4FNUA

Crystal structure of gh36 alpha-galactosidase agaa a355e d478a from geobacillus stearothermophilus in complex with stachyose
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWAMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELMYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 196
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnuA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnuA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnuA02
1TSIA 3KRZA 2V2DA 2O7SA 4JX4A 1M5WA 1IXPA 3U6WA 3C6CA 3ZWTA 3W2UA 1ZENA 4R34A 4HNNA 4HSNA 1K02A 3TTSA 1W3NA 4O17A 3NPVA 3WENA 3W3OA 3W2KA 2Q3RA 3OLEA 4L4LA 5K7JA 4BK9A 3HIJA 3BG5A 5TIMA 3STFA 3CPUA 3HQ1A 1ZALA 4GBUA 4MY9A 5LKYA 4UTTA 1M7PA 4TMBA 2E9BA 5DCEA 3P60A 3N2XA 1EP2A 2DZSA 1QNVA 3T55A 5E9AA 2QJHA 1JF5A 3UCQA 4FLOA 3B05A 3NQ2A 3IJ8A 1GG1A 2ATMA 3PC0A 1B2YA 2CHNA 2OSXA 3ZSSA 3EJUA 1OX5A 1JCNA 3P7YA 1CXEA 5TQLA 2C15A 3PAJA 1YXCA 2NUXA 4QJ1A 1U2YA 3DAQA 3PVFA 4GFSA 2OW6A 3ZT7A 2DZVA 4UTKA 5D04C 1LRNA 4MY8A 1RQHA 1H7RA 1KFEA 1LORA 2A4AA 3GK0A 4QAWA 4HOZA 1JGIA 4UQAA 2C1HA 3OHIA 5EMYA 4O0ZA 3TW6A 1S5WA 1KM2A 2G96A 4JFTA 3TU9A 1VB9A 3WFAA 5E6ZA 1XV8A 2DH2A 2DIEA 5LSMA 4IX2A 3NQEA 4XUGA 1GQNA 1B4EA 2XN0A 5HWJA 5E0KA 3EEGA 1QOPA 5AC6A 5K4XA 5HXMA 1GT8A 1HL2A 1TV5A 4AIOA 1B4KA 1GVFA 4CNOA 1FUYA 1FWTA 3A5VA 5HWNA 4RZ5A 4HNUA 5AYXA 1WV2A 5CKSA 4U3CA 2WKGA 3W1UA 3P5YA 3TXVA 3W9ZA 5AHIA 2EEXA 3GXNA 3VX1A 5K9XA 3DFNA 3G18A 2GVYA 1NSJA 4CCEA 4LS0A 3C52A 3L9CA 1VR6A 4CNPA 4JL1A 1MFUA 3S2CA 1OF6A 2F7FA 3MMTA 4PC8A 3W75A 1KV5A 1KBIA 5G2IA 2WNNA 5A2BA 4YMZA 3S0CA 2ISVA 3CZSA 4AEFA 1FBAA 1QWGA 4JNMA 1YDNA 2CLOA 2X2JA 4WXZA 1K8ZA 4GI9A 2NX3A 3BW2A 3LCWA 4K8EA 3H54A 5D2WA 2DZTA 3F4NA 2QUVA 2PWGA 4Z08A 4OGZA 1JCLA 2ZXDA 1ONRA 3NYZA 3M5YA 1PEZA 3PSVA 2FPYA 2GQ8A 1LLZA 4TMCA 1TTPA 3VMOA 1LBFA 3LLDA 1F2JA 1H61A 4WXYA 4UFKA 1UUMA 4ZQCA 1SSDA 1W3IA 4Z1BA 1ALDA 1VFMA 1CIUA 3BLEA 4O11A 2OMAA 3EWYA 1RPXA 2BLEA 4CVWA 4JL2A 3IVTA 2Y7FA 1XKYA 3HB9A 1T96A 1A5SA 2OYKA 1W31A 3TC7A 5FEPA 1TB3A 5G1YA 1KBJA 4RXFA 2KZHA 3S1VA 3ZO9A 3TIMA 4AHOA 4JTTA 4BA0A 3MWAA 2OT1A 3W7EA 1DL3A 2TYSA 4PSRA 3W74A 1XD1A 1OT2A 1UD3A 2J9XA 3NQAA 3PB0A 1ZCOA 3DC0A 3P62A 2CLEA 1IF2A 2A7RA 4UOZA 2P10A 3BGGA 3OA3A 3BCFA 1WBJA 1KTNA 3C61A 1TTIA 2ZFAA 3LHWA 2WVUA 1N8FA 4B9ZA 1FCBA 1SPQA 3W1LA 1F05A 4Z0SA 1R30A 1TPWA 3WDIA 4Z1AA 4QQ3A 1ZAHA 3G3DA 3LHVA 1U30A 4OQVA 3L2LA 4IUOA 3HPXA 3TQKA 1OFPA 4YCPA 2BY2A 2F7OA 1FCUA 1ICSA 1CGWA 1KM5A 1OX4B 5AHFA 4IOTA 4MAZA 2Y5EA 2DP3A 2ZZ4A 1SW0A 2ZWYA 1SO5A 4MZ8A 3STEA 4LT9A 1XUUA 3RILA 4AW7A 3F4WA 2TMDA 3EB2A 5D38A 1DORA 4AHPA 3A24A 2F7RA 3DHDA 3GKFA 5D09A 4O4VA 3GX9A 1J2WA 5LZLA 4A21A 1G1YA 2VKZG 3OEXA 4H3DA 5LNUA 1HXKA 3EJPA 3WJSA 2WVVB 2WV8A 4HKPA 3VKJA 3ABSA 1WZMA 1ME7A 1SMDA 3NAVA 2FHBA 3LCFA 4O18A 3L0GA 1JVNA 3BAIA 1LZOA 3IJ9A 1QI3A 1WAUA 3G1XA 2PRLA 1ME8A 3LHYA 2WSPA 1PS9A 3NPXA 4I9AA 4UCGA 3L4WA 4UMCA 4JTSA 4MUZA 2CZEA 1YADA 1GZGA 3FFSA 3KLKA 3BCDA 4Q32A 2ZA2A 1X1ZA 4OHQA 3BLBA 2WCSA 1H1ZA 1HUVA 2ATSA 1E40A 3L0NA 1ZJAA 