MJ7H 4OIIH 3OKOA 3QI9D 1TNMA 2RA1A 3KVQA 1K4DA 2KI6A 2ENYA 5FS5A 4M80A 2PDUA 4UOW0 1K6QH 1LBMA 3PLYA 4YL9A 1FXPA 4GKSB 3FSTA 1KRCC 1CB2A 1MDTA 1HKMA 3VI4B 4KKNA 3I2CH 2AJUH 2VQUA 3WJXA 2DUXA 4O1FA 2Y85A 2AQ1A 5DT5A 1XKYA 2R1PA 3O6DA 5I15L 1Q45A 3SE3A 3TY1A 3WCYA 2CNYA 4P0DA 3F7PC 4E38A 4UTHA 4X6DB 4MXQD 1E8ZA 2Q2EB 2I9LA 1ONQA 4ZMAT 5KANI 3VIJA 4PFEA 1TPEA 2HH0L 3X3YA 5C0JA 1V93A 1MIEL 4OH2A 1EFQA 2GBVA 3TR9A 2CALA 5C0AA 1TQBC 3WN5B 4N5UA 2G9HA 2AKRB 5EF3A 1QO2A 1P53A 1HZYA 3PJTA 2ZWSA 2BODX 2DSWA 3ISYA 5DZAA 3V1PA 4XNBA 4RAVA 2NY5L 4L56A 4AIUA 4V1DE 5F9OH 5C0EA 2WZAA 4H04A 1Q94A 4HKXB 1A66A 3WMLA 3PG9A 1JZ7A 4V11A 2WOHA 3N6QA 2MCMA 1KRBC 5F7EH 2R59A 3MLXH 4GBXD 1AANA 2AJ3B 2VDOH 4Z7UB 1YQVL 1VZWA 3E3HA 3PL6A 2V2WB 2CO7B 3WQVA 1V79A 5G4HC 1T03L 2HPMA 1CE1H 5AL0A 3WAJA 1EAPB 5C08B 4Z1PA 1P84K 5AW5B 1AQFA 2R24A 5ERWA 2O5XH 1T2QL 2BZDA 4AT6A 3US1A 5INCA 1RZIB 1V55B 2OR7A 3WI9A 3KH3A 3L3GA 4XN7A 3U0PA 2DICA 1SSDA 1A7BA 4W86A 4H0IA 5C9WA 1NSNL 4NYLB 5E08L 2DZXA 1CDGA 3IUIA 4FPSA 4OK2A 2A3TA 3S4DA 1LO3H 3BPCB 4G6ML 3M4HA 5CHNB 4ZPVA 1UR9A 1R9YA 2PCEA 1CLZL 1X5IA 3E3QC 3L4WA 1JUFA 3S6DA 1S39A 3Q8BA 2VDNL 5C0IA 1X96A 4G6FB 1WIOA 4HCDA 2QKIC 4PRHA 3ZE0B 1LG1A 1TJGL 3KJ4C 2W81C 4X9IA 3Q3GA 1XFPA 2NQ9A 3U9PH 3H9HB 2FB3A 4EXQA 1L4IA 4BTWA 2D2JA 2XISA 3HRZC 2X42A 2CDEB 4I3RL 1XKJA 3BOLA 1CFBA 1SFSA 2EJ1A 1KRMA 1GJWA 2R6OA 4WVXA 4N3UA 1IM3B 3APYA 4W6YB 1CN4A 4LAQH 4ZQKB 3QUZD 5HDRA 4P5TB 2VXQA 3WXVH 1I8LA 3GR8A 3WFZA 2DKUA 1XLGA 4NNBA 5EO1A 4TVDA 4HCFA 2HE8A 4PMZA 5BRPA 3E6HB 3CXFA 4HJTA 3XIMA 3UJ2A 4EIVA 1NSSA 1RJYB 2IMRA 3G7TA 1CXFA 3UPCA 2JH2A 1RY7B 3WIFA 1FCUA 3IF1B 2GVGA 5A2IH 5I19L 1A21A 3PFUA 2FK9A 2HA1A 1RQEA 1WYIA 2UZYA 3C0LA 3FCUB 5KSAC 3R94A 4N5EC 4LY4A 4G6AC 2NW2A 2CYGA 5D05A 3L13A 5FX3A 2XWEA 4IBQA 1ICTA 1BZ7A 4LSBA 1D7CA 4B9FA 4NZ5A 3V9FA 2Y7OA 3Q6GL 4CKQA 1LO2L 1DQMH 4L8SC 8PAZA 3SCMD 5HYJB 1I6NA 1FH5L 4PI0A 2NQZA 2NTFB 1P6AB 1UWSA 3TAOA 5KYYA 3KDMB 1EO7A 3VRJB 4OFPA 4MXVE 3RGVA 1JZ3A 1NCCH 1OD9A 4UFIA 1K7EA 1ZBWA 3KS5A 1EHNA 3BURA 1NICA 3JXAA 1QLEB 1JZIA 5A6MA 3OIXA 4NILA 4KTYA 2R2CA 1B3IA 2IKGA 4D6JA 1H5VA 1X98A 1ZNNA 3HI5L 4PG2A 5HDBB 3VD2A 3GNOA 2BVOA 5DDHB 3UA4A 4LNCA 4LCRA 4XOCA 2GSHA 1NANI 5AVZB 2IDSA 4GI6A 4HYRA 3BWUC 5CIPB 4LNYA 4NN7B 3BZJA 2FFCA 1IL1B 3H9SE 1DBKH 1C08B 4HAGA 4QJ4B 4G1EB 1Z5LA 3EZ8A 2RQEA 5E5CA 3CL8A 4C6FA 4NT6A 3ZW3A 5I1JL 5HHVL 4MJIB 2WJDA 4A4AA 2IQ0A 2W07A 2AJZB 5LGJB 2B77A 3KYKL 4A2SA 2ZSWB 1XEUA 2VN4A 4OB5L 5HVHC 3G3DA 5LA0A 5H94B 4S2SA 5KN5A 1LEKA 3ARYA 3E8UH 5I17A 2WM1A 3Q2DA 4PJIF 4ONGL 2XV3A 3CNKA 3DCDA 3HQ1A 1QU4A 2VERA 2R1YA 1SNRA 1W0YT 4ZFMA 