3GXMA 1AL8A 5D2YA 3EJTA 2WKLA 2BY3A 2WVSA 2QAPA 1O95A 4H8UA 1DTUA 3SZ8A 1GTHA 3HJEA 4GKLA 4XB3A 1YLVA 3OVPA 3PG9A 2DZXA 4ADUA 4DBEA 1DJQA 2YW3A 2ZRVA 1MVYA 1OJXA 3DHUA 4M7TA 2V3DA 2CLFA 4ICNA 2FPVA 3DX0A 2WSRA 1J0KA 1PS3A 3LM7A 1H63A 2PRMA 3CZKA 3G22A 3BUBA 1V7YA 3FLUA 4BI6A 4UTUA 2NV1A 1QW9A 1XDLA 1G69A 1FX6A 1H5YA 1LBLA 4M6VA 3SFKA 4BI7A 4H8HA 2H3BA 2Y6ZA 4E2DA 4PSPA 4UFLA 3R13A 2A2IA 1HFBA 3NA8A 4PH6A 5D32A 5F1VA 4CN1A 6CGTA 2VR5A 4OWGA 5CLTA 3FEMA 2UV8G 4DO6A 2VEMA 4Y90A 2GUYA 2WSKA 1EWEA 1Q45A 3L67A 2B7NA 1GJWA 3BVUA 5HPOA 2X16A 4UXDA 5MHBA 2OZ0A 5K3VA 2VEPA 2YA0A 4BFAA 4UQEA 1SZEA 3UZ5A 3BAJA 2YIHA 4U2YA 1KFKA 3E9AA 1HVXA 2X2IA 4ZMGA 3G1SA 3UY8A 3I7QA 3B0PA 4AVFA 2A0NA 3BV4A 1CW2A 5IBXC 3VGFA 2OSYA 1L6WA 5E93A 1P5BA 5TBOA 4M7SA 4AMAA 1HNYA 3MI6A 4X3ZA 4AAJA 3RLUA 3IVSA 1OYCA 4D2JA 5DXXA 1LOLA 5CSRA 1TPEA 5CSSA 4FNRA 3O6DA 4MYXA 6ALDA 4UOQA 3CHVA 3BVVA 1C8VA 1F6KA 3EWZA 4Q4KA 4UTTC 3UNDA 3AMLA 1S3HA 3MO7A 4NNAA 2ZUWA 1M7OA 2FB2A 3I7SA 3W7KA 2EF9A 3P81A 2CFFA 3LPOA 1TJPA 2OT0A 2QEZA 4FHAA 1KM4A 3M41A 1KCLA 2ZXBA 3BUIA 1CXLA 3DKLA 2ZX6A 4RV8A 5BNKA 2FDSA 2BY1A 3HMJG 2QUUA 3LB0A 3BVWA 3S1XA 1G94A 1KXQA 3LTSA 3O05A 3TSMA 3TAKA 3DENA 1XH2A 3UG3A 1SZGA 3PM6A 3NQCA 4EF8A 4X9SA 3O6CA 4O12A 1JCYA 5CZJA 4EOUA 2PE4A 4JFWA 1IZKA 1GPWA 1NM9A 3I7RA 4R7JA 1SO4A 2QCGA 3LLFA 5I0DA 4H7VA 1NF7A 1QPQA 5LHFA 2E09A 3ABQA 3W1PA 1A5BA 1KM1A 1W5MA 3KVKA 1JDCA 1LRTA 2VOMA 3QMRA 4HOWA 2Z2UA 1U33A 4TIMA 4DEFA 4E2BA 3ELFA 1J5TA 1R46A 3DFQA 3T4CA 4OIFA 3UWYA 1LBMA 1QPKA 4M5PA 2JGQA 2FYVA 2WJZA 3E12A 1UKTA 4FLRA 3FYPA 3QGVA 1PV8A 3PBWA 4NNBA 1D3GA 1IIGA 3RIKA 2C19A 2EKCA 4RR4A 2ZDRA 1EEPA 1QAPA 1WYIA 4UR8A 2X1RA 2C8NA 1R33A 3TV8A 1HL8A 3G1VA 4NJIA 3BLIA 5KEZA 2B7QA 1QW8A 4WOZA 1XFBA 3BO9A 4CLMA 1DBTA 4N9EA 3WDJA 2EABA 1CPUA 3KL3A 3R2GA 3EJSA 1LLWA 2A6LA 2JKPA 2EACA 4NJHA 3UPWA 4XBSA 2FIQA 3QEZA 1D9EA 4HSOA 4O10A 5FEXA 1JDDA 3LX9A 4AXKA 1JUKA 2H8XA 1RQEA 3M1ZA 1LOSA 2ZBTA 1OFDA 3WK0A 4QISA 2TAAA 4DF2A 5HR7A 1CGUA 4Y96A 4XTDA 3B0UX 3PUEA 2C13A 3BLPX 4GRSA 1VGAA 1DVJA 4CN4A 3STCA 1OGSA 1OSEA 3QQ1A 4CNNA 3DFTA 1J0IA 4GI8A 4FXRA 4GUIA 4Z1CA 3L2IA 4UTLA 4LOCA 3HGOA 4GQRA 3TTYA 3A5FA 3RF9A 2ZX8A 4XKYA 4JD4A 3S9YA 4NU7A 3RLVA 3KL0A 3MBFA 4MKNA 3W83A 3W7PA 1F5ZA 4OV9A 1UJPA 4RX0A 1CXHA 1OFRA 5DY3A 1VQTA 4GWEA 5HUPA 1VJSA 3UYCA 7TIMA 4YCOA 1TMHA 4IPIA 4UMBA 4GINA 4HNVA 2ZZ1A 3DI0A 5D05A 5G5IA 5DN1A 4LXFA 1A5AA 1J4EA 1XL9A 3P74A 4GNJA 3HGJA 2GJNA 2B0MA 1B3OA 5FI8A 1AK5A 4HA1A 4PEKA 4UZUA 1P4CA 3ZQ9A 1QO2A 3WK2A 2VELA 2ALDA 4O0KA 4QNEA 3ZR5A 1IZJA 1YXDA 2ZZ7A 3ZT5A 1JQVA 3WJZA 1FWRA 4N4QA 5CPMA 4UTHA 3NZRA 3NL6A 1PZ2A 4WY0F 1UD8A 1XBVA 2B7OA 1G9HA 1EP3A 4WLCA 1TCDA 5DY2A 2V82A 5FESA 3WJYA 3HG2A 1TQUA 5CLWA 3Q37A 4KKXA 1UD2A 4NQ1A 3W84A 3NQMA 5C2XA 4POCA 4FNPA 2GUUA 2OYMA 5EL1A 2X2HA 1XXXA 2X1SA 1FWSA 3VNYA 3FOKA 2FPTA 3W1AA 1OF8A 4RXGA 3BAKA 2CLKA 5I3HA 1I4NA 4M56A 1ZJBA 1BG9A 4G1KA 4UC5A 4TR9A 1EO5A 5EKYA 3W87A 3CTTA 3VGDA 5F4XA 1WZKA 4J3XA 2XWEA 3GTNA 3TAOA 4LUJA 3FS2A 1QPNA 1GYLA 1QWUA 1O94A 1K7XA 