1OTUD 4L29B 1UG6A 1CDUA 4NGHH 2VLJA 4MSSA 1ZAHA 4IUOA 5D6CB 1EPXA 2HVKB 4C83A 43CAB 1KR0A 4GXMA 4M7LT 4FFZH 3PC0A 1SJAA 3IS0X 3V4BA 3P4MA 5HJYA 4AWJC 3NIDF 3M7OA 4W9LC 4G7RB 1QTSA 2A74C 2NUPB 3WAKA 1T0NA 3LEXA 1YDOA 3FXGA 3GB7B 1MFEH 3DG6A 1R6WA 2G4GA 2V5JA 3T1FB 5E1AB 2EE9A 5FW8A 3MWXA 3T0EC 3DG7A 1EOMA 5L4IA 4JM4L 1GH7A 1MUJB 1N8ZB 3V4UL 1AC0A 4YU1A 2QV4A 5ACLA 3T9WA 3VOFA 2Z93A 4PRIA 5K9JL 3MOAH 2O7SA 3KZ8A 3VGHA 3VRIA 3BKJL 3GMMA 6FABL 3TX9A 4XE0A 4R4BB 4G1MB 2AJXL 3MOQA 3O6FD 3SPCA 1BWVA 3BW2A 1JNLH 3QUYA 3HM7A 1ZHNB 3FTZA 1MCCA 2CR3A 3UCQA 5LNRA 1T8QA 5A5WA 1GS8A 3ZHFA 2VDMB 1IQ8A 3MXVL 2GIMA 3C2SA 4OOUA 1YXYA 2IOIA 1RUSA 1SZFA 1JMXA 4P4RA 3BZDA 2WW0A 4HU2A 4A1RA 1RHFA 3L0GA 2NLIA 5JHMA 4DGYL 1AKJD 2OQJB 3T8XB 1Q7MA 4HVBA 1FL3B 3QIWC 3O3DB 1UZHA 4BZHA 1FX6A 8RUCA 2NY7L 1F1SA 1D5XA 4LVFA 5L6YH 1CBGA 5CC7A 1M7JA 4RZ5A 1M3UA 4ZNEA 1US1A 1NC2A 3UYIA 2MHAB 4YDNA 1HKLH 3FT2A 2QDVA 1Q13A 4IIQA 2AQ3A 3R4DA 4LCIL 1N3NA 3SDAD 3GSXA 2QQ6A 3MCYA 3ZHKA 2F1AA 4DIXA 3NTCL 5TQ0L 3L7RA 4NZUL 4DGIL 1S3TC 3G6AA 4MMXC 4FLOA 3FSUA 3GHEH 2DQTH 5JIQA 3QFGA 4LKCB 4XP6H 4L1HA 5FA3A 2QCHA 3OW1A 4PB0H 4Q74A 2D2CC 2ZXBA 4HH8A 4IOIA 3BPNB 1G9MC 1KGUA 3ZTNH 2WBXA 3D47A 3USBA 4S23A 5K2ZA 1TPXB 2WVVA 2F8QA 2PLMA 4WV1A 1MCBA 4HXAH 2NY2B 3A6OA 1QRNB 5C0DB 2EQDA 4FZIA 3U1QA 3GSOA 5LGXA 4Q8OA 3OIHA 2FBJL 2H0PA 5FXCH 3HS8A 1KG0B 4CVZA 1Z2KA 4PGDA 4YZWA 3EYOB 1U0QA 3WMPA 4GG6A 3GK8H 3OWEA 4PCTA 4JNZA 4TPRH 1TYGA 4OGXH 1NIEA 2FEJA 4AEHL 1Z48A 1JAKA 4B50A 4RFEB 1MRFH 1R3HB 3AG3B 4GBXC 3COOA 5FHBL 1BREA 3FBKA 3VSUA 4Z78A 5MP6L 5D7EA 1YY8A 2XIBA 3QIUD 3T09A 1I9EA 4NQEE 5I1EH 1JPGA 3VFGL 3VKKA 3ZYJA 4RNRA 1S46A 5DD0H 3PWPD 3B4YA 4Z95L 5ABGA 4OCSH 4OGZA 3NRPA 5DRZB 1HSAA 3AY4A 4QQ3A 1DYZA 4RISH 4O13A 4YLWA 4GAJH 1X9UA 4QY8B 1V4YA 4Q8NA 3EDFA 3IE9A 1KELH 4RKAA 4FNLL 6A3HA 4S10A 5HHOB 1JGEB 2OGYA 3N19B 4TUKL 2DBLL 5IKCB 2FX7L 5JW3L 5IDZA 3ESMA 4F80A 2ZVIA 3I65A 4FIQA 3W72A 2XNAB 2IMNA 4NPJA 2HTAA 2XIQA 1P2CB 5E2JA 4V1DB 3JVFC 3W7XA 2KZKA 3VFTA 2WBJD 4GSXA 4YWGL 1RUQH 4RX4A 1F6AA 2QDWA 3IMUA 1IM9D 4S3KA 1WVZA 1NMCC 2DWYA 5A2CA 5KSBF 5F3BB 1A6PA 4XB7A 2OQLA 1GEHA 1Q7ZA 3W1LA 4ROQA 2X0VA 4DVBA 2GJXA 1A5MC 3MNVB 4AX7A 3FB5A 2XDFA 2DH2A 4S3CA 2OJZH 1IGCH 4H8WL 1N7PA 3N6YA 1CLYL 5F9AC 4DZAA 1PDYA 2BS71 1ILSA 1KD0A 1NBYB 4HZMA 2QPUA 3QUZC 3QW9A 1JI2A 2GGJA 3MV7A 3SYAA 2PDGA 4AJVA 1FG9C 5DMKB 4S3JA 4WJ5B 4B2DA 4JTQA 5F0PB 1BF6A 1RCOB 3W2DL 3G1YA 5F7HA 2HWZL 1P5VB 1HNFA 1HHHB 5ABAA 1CBJA 2XXGA 3QCVH 5DVNA 4QXVA 3AT0A 3NEHA 3KLAB 3UESA 2BIPA 4L8SA 2Y6TE 2P88A 3ATFA 3LGGA 3SY0A 2Z31A 2VWEE 1EA9C 3C5ZA 3LLDA 5F89B 1DBJH 2CJ3A 