3G0UA 3ABOA 3TSBA 2Y62A 3VM5A 1WX0A 4RZ6A 1KGWA 2NWSA 5IBXA 3DI1A 3A22A 3THAA 3HJZA 4MZ1A 4ZQNA 5HINA 1EWDA 2WKJA 1BWKA 2WO5A 4AHQA 4MJMA 2VENA 1H60A 3GDRA 3K8LA 3C2OA 2BSLA 2CLMA 2GVJA 2VFIA 3GR7A 1AQMA 2C3ZA 1QCWA 5DCDA 1OX6A 3UWUA 1XGZA 4C1LA 1SO3A 4O8RA 1CDGA 3LOTA 1A53A 2WPGA 1KBBA 3P61A 4MVAA 1PIGA 1JCXA 1DV7A 4Y8FA 2GQ9A 2VEKA 3IIPA 3EDEA 3KEHA 4EVZA 4I7WA 1NF0A 4UTIA 2YYUA 4XTIA 5AHEA 4HIBA 3TR2A 4C1KA 3IIVA 3W7HA 4OT7A 3BW4A 3E96A 1UKSA 2DORA 4FX8A 1ICPA 3DX1A 2XWDA 2NX9A 1O60A 2Y24A 3EXSA 3WNLA 1VCVA 3HGRA 1I75A 3DDGA 1VFOA 1MZHA 1ZY9A 3NDOA 4PEEA 3GNDA 1CXFA 2ZRZA 1HO4A 3PR2A 4JR5A 4N02A 3S5OA 3W1NA 2C7FA 3KVLA 3KRSA 1KFCA 3RMJA 3F1QA 5A2AA 2Y7DA 5HR6A 5DBUA 3ZWSA 1V3KA 1XBYA 3TFXA 5C6MA 3RK8A 1RPKA 5KTLA 1H7NA 2NLIA 5A6MA 2NWRA 3BW3A 5D02A 2Q8ZA 4IX0A 1U83A 2Y63A 4JFVA 1RP9A 3ZS4A 2CZDA 1XBZA 3FJ6A 3AMKA 3ZR6A 1T0OA 2NXGA 3NXFA 1AQHA 1TPVA 3EX1A 2WVTA 2R14A 1OK6A 3BG9A 3DFOA 5LNRA 4XZ9A 4QNWA 3UQNA 3AJXA 2BX7A 4K6AA 4DO5A 1R2RA 2RDUA 1TV7A 1VYRA 4NI3A 2BZNA 1X6UA 2DJXA 1V3JA 4LC6A 1RQBA 5J5DA 1TTQA 1I2QA 1ZNNA 4LUIA 3NL5A 3LTPA 2G95A 1WPCA 1TPDA 4JTUA 3TJLA 2CZFA 3CLWA 1LROA 1FXQA 4ADTA 2WSYA 4AF0A 1YTEA 2Y89A 4YWIA 3M5VA 4RLIA 1SUXA 2J88A 1AVAA 1L9WA 2E5CA 3GDTA 3NM1A 1JAEA 2EAEA 2J6XA 3IIZA 4JTKA 4BWLC 3M47A 3W70A 3SGUA 3N73A 4Y9AA 2W0UA 3W76A 2QDHA 3BUPA 1XCWA 3MYPA 3BMVA 3TA6A 1WO2A 1OYAA 4X0NA 2FHCA 4UQ9A 1TPC1 1KBKA 2CLIA 1OFAA 2D73A 1VYPX 1PPIA 4GUJA 5AYYA 4EF9A 3NM3A 4FIRA 5SWUA 4UR7A 3LXCA 3DHPA 5EMUA 1SMAA 1PHQA 2YR1A 3PB2A 3TMLA 2EHHA 4LY8A 3CB8A 4S1FA 2V2HA 7CGTA 1OYBA 2JK2A 2ZUSA 2OW7A 3L4VA 3G0XA 3K1DA 2ZXAA 1VC4A 1E3ZA 3N19B 1SFJA 4LWWA 2FFCA 1EH9A 1W5PA 4AWTA 5HMSA 5FF7A 4XKYB 3G0SA 3EWUA 2NSXA 5I24A 2CU0A 3LCGA 2WNZA 3CTLA 5G4WA 4HNTA 2FE0A 2O7QA 2XIBA 4NXKA 2YJQA 1H51A 3DZ1A 1XSJA 4DXVA 5HNRA 1LM1A 3USBA 1I45A 1UH2A 2F7PA 5E70A 1VRDA 3W7MA 1RV8A 4KWVA 1UOKA 1G6CA 3L2MA 1TQJA 2OSWA 5KZDA 4GUFA 2QDGA 3TH6A 2ZRUA 3GAKA 4IMEA 4XQ6A 3W72A 4NUWA 1L6YA 1W8SA 4U28A 5CZSA 2OJPA 3WNKA 4UTJA 1F6PA 3VGGA 4DPPA 3I65A 2CLLA 2YZRA 1G4SA 4J27A 1I2RA 3WELA 3ABRA 1LP6A 4DQWA 3CGTA 3C8FA 5GVJA 1QDSA 5K9CA 3FJLA 3JRKA 1BVZA 1MWOA 3D52A 5J5RA 1SW3A 2ZWZA 2VFGA 4H4IA 3FIGA 1GG0A 4NJJA 3LERA 2CXGA 1AW2A 2V3EA 2ZX7A 2QCHA 5AHLA 4MY1A 5DXYA 3L4UA 2C14A 5LGXA 1FY6A 4CKQA 3GXFA 1FCVA 1OFOA 3FYOA 3KWXA 5CGTA 3DDFA 2QKFA 5AC8A 1TPB1 2F2HA 4GUHA 4WSJA 1WA3A 3V75A 5KZMA 1HG3A 1JD9A 2ZTKA 2J27A 2A7NA 1GWJA 3IGUA 3DBPA 1KCKA 2A1YA 3G1DA 4IXXA 1PCKA 3FAXA 2Y85A 2QCNA 5D33A 1C8QA 1JXJA 2PWHA 1XUZA 3FKKA 4WOQA 1J0HA 2YPIA 3UZJA 3WFZA 2BWGA 3WJXA 2E5DA 4MYAA 4NXSA 2Q3OA 4RK8A 4N6EA 1IXOA 3WJWA 3O06A 5DFAA 4UQCA 2V2CA 1H3GA 5LNSA 2NUYA 2E68A 3M0ZA 3E02A 2ZXQA 3HG3A 4K39A 2I1OA 1K7FA 4GI6A 4R53A 5F2IA 2XVLA 4O16A 3GNNA 1EA9C 3W2MA 1BSIA 1D3HA 1KM3A 2JKAA 4LU0A 4Y6GA 3ZSTA 4JXCA 1UD4A 3TK7A 3VCRA 3TQVA 2ZX9A 1G4EA 3HOJA 2DU2A 1RR2A 1JQXA 3GLCA 5CGMA 1WOBA 3W85A 1MEHA 4YLWA 3QM3A 2Y4SA 2I9EA 2PWEA 4HPHA 4PTNA 2X2GA 2QLYA 5D2TA 4IQLA 1XM3A 1THFD 2IGTA 1H7PA 5D03A 2CPUA 2J25A 1UUOA 