3BXWA 3SCMC 3BP4A 4NQ1A 3UEQA 3JU2A 1Q1JL 3FN9A 4FKKA 4G42A 4HUWB 1CDJA 2VSKB 3EYUH 4Z2IA 4X7TA 4KOCA 3U0TB 1K5NA 3W7MA 1BMZA 1AD1A 3A67H 1N59B 4WY0B 4RGNE 4PBFA 1JPHA 4XN1A 3NZQA 4H5SA 4U33A 4NWUH 1K9TA 1DJIA 1YEHL 3HE7A 1P0KA 4UYQA 4M1DL 1GYUA 3MA9L 2EO7A 1SXNA 4JREC 4Q58C 3BRDA 1B3XA 5T91A 1BWWA 3G3MA 4P4KD 3KXFD 1HOEA 4PIBA 4KDVA 3S4SB 2G60H 4MA7H 3TOYA 4HT1L 1CQYA 1B3OA 3TTQA 3DDGA 1WXZA 2WSPA 2NDGA 4Y16B 5D7IE 3P9MB 3UXAA 1PSKL 2AVFA 1FDJA 1YDPA 3CV1A 5CMAB 3MSYA 4CGUB 1AW5A 3MRNB 3DOSB 4DGVH 1F6PA 3BPLC 5EG6C 5M17A 1C5BH 2E75C 1UWEL 3H26A 4IZGA 3ME0B 1IE7C 1BD2A 3CH1B 4QQUA 2ZQ0A 1G7JB 4BQBA 1X1ZA 2F5AL 3O2VL 3S96A 4XH2A 1AQKH 1VERA 1W9BM 2FCBA 3QH2A 1NAL1 3LCLA 4EZLA 2GUOB 3IRDA 3BQ5A 2WINA 3AWEA 3LHAA 1NDGA 3I50H 4RWYH 2DQUH 3DMMA 3L8QA 1FFPA 4OZHE 3CXDL 5DJCB 5JPMC 3ZLGA 3QCTL 1FNFA 4XBEL 4ODBD 2GK0A 4PRBA 4YL4A 2HCZX 4NAEA 4IJRA 4OVVA 1M7OA 2GYIA 2MANA 4CW1B 1E67A 4F58H 1QA9A 2R0ZL 4D0CB 3TMLA 1LROA 1P6BA 5C6WH 3QDEA 2JWYA 2I5IA 2CQTA 3LHPL 4X5RA 3H9SB 3SCPA 4CD8A 1HKKA 3QYSA 4EDXB 4ORGA 1QYGH 2Z3FA 3PWUA 4BUQA 3GVWA 1AXSB 3T4YB 5EC2A 2PYEA 3NRFA 2WXIA 2YJQA 1WFMA 2FQEA 4HKZB 5EGRA 4XVDA 1T1WA 2WSDA 3LERA 1YXCA 2P1FA 5TE7L 2XUCA 4HIEA 1UA6L 2WKOA 5T1MB 5DD5H 3FSAA 1EQWA 1RI8A 5EBLB 1QZ1A 2LQRA 1WD9A 5IHSA 5C0AD 3SQOH 3QG7L 3D6NA 4JG1H 5IJBC 4I3SH 4BKTC 1WO2A 1IQXA 2A21A 2FWLB 1WFJA 2Y5TB 3Q58A 3TJEL 1Z66A 2EE0A 4XC1L 2Y63A 2PE4A 5MI0B 1FWNA 2DI9A 3G1VA 4C60A 3EFDH 4CNTA 4HG4J 2PDWA 4IKLA 2DEWX 2BNRE 3DJ9A 1HE7A 5JIIA 4E41D 4X4YB 4L0PB 5ICYB 3QIWA 1GXEA 5EZLA 5AVWB 2JCWA 3SPVB 4AY7A 3UWWA 4FFYH 2DQIL 4HULB 3PZ9A 4I1PA 1WE5A 4QDWA 5F96H 1U1UA 2EDKA 3PL6D 1I82A 1R4XA 3G18A 3DERA 4UTBL 3NAAL 3TJLA 3SDAC 3DFYA 3LS4L 4MMXA 1XX1A 3IPEA 4B5NA 4HUMB 3BUBA 2XN0A 1H0DB 4JM2F 4ATDA 1YJDH 1R3KB 1N7RA 5CPQA 3RTQA 2G5BA 2EVHA 2G37A 3HPXA 5K9QG 4ZXBB 4L8DB 4OZIF 1FVEA 5TNVA 2B1HL 4OD1L 3TYCA 1N7NA 3HZ3A 4O10A 4JFYB 2QPXA 5CN2A 5D7LB 3THUA 1IC5L 2JFCA 4JY6A 3URNA 1QBLH 2PURA 5ECJE 3W5NA 5KW9L 2ZUXA 4NM8H 2ZKYA 2WXLA 3L81A 4K8HA 3VFVA 2DIJA 4XP9L 3HFFA 5HQMA 1W72B 1FN4B 1GTEA 4JZNA 3L3DA 1TJ2A 2UX7A 1ET7A 5FYKH 2GZXA 3EBIA 2AI0H 1KDJA 3LV3A 3NCCB 1H4PA 1E72M 3R43A 4BH7B 1OQOA 4XPAH 2OTDA 2OSLA 5AG8A 2M2DA 4X0NA 1CFTA 4L1LA 3SDDB 5DRXB 2ISFA 1P4LA 1OP3H 3V0WL 4AD1A 1SN2A 5J1AA 3PWLB 4M61B 5GGQL 4J3VA 1T6MA 1AFVH 4Q4OA 4D72A 4M3PA 4FADA 4N6FA 1SJVA 4GINA 4R90L 4O16A 5IEKB 2OK0H 2BCMA 4IG2A 3VGAB 3QIUC 2I9TB 1XF4A 1PZ3A 3MJGX 1B3VA 1KFAL 3H42H 3NSMA 1S8DB 4WD0A 3V0EA 4NP9A 2XZCH 4NI8A 3C6CA 2DQFB 4TTDD 2CIQA 3VGGA 2GJLA 4Y5VA 1B6UA 1MHHB 2SODB 3JWDH 3AIEA 2BC4A 3TZVC 2VCOA 3QNFA 4K7PY 2D2HA 1A6UL 1JPIA 2V9DA 1ACCA 4EVZA 1A0EA 4AIEA 4GUCA 4O15A 4HIPA 4MBRA 5ACMA 3CLMA 2YGPA 3KZSA 3FNKA 4B5VA 3RU6A 3MCOA 2M83A 4EPEC 3D52A 2NQCA 4WI3A 4FA7B 2W62A 4U5IA 2NX3A 5FWQA 2PDBA 3MRKB 4M51A 4QRRA 1HKWA 3GZKA 5FYJU 3CB8A 4D9QE 2MOGA 2WBJC 2JTDA 1VJIA 5HR6A 4JO4L 5EA9A 1IBHA 3A13A 3ZMEA 2CO2A 1I85C 2QMKA 5DMNA 1E4LA 1OW0C 4WU7A 3NAVA 3LGDA 4FTVA 1ZIAA 4AZ6A 1F3JB 4BWLC 3M8OL 1R3JB 3FU3A 3FAWA 4NQEB 1E9ZB 1HQ4B 2NY1D 5BOJA 2ONEA 1O6SB 3V0GA 2CFLA 4XMLL 1V08A 2IADB 3FOMB 2JGQA 1NH6A 1S3HA 3IJSA 5I00A 1XH3B 3WJSA 4CMHB 1AOHA 2BSCA 1UP2A 2F2HA 4ORMA 4KKZA 4NBXB 2HG0A 2OQEA 3FN0L 4S1SH 3BC9A 4A8NA 4M02A 4DT2A 3HUJF 1OM3H 3UC2A 1MJUH 3MJWA 4YGVB 1FLRH 3ARGD 2P8MA 1A4BA 2BRVX 4BGDA 1QSEA 1JF1B 1IQYA 5KBKA 3MU7A 3UDWA 1FGNL 3QLDA 4F8OA 4NKOA 3WFHB 3KVLA 4JX5A 3VTTA 1LL1A 3CVHL 2F7RA 4FR6A 2VLJD 2GJ6A 1E2ZA 3IJ6A 5EDXA 1YHPA 1V5XA 3F12A 4K3JL 4Z5RB 4O1DA 2EYSA 5D09A 4DBEA 3IN0A 1GVIA 2QJHA 3IDGB 5E0QA 1CO1A 4LSSH 1HXMB 4F8XA 1XPYA 3V0SA 5G4EA 4E5TA 1RUPH 1U8KA 3T5WA 4YS4A 1RWHA 2NUTA 3UTQA 2XFXA 4ELMF 5E6ZA 4DO7A 1BG4A 4N2DA 4YHMH 1I2NA 5TF0A 2ZKHL 3KZPA 1F00I 3IJYA 1CURA 4XZIA 1A9VA 1R5IB 5CJQH 4D7BA 3Q8AA 1XL6A 2I9EA 1TZ9A 5KZCD 3F84A 3QFJA 1NDZA 1F2JA 1T0OA 3GW0A 5ISZB 2A6DB 2GDQA 2ENJA 5H2BA 3X3ZA 2C10A 1YEDA 3W84A 5IB4B 2WQAA 3UCRA 3LCGA 3QUYD 3U0WH 3WH7A 1HEJC 3I6GA 4GRWH 3OZ9H 3KM2A 2KL6A 4WFGD 4U4MA 3R58A 2P3YA 2V2TA 2ALRA 3P9LB 1KM6A 1XICA 1LF6A 4DAGH 1IT0A 3GLEA 1JWMA 5CZ0A 4YIQA 3ARBB 4ML9A 4F57L 1XGRB 2YPKA 4CC4A 4XAYA 3P77A 4RGNB 2FWUA 2JLLA 3W7JA 3BJTA 4GUPA 1NC2D 2FQDA 2QADB 3HFMH 1MOEA 1PQZB 3O3BA 2QR0A 2G3XA 4UTAL 2NX9A 3KS0H 5TF1H 4R7VA 2K4WA 4OUOA 1RCXB 2HV5A 4JTTA 3BDXA 3QNXA 5T3XE 2A9MH 5A1AA 1RIVL 1TJ1A 1VACA 5A6BA 3OPZL 5D7IB 2RH9A 4J1OA 2YBVA 4K9JA 5IBTH 1F4HA 3MGOA 1W3IA 5DHEA 3EFFA 4LIQE 3L45A 3RA7L 3CIWA 2VITA 1DQQA 3WLQA 5JR1L 2CRYA 3Q45A 4OJFH 2HJLA 4D8LA 2WVSA 3BSMA 5KYXB 3V2AR 2VDRH 4F7TB 4OZHB 1OCWH 4C6BA 2E1WA 5EY5A 3SBRA 3W7NA 3ECBA 1FXQA 3U1PA 1QXLA 4LT7A 4O2CA 2J2ZB 1KM4A 3GI9H 1U2HA 3HS0A 4BFGA 4DYEA 3FONA 5IUSA 1PV8A 4NS0A 4P7QA 3WLKX 3MJ8A 2CLMA 2EACA 1Q85A 4GVFA 2DW6A 4F7EB 1GC1H 3T2LA 3NYDA 4LYPA 2AV1A 2VXVH 1MXSA 5IF0B 4Z7QE 4FYQA 3SDYH 4K9EH 2RR3A 4IF2A 2IFFH 3WD4A 2ABBA 1UM5L 5FCUL 4X6EB 3T05A 4NI3A 4GH7B 1LRTA 1S7XA 3T0DA 4ASTA 2P53A 2XOTA 3QA3A 4LSQL 3IGXA 2OPJA 3W7LA 1TENA 3M9YA 4ZMLA 4GXFA 2ADFL 3CWNA 3BOFA 3BAEL 5C09E 4CNIB 3HJZA 5JBEA 1NIAA 5DRWB 4WFFE 4ZYKB 4QXWA 3QTGA 2XQBL 3R4RA 3TJXA 1IAMA 2QVNA 1G7QB 1MRCH 3RWCA 4K94L 2JKIS 2GSMB 4DW2H 4D0BA 2O5YH 3DDFA 1I8QA 4QO1B 2VDML 1V3JA 2WVZA 3NCFB 3TJIA 4EIGB 3ZR5A 4ZEPA 3MZ2A 2BNRB 1Q4WA 