4O14A 3UD6A 5I3JA 1UASA 1PE1A 3P8JA 3NQDA 3BUDA 2BHYA 1FDYA 3KE0A 1YTDA 3M9YA 3S5YA 2PCQA 2VEIA 4KWWA 5F2MA 2VFEA 3C0JA 1TRDA 1IXNA 3Q2DA 2J24A 4X2RA 2Y2WA 2YX0A 4A2SA 4J3WA 3O1NA 1NVMA 3WY2A 1I2OA 3ATZA 1BAGA 3W7JA 3BUQA 1MEIA 2QR6A 1TQXA 5D30A 2XVGA 2VFHA 1AW1A 3NR0A 2EADA 4E38A 1TQVA 3TDFA 5CPNA 2VFFA 2B7PA 2A21A 2Z1BA 1I8JA 2GOUA 1LTDA 1PIIA 3N9SA 5BRPA 3VSUA 3W07A 3MUXA 1WZAA 2ZUUA 3MW7A 2F61A 1ZS2A 3FA5A 3CEUA 2YOCA 3EJRA 1K8YA 1O5KA 4AH7A 4W9TA 3VNDA 1SZNA 2EQDA 4WY0A 1RZMA 1CX9A 1Z41A 1X7FA 3EDFA 2HTMA 4JTGA 3W1MA 3EDKA 2E6YA 4NZFA 2Y61A 3NNTA 1N7KA 4MFDA 3T44A 3VGEA 1XBXA 1OB0A 5FF4A 3S5ZA 4AF0B 3TE9A 2ZRXA 4UQBA 3PY2A 2YDAA 1ZAJA 5KMYA 3W71A 4BWLA 3T40A 4MPQA 4AIEA 3GIYA 4UNIA 3C2EA 5HULA 3WEMA 1PJ9A 3GYEA 1OVDA 2QJGA 1A5CA 1R2SA 1NEYA 3GBDA 3QMSA 2HS8A 3W2LA 5G2WA 4R33A 2XVKA 1GVQA 1PCWA 1AW5A 2DJLA 5A8GA 5F2GA 2H8ZA 3HPSA 4JDBA 2YKKA 3F03K 1MW3A 4K8HA 4I7VA 2BTMA 3G8EA 2V30A 5AB3A 1GJPA 1XSIA 3WY3A 1H7WA 3LCHA 5G1TA 3W7NA 2X1UA 1PIFA 1DQWA 4AEEA 1KTCA 3MHGA 4FNQA 4CQ8A 1W1ZA 3M5ZA 2TPSA 3KRUA 2BHZA 1OFBA 2ZA1A 4IMGA 3EXRA 4WD0A 2I14A 3PUOA 1R47A 1UH4A 3GXPA 2GVGA 3CM4A 3W1QA 3JR2A 5LGZA 3OG3A 3W7RA 2ZICA 2JGYA 4DELA 4LC8A 3L4YA 1ZJIA 3L5AA 3BLFA 4JX5A 3QW4B 3OBKA 5L6UA 1CGVA 4Z1DA 1L0PA 4FLQA 1Y7VA 3N34A 3DXIA 4AWUA 5K4ZA 3RU6A 3W38A 5HQEA 4E2OA 3EKLA 2D2OA 4MIMA 3QC3A 4NJKA 3CPRA 8CGTA 4O52A 1T99A 4PCTA 4P61A 5U7SA 4WX2A 1FWNA 3THQA 1IIHA 5KITA 1DOSA 3VSTA 3HF3A 3VGBA 1G4PA 3BC9A 2PC4A 3IVUA 2HS6A 2DH3A 1H7OA 3LTYA 3VMPA 5E6YA 3R8RA 2RDTA 3UG4A 4UQDA 3TMQA 4FMVA 1ZFJA 5BRQA 2EJ1A 2NZLA 4ALDA 2E6DA 1VJIA 3BVJA 3T7VA 3YPIA 5C54A 1QHPA 3M5XA 1UA7A 2ZQ0A 5AN7A 2E8ZA 3SI9A 1TYGA 1UCWA 3KVMA 3MP3A 1WZLA 4HN4A 4IXHA 5KSWA 4QITA 3VMNA 1UD5A 4CGTA 4ZZ9A 1OABA 1W5QA 2FTPA 5BMXA 3FKRA 1DHPA 4YL2A 3QQ0A 4UTWA 4XWUA 1F74A 2AQWA 5A2CA 3NQGA 3C2RA 3NPWA 4M19A 1SZFA 1XC4A 3DFSA 2FH8A 3ZR4A 4QAIA 2NXHA 1FWWA 3BLKA 3BSGA 3BAYA 2GJRA 3BVXA 3MP4A 3P80A 3P8IA 4JTFA 1UBSA 2ZA3A 3VE7A 1MXSA 2ISSA 4OV4A 3TONA 5I3IA 4WJEA 2QCMA 3CLMA 4AEOA 4KWUA 3GB6A 4GC4A 1MW2A 5BOOA 4JICA 1VLWA 1LWHA 3VM7A 2E0PA 2E77A 5KZEA 4JTHA 5AC7A 1ZAIA 3NQVA 2QJIA 4UZSA 4E0CA 1IXQA 3BAXA 1QPRA 5T26A 4O15A 2H90A 4UUIA 4ORIA 1HT6A 3W73A 3SY5A 4NZJA 3QSRA 4O54A 1CGXA 1WE5A 1G67A 1OFQA 2VRKA 2DZUA 4JFUA 1JIBA 1AMKA 1W54A 1FCQA 1Z32X 1KFLA 1JUBA 3CIWA 2Z1KA 1QFEA 5ABTA 3BAWA 5CXPA 1SFLA 3W6YA 4FO4A 7TAAA 1NOFA 4IGHA 2X30A 3EX6A 2NXIA 4S2CA 4LPCA 2ZZ6A 1RP8A 5TD4A 4XBKA 4UTMA 3LRLA 3PG8A 3TXZA 3B4UA 2ISWA 4AMWA 4UFMA 6TIMA 1JDAA 2NT0A 3EX3A 5F1UA 3IIXA 1KA9F 1HTIA 3C2VA 2P1FA 3CT7A 1XD0A 1R34A 4IMFA 3S5NA 3S8HA 1UKQA 2HSAA 1BPLB 5I5RA 1Q3NA 3LCXA 3H55A 1XCXA 1MXDA 3LXBA 2WOQA 4IJBA 3NPUA 4IPJA 3A4AA 2WANA 1MW1A 5C55A 1JL8A 1ODUA 4FEZA 1P1XA 2ZZ5A 4NX5A 3BMWA 1TPFA 1D7FA 4GIAA 3PBYA 3LBMA 3KL5A 5D2VA 3PBVA 3B06A 3WY1A 1QPOA 5FEWA 3S42A 4PA8A 5I3FA 3LV6A 4A3UA 3BVTA 3LI1A 1OHLA 2XN2A 1UB3A 3BSHA 4WY0B 3A6OA 4UFIA 2TSYA 3EJQA 3MHUA 3S1UA 1JFHA 1KFBA 3NGJA 2VFDA 1VHCA 3CZLA 3W1XA 3G1YA 4FF7A 2VT0A 2ZCGA 4OU1A 4PL1A 1Y0EA 1A50A 4LVBA 3UPBA 1Z44A 1EPXA 3SJ3A 2B4GA 5IM51 3VI2A 3INPA 2E4TA 1TPH1 3WNPA 1LYXA 3DFPA 4I7UA 3WK1A 4J3SA 1OG0A 4O1BA 3ATYA 2RHGA 2ZIDA 1GEQA 1VZWA 1BVNP 4O1CA 5E1QA 3C2FA 3RFAA 4ZQRA 5AFDA 1SQ7A 2RKXA 5DO8A 3QH2A 3UG5A 1Q4NX 1VPXA 3PWAA 1S5VA 1TREA 3GDMA 2XIIA 1SSGA 1KLYA 3ZOAA 4ATWA 3QRHA 4BZYA 3LRMA 1AL7A 4CQ9A 1JI2A 1EA0A 1F73A 4BI5A 1G7UA 1LCOA 4K37A 4ONVA 2FJKA 1KM0A 2FGZA 4JFSA 4MOZA 2DIJA 3EWBX 5EBUA 3QPZA 3P5ZA 2YCEA 4KFPA 3EKZA 3HG5A 4TX9A 1G7VA 2FQIA 4LV4A 3DH7A 3ZFHA 2D0HA 5I23A 1GVOA 1YXYA 4O57A 1H7XA 2P0OA 4N4PA 4EIVA 1MW0A 4IWWA 3G8RA 2VXNA 2X1TA 1MEWA 3CWNA 3A23A 1EP1A 4O28A 5F4SA 5AHMA 5AOUA 1IV8A 4FB7A 1VYSX 4H2CA 3O6YX 3WN6A 3LHUA 3P84A 1GYNA 1XH0A 4JCLA 1YDVA 3W1RA 3WMSA 4JEQA 2A7PA 3QSTA 4UFJA 5FEZA 4YXGA 1ICQA 4CCCA 4WSKA 1MFVA 4JTEA 1WBHA 1W0MA 2A5HA 3KVJA 3L5LA 1WOAA 3W7GA 3W7LA 2OX1A 4JY9A 2PURA 1JCMP 3B8DA 2WPBA 4S2BA 3B0VC 1W37A 3L66A 1M7XA 3UEQA 3KLLA 1CXKA 2BXVA 2ZZ2A 1HL9A 3DGRA 3IEBA 2YW4A 4LVGA 3O16A 1OFEA 2C18A 3EXTA 2F18A 3TJXA 5DCBA 3M07A 2RFGA 2XN1A 1DHKA 2GJPA 1PHWA 1C9DA 2GVLA 1P0NA 3W37A 1E51A 1GJUA 3DX4A 4NVTA 1Z48A 3GZ3A 5HWMA 3SR7A 3CIXA 3HG4A 2QAFA 5L9FA 1KWGA 1RD5A 1TRIA 3GDLA 3KFTA 2QF7A 2QMJA 3IK2A 3G1FA 3NQ8A 4HT3A 4LS1A 1PZ3A 4DPQA 3N9RA 4J3VA 1QWNA 1GOXA 1DEDA 3NQFA 2OCZA 3SIZA 1ZHAA 3CWOX 1XCFA 1TQSA 1JRCA 4GO9A 3DU0A 3NQ6A 3L4ZA 1ME9A 4RZ4A 4NJGA 3W2JA 2FLIA 4JTLA 1N55A 1JF6A 1MXGA 1XSKA 4PL2A 3V1PA 1GVRA 3NEVA 3UY7A 2YYTA 1JR1A 3W7DA 3DX3A 2QMKA 2CW6A 2V5BA 4OE7A 4GE8A 2JKEA 6TAAA 2EPHA 1H50A 3CZNA 1CLVA 1KW1A 1TQWA 2XFWA 4LW7A 3NG3A 1O4UA 4LVAA 2R94A 3UERA 1K8XA 4WZHA 2CWNA 3FAWA 3PS7A 1O5XA 4JN6A 5FF2A 3WK3A 2QPSA 4NNCA 5CG7A 3UWVA 3N2MA 1VFUA 4CN6A 1FXPA 1U5JA 3B04A 3NO5A 1Z42A 3C4UA 3M7WA 4TVUA 3Q94A 4HPXA 4A2RA 2AAAA 4X22A 3B03A 2C16A 1KXVA 3QMTA 3C3NA 3TSDA 3VU2A 2ZZ3A 4ZL1A 2ZX5A 3MBDA 2F1AA 3WNNA 4MLJA 5DBTA 1Q6QA 4HOXA 1TPUA 3T78A 3KX6A 3ECQA 1EHAA 2FHFA 1CYGA 2PWFA 3PULA 3STGA 1K03A 3MYOA 4ZQPA 1B0IA 2G3MA 3NOEA 2W6RA 4GJ1A 1FDZA 2E1DA 2TRSA 4FX6M 1CGYA 5CGQA 3PUDA 2RH9A 5K9DA 3IGSA 3O63A 9CGTA 2G3NA 4JYEA 2FH6A 3FW6A 3S1WA 2BXZA 3JS3A 2QUTA 2R91A 4GQQA 1KXHA 3WNMA 1QX1A 2Q8LA 4UTWC 4QIUA 4ZVJA 4LVDA 2QCEA 1VLIA 4IMCA 3LCIA 1ML1A 1TMQA 3D50A 1SR9A 4J7RA 5KINA 2Y88A 5D2XA 1K3UA 3GAYA 2Y70A 3NVTA 2H6RA 4FNTA 1KGXA 5DLCA 4HPJA 3MI2A 1SU5A 1QI4A 4HP5A 2QCCA 3W7OA 1CXIA 2E8YA 3W7CA 1JJKA 3IJ7A 3GR8A 4FXSA 3UWZA 2QCDA 3E49A 5CPOA 3K8KA 1EIXA 4U4MA 3W7QA 4H8VA 4B9YA 3QJAA 1W3TA 4JY8A 4LQ1A 1T8XA 2G97A 3G1AA 2WC7A 4RKAA 3HPZA 1VIWA 3QPYA 4FX7A 2GQAA 1G4TA 4RJEA 1JCJA 1E43A 2A6NA 1VCGA 4P2VA 3MP5A 3PSWA 1RVGA 3Q58A 4GO8A 4MZYA 1TCMA 3TNOA 3C56A 5C5YA 4H6KA 4QSHA 4AYGA 1CGTA 1JUEA 2D3LA 1PL9A 3IV3A 1TIMA 1TJRA 4KMQA 2R8WA 2W79A 3AO0A 3D0CA 3KXQA 1DJNA 1LOQA 4NT0A 3TCEA 3CU2A 4UCFA 4JTJA 4FIQA 5F2LA 2BHUA 1WDWA 4JDYA 5DELA 3DHFA 2YSWA 3N3MA 2Z6JA 4UNKA 1X1OA 5AYZA 1GTEA 3TOPA 2D3NA 3WNOA 1LRQA 3DKJA 3W22A 4ZQMA 3VFLA 3W23A 4EWND 5FF0A 4TU1A 3BGJA 2EGZA 3VO0A 3O07A 4U2ZA 3EX4A 1JD7A 1QR7A 4K7YA 4Q33A 3SECA 