1Z6KA 1NGXA 4RX4D 2CLRB 4QI3A 1T7WA 3JWNE 2B1AL 2XXFA 1FNSH 1QSVA 3NQCA 2JCCE 1I7RB 5C7ZA 3ZDYB 4HFUL 5A3HA 1ETJA 5CSGA 1XLDA 1VBGA 4XX1E 3KH4A 3KOWA 3R1ZA 1OTSD 4PMQA 2OO6A 4YN3A 4CCEA 1KSIA 3UPWA 3WNNA 4EQ2A 5KETA 4UTBA 3MNDA 3O8XA 1E9PB 4HCIA 2G41A 4Y5YB 1RJCA 4NO5B 3KW8A 2CJSA 3O6YX 4BZ1H 5J11C 3QJOA 1X5GA 1A3WA 2H6PA 3MV7D 2EIZB 1I8LC 3QFWA 4OF8A 1JCMP 5K59F 2E7LA 4GAYB 4X0KB 3EBAA 1IBGH 3AAZB 3MKCA 5GRZA 3VYLA 3Q1SL 4NO2B 3EYFA 4A7GF 4AB4A 1HUVA 3S9ZA 1R3QA 2BZNA 5E2TH 1VZIA 3IMSA 3TZVA 2DQJL 4Q9RL 1H1ZA 2DDXA 1Y0LB 1QUNA 4AH2B 1ECYA 1GAFL 2GY5A 2H0FA 3HKFA 1WD8A 2Z31D 2DVUA 1BXAA 1NKGA 1L6YA 3E0IA 3X3GL 1F4YL 4QIRA 3APTA 1L6FA 2VMDA 3PV6B 3EIFA 4IOSD 3NQIA 5DRCA 4XZLX 3F7YA 2V5KA 4KXDA 3QDGA 5SX5K 3QDAA 3GZAA 3RGVC 4NUGH 4LUTB 1C82A 4M03A 3VI4A 1AGEB 3BKCH 2IWFA 1IKNA 2OQYA 3UBFA 2GW5A 1VPOH 2XSAA 2OTUA 4MFDA 4A2RA 1JXFA 1CK0L 2PCFB 5DC4B 2HX8A 5AZ2H 3U2EA 4PG2C 2NR6C 5D2NE 1RZMA 1IEBA 1RU9L 1UWQA 3GLZA 4X6DA 5HVFB 1R3RA 3FJNA 3E2HB 4HS3B 2NY1C 3ZLFA 5KS9F 3MHGA 3PREA 4MA1B 1ODZA 2E27H 1UD4A 3CLFL 4H2CA 4QHNA 3SGEH 4HZ7A 2VFGA 2YX0A 2W80C 1WNOA 1R7OA 4NL1A 5A6KA 3OB0H 2YBUA 1DQIA 4RZ6A 2NNRA 1UKTA 3WN5A 1EZLA 3CHVA 3VDAA 1A7RL 4AUJA 1SXBA 4UOZA 3TT1H 2C19A 3TSDA 1Q6QA 5E9XA 1CZ8L 3MZGB 3EBVA 3QHZH 4PUEA 3K0YA 5E8NB 3CHDA 3MMEB 2QVIA 3DMMD 3WS6A 5JIMA 4NPKA 2VD8A 3GI8H 2Z7YA 3BD5A 4L23A 3N1GC 1PZCA 3TBBA 1VCVA 2Y22A 4X3ZA 1P84J 2IQ9H 3MRQB 2LW3A 1B1YA 5G1TA 4ZW8A 3WXWH 1LE9B 2AJ3A 4OFQA 1MQQA 3GC3A 3K72B 3WIIH 4Z7UA 4HH9B 4FEMA 2ZOLB 2C9SA 3LTPA 2V2WA 1ZSDB 1E8XA 2VVSA 3W6LA 2PDJA 1EJWC 4XVJL 2PYED 2FZNA 2WK2A 4UILL 5TAOA 1KYOK 1RJPA 5MENB 3NCYS 3WQGA 2IC2A 1O5PA 5C08A 2GTWA 3TYAA 1NFDF 4DX3A 1AGFA 4DEUA 5EFIB 4FX5A 2CLLA 4YFLF 2FPTA 5FO2A 3ML9A 4NC0B 4AIXA 2BNQE 3IMHA 1RZIA 4Y1AA 3O4LE 5AOLA 1HH9B 4DNLA 3H85A 1T2JA 3EXTA 2Z1PA 5KZ6A 4J3XA 1E8WA 2WP3O 1ASPA 5HVGB 4NYLA 2E6AA 4LLDB 1KGCD 3QF0A 3BLDA 3DLQR 2WZEA 1FP8A 3NJKA 3B2DC 3UGEA 1T3FA 2DKMA 3K74B 3BPCA 1LT7A 4J8RB 3WYRA 4YFDB 4JK0D 3CVHA 2K6YA 3AU1B 3UA3A 1SJHA 5LNDA 4PCSA 1TREA 2XV6B 4JW3A 2YC1A 1IARB 4ZS6C 3RXZA 3QIWD 5IM7B 1RY8A 1PZUB 4KKAD 5CN1A 3D33A 1KPUA 2X89A 1AR2A 4PWIA 3QZEA 1PBYA 2CDEA 4Y6GA 1AHKA 1M7XA 3G0SA 3MLRH 3H4HA 1Y5VA 3MPCA 2H8PA 1PZ5B 1IM3A 4AIZB 3VFNB 4IIQC 2XZQH 4P5TA 3MI3A 1T6WA 4P3DB 1D5MB 1GOQA 2ZWYA 2UZPA 5DT7A 1UCTA 5E9AA 1J9CT 2DM3A 5I77A 3E6HA 4O12A 1RJYA 1QUPA 3FO0H 2QPEB 3T44A 3RTQD 3QPZA 3IF1A 1T04A 4QJ5B 1MW2A 4UYPA 4RAHA 1IVLA 2B1OA 1AK5A 2JQXA 1HKIA 4QRPD 3WLLA 1F11B 4Z7WF 3Q8EA 1XB6A 4P2QB 1TXKA 2A83A 3QE5A 1FWWA 4IJ3B 3D30A 4X6BA 1A4LA 2D0HA 1ONXA 2VGGA 5HYJA 3HC0B 4WV1C 4ZBCA 4QXUH 4ZAKC 5HHOE 3QORC 1RVFL 1R0MA 3FCBA 2GHWB 3VRJA 2ARJA 3PZQA 3WJMA 1F42A 4LGSB 3SB0A 3GJFB 4D8PA 1R3YA 3S6TA 2RTTA 2W94A 3MRPA 4JPSA 2WUCH 4QS5A 3WG7B 1UR8A 4XPFL 5AB0A 1A22B 5C7XH 5IMLA 5I1HL 1ZEAL 4UTAA 4FC3E 1QOXA 2Y36L 5CEZL 5DDHA 2ZOUA 3TEZA 4NN5B 4X7SL 2HJPA 3SDXA 1WFUA 2VM4A 4X98B 3Q9QA 3NOEA 1OP4A 5CIPA 1V6XA 1TEGA 3EB3A 1RHHB 4G1EA 3KWXA 3UJTL 4KI5F 3FUHA 3VDGA 2VURA 2AJZA 4H8PA 5IBLD 3H9ZA 2C26A 3AY4C 1EXUA 4I0PA 2GJPA 2XJ7A 5I23A 3QRFM 4X7DC 2FJSA 4YZFF 1TJHH 3SADA 5BVPH 2X4RB 2AJSH 2D9QB 1QNVA 4J6RL 4L8BB 5D1XE 5DY3A 5ESVB 1AYOA 1HGYA 4GA8A 4WTZA 4DBDA 4BQ2A 3DAQA 1OF2B 4TR9A 4LVHB 1E3FA 3PNZA 4PR5A 4BZEA 2HPTA 4L29A 4NKMB 4XPTH 3O3UN 1HEZA 4DEPB 1A3LH 4QRRD 1J48A 2NY5C 5FEBA 3P93A 2JKXA 5K39A 2V9TA 2HVKA 2GSEA 1OK4A 3S4TA 3QQ1A 3BW4A 35C8H 1YNTA 4Z7QB 5FD0A 1CFSA 3NRQA 5L9DL 1OLLA 4NUPA 1RCYA 1WAAF 2NUPA 1YXDA 4FTVD 2GIXA 3HPLA 1OTSC 4LANA 1LJYA 3HBQA 4MX7B 1A7NH 3WLBA 3S37H 4MD4A 3QPQC 1KCRL 2ILLA 2OMUA 5E1AA 4KZ0A 1NCAH 1HX0A 3F3HA 2BZ7A 1BMGA 5C09B 4UM8B 1A4JA 4AM0B 1N8ZA 4D9RD 4CL7A 1L3NA 4LOVA 5EBUA 2MKWA 4EDWL 1F8IA 1QFEA 1E42A 4QRUB 4Y4FB 1UM6L 3GSVB 1SXAA 3QZBA 1MPAH 5DSCA 3W57A 3Q44A 2H1LM 3RYMA 1MMZA 1U3YA 1KJMB 5F9WB 1D6UA 4G1MA 4OZFG 1QSED 3OQEA 1F3DH 4QRTB 1Z5HA 3GAKA 4HSNA 5B80A 4UTKA 4MY1A 1EEZA 2Z2AA 5D4IA 4N6RA 3O63A 1TFVA 1X7SA 3UH8A 2EAWA 2XTJE 5DD6B 3PANA 3BEWB 4X7EC 2GJ6D 4BUHA 4WOZA 4XAKE 4LB4A 3IAQA 1X7FA 4DBWA 4DXXA 2WBWB 3L54A 1M6JA 4ZX6A 1W72L 2Z31C 4G7EB 2JCCB 5LIKX 4JQIH 2X1UA 3C5ZC 4Y5XA 3QSRA 2OMBA 2OQJA 2CLOA 3U4BH 1FL3A 3O3DA 5E51A 1B4RA 2EGZA 3WGUB 1U8PA 1T41A 2MHAA 3EOBA 4KW2A 3URBA 1B5TA 3L4XA 2X6BA 5F3HB 4PCYA 4HZ6A 1UD2A 4P8VA 1SSGA 3G6JA 2E5EA 3LQLA 3HE7C 3T0WA 2NR6A 3PUCA 5BO1H 3VKDA 4PRPE 2UUDK 4GXUN 7FABL 4JQ3A 4GLRI 1NJ9A 4PJCF 1LNUA 4X9FA 1E4WL 4JS3A 3IGAA 4I1RA 4QHMA 4GMEA 1X9LA 1XBRA 3GMRB 4OJYA 4DLMA 2VIRB 5JVLA 3PE9A 2DLFH 4DJDC 3UYRL 4PODA 1M4KA 3NL6A 5IR1A 3GBEA 3QFJD 3SCUA 3BW9B 3MUIA 5ITBL 3W07A 1MEHA 1J88A 1ZHBB 3L5IA 1OAKH 2WZMA 1G4MA 1NIUA 2OJEA 2PCXA 1UEYA 4M1GL 2CCVA 4P3CL 3CHRA 3O2LA 4FLQA 1QRNA 1GONA 5C0DA 2C1IA 2HNEA 5E2VH 1MCDA 2Y5JA 2Z0IA 3ALWA 2IUZA 3LS5H 4TNVF 2C7UB 4IPLA 3P60A 4NWTL 3DMMC 3S3GA 3QHOA 1F3EA 2WY3B 1F61A 2RGMA 5FL1A 3BKYH 3BVNA 3B3IA 3UXDA 4Y89A 4YDJB 3VXNA 1IQWH 1GKRA 4RETB 1DVFB 1T7LA 3KOFA 4O58L 3AG2B 4KZEH 1IU7A 2GWGA 4Q0XH 5DYOB 3U7AA 5D2NB 5T3ZH 1T2XA 3ABSA 1G0XA 2QDEA 2XA8L 5B3NA 3WFLA 4DKEH 5DU7A 4JTRA 5A6BD 4PJHF 3X42A 3PPCA 4P57A 4Z77B 1UASA 3AREB 4JTIA 2ACSA 4AISA 2W60B 3DIFB 4WFEE 1J5TA 4S1QH 1RUML 2K1MA 5DRZA 3STPA 1OXYA 2W9MA 1ONEA 3JZ7A 4YS1A 5GGTL 2LGNA 3T6ZA 4PYGA 3TF4A 3GLAA 