2EO7A 4ORMA 4J3TA 2D0GA 1HTYA 2RDWA 4LS2A 5HUOA 3OVRA 3L4XA 3E0IA 4O19A 5I3GA 2PWDA 3TFCA 4LV9A 3D4ZA 1CI1A 1W5OA 5BW6A 3L0KA 4KFOA 1HWWA 4BF9A 1QO5A 4NX0A 3VSVA 2OYLA 1C29A 1JG9A 3OLGA 4DBDA 5F4WA 1EUAA 1E3XA 1EX5A 4J28A 3U8GA 5I3KA 4J3UA 1H62A 3A21A 1I2PA 1W5NA 2YFOA 3BPWA 3K30A 4OKDA 3CQ0A 1FDJA 5CPLA 3M44A 8TIMA 1BKSA 4LNYA 3UWQA 4TO8A 4W93A 3PF3A 3II1A 1GVSA 2AAMA 4QM1A 5F7UA 1VCFA 2DZWA 3SSJA 4A22A 1KFJA 4DO4A 2D0FA 1VAHA 4FNUA 5EYWA 2ABBA 2NV2A 3W88A 3CV5A 3AJ7A 4PCSA 1WXJA 2YXGA 2WNWA 3MI3A 1LWJA 4O50A 4L4MA 2QPUA 1S5TA 2GPTA 2NUWA 4LRTA 4IMDA 3L21A 1BF2A 4O13A 1TQTA 4AB4A 1WP6A 1LDCA 3NZ1A 4M6QA 4JCMA 1JI1A 3AXHA 3HZ3A 2BXYA 1YDOA 4JGDA 3S6DA 4LTSA 5G4EA 2WCGA 1NFBA 3TQ0A 3TW7A 4M8UA 3QYQA 4WUIA 1KWKA 4RCXA 4N9BA 1WQ5A 3EWXA 3GXTA 1D3CA 3QFEA 4M6PA 2F84A 3U2OA 3BK0A 1L2UA 1YYAA 2YA1A 2C0AA 1QMLA 2EAWA 1EB3A 4K7VA 3W7IA 1PVNA 1KB3A 4LRSA 3WDHA 2ZRYA 2ABAA 3CEPA 1VS1A 2ZTJA 1GCYA 2WNQA 3MHFA 4PFMA 5U4NA 1AG1O 4JIQA 1JXKA 3LRKA 4FLSA 3L5MA 1TV8A 3R5EA 5BRBA 3LDVA 4ML9A 2VUYA 4GUGA 2GJLA 5LHEA 3EDDA 3VNZA 3TROA 4N2YA 4OBTA 2C6QA 4KFNA 1M6JA 1HX0A 2YA2A 3LPPA 2A85A 2ZUVA 2VNCA 2F1BA 4AYSA 3WY4A 1K7EA 2QCFA 4UIOA 1KV8A 4JYFA 1BLIA 2V0TA 2V5LA 1B57A 4AWSA 4K36A 1HO1A 4K38A 1W56A 2H3DA 1S46A 2J9YA 1GVIA 2VRQA 3TKFA 3GVGA 4U31A 2CLHA 1O7DC 1H1YA 5EY5A 5A5WA 3TX9A 1Q6OA 2V8ZA 1PAMA 1UD6A 2Z0IA 5CZ0A 1B9BA 3A9IA 1M53A 4LVFA 3D51A 3W2NA 2ZE0A 1UA3A 1YTKA 3IRDA 3CZEA 3G1HA 1MO0A 2F7QA 1I2NA 1G5AA 1V3MA 1TO3A 2IQTA 3CC1A 4JS3A 3NQ7A 5FF3A 4X9YA 1XH1A 4N6FA 1F76A 4A29A 5LNWA 1SW7A 3BARA 3KHJA 5E0FA 4PODA 5EPDA 3EWWA 3SGZA 3O8AA 1BWLA 4PCFA 2WQPA 3R12A 4GXMA 3OLDA 5H91A 2HMCA 5K2ZA 3BG3A 3UWWA 2V81A 2E6FA 3I68A 4DF0A 1BTMA 4UFHA 2V3FA 1V3LA 1XDMA 1V5XA 2LLEA 1KXTA 2PRHA 3M16A 4MB1A 3AXIA 1SO6A 4CCDA 4N9CA 4B5NA 3QZEA 5HDRA 4ZQOA 2YGYA 3LGEA 3M43A 5LNVA 2BY0A 4ADSA 3SW6A 3CZGA 3OIXA 1NAL1 3UXAA 1QOQA 3DX2A 5A6LA 4MFEA 2ALWA 3HGSA 3M6YA 4U33A 1P6WA 2QCLA 3GKAA 3PBUA 3OVQA 2J9ZA 2AMGA 1EUNA 3LXAA 4N9DA 2ZUTA 4UMAA 3P67A 1L6SA 3OLIA 3LCLA 3UXDA 2ZYFA 3LHZA 4JX6A 3LBCA 1EO7A 4JIPA 2QCDB 4JTIA 1R2TA 1QHOA 5AHNA 4AMXA 3I6RA 3L68A 1QI5A 1JULA 4O1AA 3P82A 3GXDA 3WEOA 4MLRA 3TUUA 3H53A 3EDJA 1BEUA 4O53A 1DKWA 4FNSA 1ADOA 2VC6A 2E5BA 1Q6LA 5HJLA 2AGKA 2QV4A 3QW3A 1YPFA 3R89A 1VH7A 1TTJA 3L4TA 3N14A 1KTBA 1DQXA 1X8FA 1UH3A 3LV5A 2E6AA 3W86A 3IGXA 4J9JA 1YPIA 4Z0JA 3W1TA 1R75A 3A47A 3NL2A 4JYDA 3VX0A 3GBEA 1J0JA 3O15A 2Z6IA 4MJZA 3MJYA 1A47A 1MSSA 3L65A 3VGHA 2NX1A 3HBLA 5H2ZA 3RNDA 2Y7EA 5G2HA 1AMYA 3LI0A 1OT1A 1KLZA 3KAOA 1IGSA 4BR1A 3K8MA 5D37A 3EX2A 3D4YA 3ANYA 4WQ6A 1VHNA 1KM6A 3QF0A 1OX4A 4OJYA 3IIOA 1P0KA 3NL3A 3TC6A 4DF1A 5BMWA 3G24A 3KOFA 3G3MA 2G5WA 5CZTA 1W9XA 3LHTA 1XI3A 3HO8A 1JRBA 2DZPA 3ZT6A 1Q6RA 1FQ0A 4WF7A 1KGUA 1OK4A 2NT1A 3GXIA 4O1DA 4HHPA 3VE9A 5EA9A 2Y7GA 2WSQA 1F7BA 4O4WA 4UNLA 3BH4A 3GDKA 4CQAA 2CZ5A 2ZRWA 2YFNA 2V9DA 2JBMA 2FB3A 2WVVA
chains in the Genus database with same CATH superfamily
4Q7IA 3N50A 4MCNA 3BWSA 3S98A 4Z3JA 2ZWNA 4C5YA 3LOYA 1AO7D 1Z9MA 2F9RA 3HNVH 4U1GB 3K5XA 5K7JA 1G4RA 3BG5A 3EGXA 3STFA 4I77H 5CIPH 3ZQXA 1M7PA 1QNQA 4H41A 4LANA 1AOHA 4NIRA 3IKCB 5IJKA 4NC1C 3P3RA 3T9WA 4OI7A 4XMVA 2A4AA 2A6DB 3L3IA 1M05A 4C4BA 2OQHA 2YSSA 4EK7A 2C1HA 2YMOA 1QVBA 3FPYA 1QQDB 1JNHB 4O0ZA 2EDLA 4X4ZA 2X2UA 4ZTEA 3HUJA 4X7DC 3M8OH 3D48R 5LSMA 1DVQA 1GQNA 4NNPH 2FNWA 1PX8A 5K9KA 2V37A 5HI3C 5K9OA 3MLYL 4QP0A 3Q45A 4XAPA 2AJSH 4RZ5A 4HNUA 3EFDH 1XZ0B 2OMTB 2GSIB 5C1MB 2WKGA 1YY8A 3TXVA 3G6JE 2XWJB 4PG9B 1MG3C 5ICXB 3RWJA 3SE9H 4PC8A 3U7BA 1KBIA 3R11A 1V6UA 5ABDE 3OJ2C 4K3AA 1J10A 4AEFA 1FBAA 1UC6A 4BGDA 4GKOA 3OR7A 4WXZA 4MJID 3NSDA 1P6BA 5LVEA 1SIIA 2ZXDA 4TVPH 1YZZA 4O1EA 5GGTA 3VIJA 2YPLE 4HUVA 5IEKB 3CFUA 4HWBA 1XLIA 3I2CL 1XGQB 1F2JA 4JRLA 4N0YL 4F58L 1H61A 4N68A 2XIQA 1UUSA 1SSDA 4Z1BA 1LK3H 4OZHB 4MD0A 4UV4L 1A3LH 1YMYA 3FO2A 4LNRB 4TNEA 2CM5A 3V4PH 2EYTA 2DLHA 3BW9B 1WBXA 5CJXC 3DC0A 4K1WA 1VADA 3WLBA 2PR4L 1EAPB 1RHHB 3BGGA 4ZDHB 1HMUA 3C61A 2GSJA 4PR4A 3G3DA 1SN0A 4U49A 2Q09A 5GZOC 4PPTA 4A6GA 3FU7B 5I74B 1DJIA 1A7RH 4O4VA 3BSZA 2OL3A 5H8MA 3PJWA 3VXRB 1IC7L 4P04A 4PE8A 1MF2H 5MEPB 2ZUQB 3LCFA 1HK6A 1QLEH 4LBSA 3KLKA 4HGKC 3BLBA 4ZOAA 4Z0BH 2V17L 1JV5A 3M88A 1I0BA 4ZMWA 1SYSB 3EOYG 5C0EB 1J0KA 1QEXA 3WKMH 1YMHB 2PRMA 1MFAH 1GGIL 3S6OA 3CFDB 4G6FB 2CFWA 2JJVA 1M1XA 5L8LB 1EYEA 5CLTA 3FO0H 2VLMD 3TYCA 3N1QC 3KPQB 3RPDA 3D3AA 2GUYA 2N7SA 4X4ME 5DI8A 3K5RA 5E0QA 4TSBH 1A4MA 2VEPA 2A74B 1NFDF 1UI7A 4UQEA 3MXVH 1AJZA 3GHRA 1XF2B 4X8JB 2ICES 2N3JA 2OJZL 4GW1B 4ADIA 2X1OA 2A0NA 1T7ZA 4KMTH 3BV4A 3CBWA 3VXQB 1KY6A 4Y8EA 1N7MH 3R58A 1P5BA 5E93A 5TBOA 3WO3B 4X3ZA 2PW2A 1IEWA 4IBWA 2YAFA 4ERIA 3QTGA 5JMRA 4PJAB 2BH0A 5HP5A 3V0VB 1ADWA 5DUMH 4AGNA 4NRYB 1U91B 1GIGL 4CMMA 3P0YH 1V0KA 2FDSA 2IAMD 4YUEL 1I3RA 5DS8A 1FP9A 2HTLD 3DVIA 5ID1B 2DQGL 5AOLA 2M83A 2ZF9A 4PVNA 4LEXL 5I0DA 2BVWA 5DMMA 3HMCA 4EI5B 5D5ME 3QXBA 3AW5A 1XL4A 4KO5A 5AYQA 4AH2B 2X6CA 1NEZA 4PD4J 1JK9A 2GKIA 1T66D 1MCKA 4DEWA 1GGOA 4XISA 4AYFB 2ESVB 2PUQT 2C19A 4V1YA 1IE5A 1ZA6A 4JPVL 2I26N 5CBEB 5HGHB 1QW8A 4Z18A 2EVIA 2BGNE 5CFAA 1ZHNA 2XIOA 4IM4A 5IP4A 2CIQA 3V79C 3AB0B 1MKFA 1A5FL 4MD4B 1LO0H 3XINA 3G6MA 3QEQB 3PUEA 1NOLA 2WMIA 1J1PL 1UGKA 1F3XA 4GXVH 2H3NB 4MQ7A 4Z1CA 3D07A 4RRPG 4O0QA 4W5ZA 3IJQA 4NU7A 3KL0A 3MBFA 1M42A 1OTUC 4CJ1A 1ECQA 1EFZA 4NQDB 5EEUA 4HJEA 3BYYA 4EVNA 3UYCA 4D1JA 3X3GH 5D05A 4Y5YC 3O3EA 4L2LA 3T3MF 3SPVA 4NEHB 2EE0A 2Y0SA 3QPEA 3VSNA 1S9KC 5G1MA 3USZA 1MRCL 1AJ7L 1GY2A 4PGEB 1ZLSH 4AZ8B 4OF3A 1EP3A 5DY2A 4XAWH 1SYTA 2V82A 4XI5C 3ZHFA 2XIJA 3BFOA 3RVVD 3LKNB 4P5MA 1FLTX 1E4XI 1TJMA 3MJ9H 2VSCA 5EL1A 5D1QC 3TXAA 4AC1X 2CR6A 5EPMB 3PWNB 2F74A 2BRPA 3SE8L 1IVWA 2UZXB 4LKXA 3CFTA 4LUJA 1BGAA 3INOA 3W0KA 4DPBX 1QSEE 3N9GH 4JDTH 3ZKNC 3ARYA 3FYYA 2VENA 1H60A 3L5HA 2YUWA 4U4BA 3REQB 4I9JA 4C1LA 1HQRA 2A83A 4GJJA 3UZEC 3UWEA 1NF0A 2YYUA 4YU1A 4UT6H 4QGTA 3INUH 4GFIA 2FEEL 3WLMA 1ZGLP 4F20A 3NIDE 3BXNB 2Y24A 3TLQA 2OQLA 4NRRA 1E4IA 2ZRZA 5JIDA 2VI0A 1DN2A 2C9AA 4GUOA 3ZLGA 2CHXA 5KTLA 3MGTA 4ZUUA 2PKDA 1RLWA 4N0FB 3VSQA 1EJOH 1YEKH 5HJXA 2P53A 4XC1L 