4P46B 2BP8B 1OPGH 5B38B 3K2UH 5T1DH 1WV2A 1PIGA 1OF6A 4ACZB 1NCDL 1AI1L 2DYRB 1NL0L 4QT5B 5IKCA 3OKEA 1FAIL 3T40A 1CE6A 1NUGA 3MAWA 2WYTA 2QTEA 3CFCH 2XNAA 3N11A 1L9MA 4TTGA 1VFSA 4AYSA 1JEZA 2X2JA 5A95A 3V4PB 4DF0A 4JTGA 4N24A 1H7RA 1P2CA 1DIKA 3AWNA 1RZ8B 2J5LB 3OA5A 3S37X 5D7LE 1T21A 2FZDA 1DSYA 5TH2B 3FCSB 4JKKA 3VXTB 1OFAA 1KBGH 1KV5A 1OZUA 4YC2B 3ZZ1A 3SO7A 4EIBA 5F1NB 5ABFB 1HZHH 4MS8D 3LNIA 1TFPA 1TJ0A 1YEJL 5EZOH 1U4FA 1LZOA 3BW3A 3C3UA 4NP7A 1QR1B 4FG2A 3MNVA 3KN4A 4KKAC 3FUJA 3PF2A 4NC2B 1KFWA 1U9KA 1LM1A 4EACA 1GS7A 7REQB 3I6TA 3VUAA 3OJDB 5TBOA 4XCFH 2VP8A 1L9RA 3APCA 1H0IA 1IFRA 1JP5A 5DUBA 3P0YH 3NZGA 4K7PL 1S9XB 4ANWA 4PV8B 4CVXA 3MLWL 5A3ID 4RAUB 2BNQB 2K6ZA 3O4LB 2ZYHA 4AQOA 2P26A 3FB8B 1PL3A 3RTQC 3PJXA 4IL2A 3WO4C 4I77H 4BFEA 1HHHA 3C8FA 1QWNA 4O53A 5IB2A 5EYWA 4ZTOH 2BSEA 4FRWA 2EDRA 1OJXA 3KLAA 4NIYE 2QQLH 1EEPA 4ECLA 1D5IH 4LSTH 2ADIA 4PBDA 4ZAKA 2C9QA 3GTTA 2DWDB 4Y4HC 3HG1A 3QORA 3SGGA 1BVNP 3VD9A 1A5AA 4ZNCD 4MWAE 4KTDH 4FXTA 5F89A 1S2UA 4J2PA 4QCEA 3UJEA 1A5CA 4LHJB 1IC1A 1X6LA 4HUWA 5CCGE 1CPUA 3JZEA 3GXUB 1JZ6A 2Q5BA 4J1UB 3G1DA 4ZMQA 3POCA 5FYLE 2CDFA 4GXUM 3ERPA 3NEVA 1N59A 3PIQA 3GBMH 5FAGA 4RMWA 1KUMA 4R8WH 2FJFA 1PU0A 2BDNL 1YGAA 4YHZH 5JQHC 3IXAB 3THQA 4UWQB 2X9WA 4FKEA 3O8XD 3NYZA 1FUYA 1QO5A 4A8RA 5JBDA 2X1QA 3HB9A 2F1EA 4GUGA 4UMAA 4UZUA 3CMOL 1V7ML 3WLIA 3LKSA 2FUTA 5JHLH 3QFYA 5EWIL 2O4EA 2W0UA 1VZHA 3IE4A 5EC1A 4OLVL 3EG9B 1GYCA 2Q0ZX 3WNJA 4RMSA 3LIZH 5AW0B 3SFWA 3L9RB 2OCFD 1QLFB 3MRNA 4P2CG 4AQ0A 5IBLC 3TZVD 2X4PA 1FWXA 4Y5VC 3H4GA 1UYWH 1C9DA 3MYOA 1PEWA 4EUPH 3ME0A 4G7FA 3EJQA 4DF2A 1G7JA 4H8QA 1MIML 3V0VB 4OU3A 3LXCA 1VRSA 3BWAB 3LSOB 1KV7A 1JGVL 2GUOA 3DETD 2R69H 1ELSA 2B7OA 2R56L 3OZLA 3L1FA 3CJJA 3VAEA 4APXA 3DESA 1S9VB 2NUXA 5DJCA 3QDGD 3D69B 4GY4A 1H9VA 4PREA 1ZLSH 4KHTL 3RX8A 2BHZA 3D87B 2X1WL 4XWGL 2GGGA 2R8WA 4R4FL 5FECB 3EOOA 2X0WA 1NEZG 3R12A 1GORA 5I6OA 2J8TA 3ZJ7A 3W6MA 3UYOD 1NSMA 1XH2A 1UURA 3RHWF 1DQLH 4TQPA 3LM7A 1LWRA 2XGZA 3T4YA 1T20B 1I8UA 5U7SA 2C11A 2IPJA 3W7RA 3KHJA 3DZ1A 1PUDA 3CIVA 5DUJA 3F6IA 4HKZA 4C1LA 3ZLHA 2Z1VA 2W0FB 2X4UA 1F5ZA 5DEGA 4BKLA 3AHTA 1U33A 4REQB 4XC3H 1SUHA 1YEEH 4FQJL 1S3KH 1EJFA 2OQEC 1T22A 5FO9B 5AY7A 1YLBB 4AZIA 3EWUA 1IQDB 5D1XB 4Z76B 3UX9B 2PCYA 4XO9A 1WTGT 3II2A 2G5UA 5ISZE 4JGMA 4WI5A 1DTNA 4U1SB 3ULUL 5E1IA 3EXJA 1NSJA 1AG1O 1N19A 1UMYA 1FE8H 3T6XA 4NKIL 1Z9LA 3UDWC 4LZKA 5ABZA 4U0QB 2OXHA 3SY6A 1NS7A 3WV0A 1JCTA 5CKAA 1CW2A 1R85A 4LBSA 3GC5A 3A24A 3MBEB 1QI5A 2YLAA 1VA9A 2H6UA 4OF5A 4N8UA 3UGVA 4MGXA 5DYFA 3QJSB 1FNEB 2ZA2A 4AVFA 2FYVA 5IVZB 3CLEL 5LCVH 3O16A 3EO9H 4PRDB 2B39A 4M0XA 2DU2A 4BZYA 3V35A 3A0OA 4O0KA 5AYIA 1J7VR 2NT1A 1MHEB 1Z9OA 3N2XA 4JFOB 4H8WC 2I25N 2G3IA 1DFBH 4GG8B 3C08H 1VADB 3I6LD 4F8QA 3BH9B 4IHOB 3OA3A 1H0DA 4HJIA 3ABXA 1R3KA 2IXUA 3VNIA 4DJDA 5I7GA 1NAML 1ZLVK 4AQEB 4Y1AD 5D8JL 3B3BA 2FR4B 2ZRXA 3DROB 4L8DA 4MZ2A 2ZA1A 1XF2B 3SY5A 2V37A 1WOAA 2PUQT 3PZTA 3DG3A 2A9NL 2VZSA 2ZCHL 2V82A 3Q2VA 3FLUA 4JJOA 2F1BA 4ZVJA 3BVUA 2VR6A 3VMNA 2D3LA 2CAKA 2XTJB 4AYFB 1SVZA 4HUKB 2NXIA 2WZHA 4PB3A 2XXMB 2YS4A 3ULUC 2HX9A 5B22A 1HCYA 1D5ZB 1VFBB 1GQLA 3VRLE 1IVUA 1J0KA 1PTZA 1SNZA 3CD4A 3B8UA 1W72A 1FN4A 1VB9A 2XC8A 4ZFQA 5T5NG 3DK0A 4GC4A 2QUMA 1EEUA 1LXMA 1KGXA 1KCUH 4QTFA 4H9VA 4CC4C 5IESL 3LNGA 3FU8A 1QWGA 3P82A 4M6MH 4WIQA 1Q9KB 3CXHK 3SDDA 5L88H 4KQ0A 1L6GA 3HLAA 1JD7A 1IM3D 2MMXA 4PRPB 4N86A 4M5YH 3CV7A 1MLCA 4M61A 1CICB 2J13A 2KDGA 4P5TD 3MPHA 2XBDA 5CINH 2CWUA 1KLYA 2ROXA 1J01A 2JF7A 3PULA 2XKNA 2ESVA 4FQCH 2VELA 3CBRA 5K7JA 3KR3H 5PTDA 1V51A 5DBTA 4DCQB 4IFRA 3WFEH 2W4XA 3TJHC 3UZVB 1US3A 4S38A 5C9JB 2YCIX 2I9TA 3OV6A 5B4MC 1S8DA 5IBUG 3CSFA 2CWVA 3DUGA 2N3JA 3NZ8B 5HHPB 1JRBA 1YRKA 1MZYA 1MN0A 1TJIL 3BUDA 4YDLC 1W2ZA 1QNPA 4YXGA 2J6WA 4WZ9A 4AD5A 2Z35B 3BIAX 1A49A 4A3UA 1EC7A 1ADDA 1VYPX 5HYJD 1DWGM 4JDZA 3WTXA 3B03A 5FCZA 1XCTA 3TXAA 2NW3A 5C0GB 2Y7MA 1OEZW 4B9KC 4DYJA 2FDBP 3GMQB 1UWAA 2A4ZA 3X1EA 3FFSA 4JTFA 1IWBA 3W29A 4XO8A 4DQOL 1GKPA 4LAJH 2DIEA 1P1ZB 4PLKC 3N43F 2DYPA 5GJTL 1RD6A 4FA3A 3MRIB 1ADQL 4NENA 3HS0C 5A94A 2HT2D 2XN2A 5B39B 3OPUA 1VPQA 4MS8C 2Q87A 1UD3A 2E9JA 3UABA 1GMEA 3ZDYE 3EPOA 3OKNB 1W1YA 3LK6A 3SRHA 1UH3A 3ACTA 3LTYA 4PUKA 4QJ3B 3WLOA 1HQ4A 3UTZB 2EKSB 3BD4A 1O6SA 1IBDA 4HIJA 2D0GA 1V54B 2EIBA 3ITLA 1EMTH 3FOMA 4UCFA 3HTLX 1XH3A 3B2UD 4IFKB 4OGYH 5F70A 1JXDA 3WFCL 1GTHA 3L3KB 3TZFA 4D6EA 2Z6FA 2CWNA 4LAOA 4DN1A 2QULA 1I9IH 3WY3A 5F7NC 1GPFA 5GGTA 4PBGA 1RZQA 4C6KA 2F61A 2PS2A 1PZDA 5A3IC 3TIDB 4I0PD 4HTYA 2QZRA 2C1GA 2NY6B 1IGFH 2XN9A 4BV1A 2WHMA 3DSFL 4B9GA 4G8GE 3IN2A 1JF1A 3FNDA 4UTMA 1ZBKA 3WLMA 4JNYA 1FNGA 4B27A 5GRJL 1JK9B 5M94B 3OJMB 4PWKA 3GEWB 4Y4HA 2P80A 4S11A 5IQ7L 3NSCA 3WFHA 4TLUA 3FQ2A 3B1UA 3KPTA 4BI6A 3W1PA 5HY9A 4MZ1A 2YXVA 1V7NH 4F1SA 1SDAB 5DMYA 4U10A 4M9PA 4LUIA 1E5NA 4TQHA 3VDHA 1B6DA 4PRHD 4O4YL 4AD2A 2Z4QB 1KZYA 2B7QA 4Z5RA 1ME9A 3HG4A 1B9KA 3L1OL 2AQPA 4WDUA 3TYGL 1P0DA 1YPZF 2W66A 3PJSB 1TLMA 4HMEA 3P4OB 1HXMA 4ZFCA 1P69B 4CNUA 5FC9A 2WMGA 5HVWA 2DQCH 1KQYA 4ICNA 3N55A 1C29A 4H1ZA 1P0NA 1Z3RA 4MPKA 3W7KA 2NXZB 2EE2A 3O8XC 4I5BB 3KRSA 3T0BA 4ZZKA 3UIZA 4NRYB 1Z6JT 3SOBL 1GZQB 4MDOA 4ICMA 2E7LC 4OCLC 2B3RA 2DZUA 2A6DA 4OLZL 5F1UA 1CGTA 3W2UA 1EDTA 5IB4A 5BXRA 2EIEA 4ONFH 1IGTA 5EDSA 3VUSA