4K94L 4H1LG 1OP4A 4PJ6A 3H2EA 4UV7L 3K81A 1ZUAX 1T0OA 1TPVA 3FB6A 3CDGB 2X6MA 1H8NA 3GSQA 2GK2A 1NS8A 4IHOA 1X6UA 3I4KA 1RQBA 2X41A 5J5DA 1LE9A 1GZQA 1QK2A 3TN0B 5HVWA 1LROA 4GUPB 4ADTA 4Z2KA 3NDZE 1OL0A 4WDTA 5J9PA 2AJXH 5D4JA 4S2SA 1XIDA 2OBGA 1NSRA 3MYPA 3A9BA 4MXVE 5A7BA 3VIIA 1X9UA 1TPC1 4GUJA 4OCYL 4FIRA 4GG6A 1XR9A 3PB2A 1J2BA 2QELA 5IUCA 4JO5A 4L5FE 5FHAH 1MAML 2ZXAA 2HPTA 4ZE4A 1HJUA 1TFPA 5HJ3B 2WNZA 4HNTA 2NY0B 2AEQH 3UZVB 4OGQC 4RDQG 4FNLH 4NLHA 4KZEL 1VRDA 1R4XA 4KWVA 5E08H 4TYUA 3GAKA 2J1XA 3KCPA 4WVRA 1CFNA 2E7BA 1USZA 4AMKL 1MFBL 1K85A 1GOOA 4FABH 1AGCB 2ZVIA 3M7SA 3ABRA 5DJZA 1WBYB 1TJIH 2JKIS 3GMOB 3GJEA 5DRXA 4LNCA 4S1SL 1XR8B 4Z7WF 5TF1H 1GG0A 1UFUA 3LERA 3WD0A 2E27L 1NCWH 3GI9L 2I60H 3ULUH 2OM5A 5KANG 4WI4A 4MNQE 3PZ9A 4JNZA 1GNXA 4C6DA 4ELKB 3MLVL 1HG3A 4AX7A 1E5JA 1GWJA 3DBPA 3G1DA 3WUZA 1QFUL 5ID0A 2HH0H 1QUPA 4PS8A 3MV8D 4UOW1 3N85L 2WNGA 4YVXA 4JQ3A 1XINA 4NXSA 1DSYA 2Q3OA 5F7DA 1SQ2N 5JOPD 4OJDH 5TQ2H 1VBUA 4ZS6D 5F2IA 3BJLA 5MENE 4RWHA 1XJBA 4L1DA 4QROA 4NHVA 3WYRA 1MRFL 1G4EA 1ZBWA 3CFIC 5SWZA 1XFPA 1XHGA 1GYCA 2WBJA 1WKFA 4J3BA 5FPIA 4WK0B 1NDGA 5HBFA 4KWWA 1PU0A 3NEHA 5DMKB 3C0JA 1YBQA 4X7EC 3F2DA 3VXNA 1NWSA 2PSNA 1HJSA 2Q5BA 4BCYA 2OR9H 4OJAA 3RHGA 3QZPA 3O2DH 3CEUA 1D6VH 1IAII 1GGYA 3EO1A 3P30H 1IJ9A 4G6KL 4X5PA 4MS8C 3KHQA 5T9CE 2NY1C 4ZFZA 5CC7A 3A6CH 4AF0B 2D9CA 1I7RA 4K5OA 1ZAJA 3IXAB 3WEMA 1PZ0A 1PJ9A 3AU6A 3KNBA 1R2SA 3QMSA 2HS8A 3GWQA 3RDTB 2RQ8A 1ZA3A 2APXA 1ILSA 4AQAA 4YHKL 1RURL 2J7DA 2B9AA 1DQWA 4H0HB 3D4CA 3CSBA 2WYZA 3SQSA 25C8L 3WQEA 2NY3D 3W7RA 3V5FA 5T1KB 3QQWA 3GFUA 1IGMH 5FF6A 3QW4B 2X87A 5K4ZA 2AKRA 5A94A 4RFOH 2WXMA 3L3HA 4MIMA 2MCG1 4NJKA 5LA0A 5AW6B 3JWDC 2EC9T 4ZMAT 1TSRA 4PCTA 1FGNH 4ZSTA 2IAAC 3THQA 1IIHA 4KGJA 1RIHH 3VSTA 3GWJA 3BWZA 5D7JC 2H8PB 4B0MB 3ZW3A 2AMXA 4YGVB 2WBXA 5HHOA 2Y06H 1SLXA 4P46A 3C60C 5D1QB 2CMRH 1C5BH 2FTPA 1H9VA 3CAWA 4L9LC 1RY0A 5I0ZA 3WBAA 2YLLA 3WH9A 3ZR4A 3GTVA 1QRNB 3EA3A 3RNKB 1KCVH 4RFNC 1GGBH 5A6BA 2OGYA 4JICA 4PM1A 5AC7A 2PR9A 3FO1A 4OZIE 2Z24A 2ID5A 4XMKH 4PCYA 4Q22A 1ECZA 2J47A 3CWGA 1G67A 2DZUA 1JIBA 4MXQC 1CURA 4M81A 3G04B 5F96L 1HKIA 2EUWA 1SFTA 1IX2A 2DM4A 3LH2L 4WFED 6TIMA 5F1UA 4JTCA 5JIIA 1C7TA 1UWEH 3MZGB 3GPEA 4LCUB 5JYLA 3CJPA 1WNOA 3A4AA 3X41A 4RGMB 4FS9A 3EFFA 2B7DT 2ZPKH 5CMAA 2IFFL 4JO3H 3LI1A 1QKZL 4A7SA 4LOEA 2VIRA 3WFCH 1CDIA 1WFUA 3CIQA 5IG7B 4PUKA 3HC3H 5JHLH 3CNKA 5SX4I 2GPZA 4PTVA 5KSBF 4ZTXA 5IVXE 5BZXA 2C0HA 2Y7LA 4WCYL 3WK1A 3ATYA 1W17A 3KXFD 3QN3A 5E1QA 2VMJA 1URLA 2X9YA 5B7YA 1YEFH 3N42B 2R2BA 1KLYA 3BD3A 4JJOA 4CQ9A 4REQA 4ONVA 3RAJL 5JMFA 4KFPA 5HVFB 2IXQA 2AAVA 2X1TA 3FQWB 3CWNA 3SZ6A 4Q6KA 4IL2A 4F4RA 1DBKH 3C5SA 5DJ6A 2DQJH 4H2CA 3U7YL 4LHJB 3MRRB 4N0UA 2I7SA 4YNGA 4KKQA 2P47B 1OAZH 5LA1A 5GIRB 1BBDL 1Q6EA 5EOQH 5FWQA 3RZCC 2Z31D 4OZGF 2I17A 3EPNA 2GJ6B 1HJVA 5ES4B 2AEOA 1PZUB 3O16A 2XN1A 5J6GB 2D22A 2NY7H 2JMRA 2LOEA 3Q9QA 3UFIA 2PI6A 1Q6GA 1QWNA 1AZRA 5EN3A 1N5YH 3GMMA 3QV8A 3HPLA 1BIHA 1ZDSA 5IUSA 1N7NA 1MXGA 5D2NE 4K3EH 1O6SA 1O68A 2HV5A 5DTFB 5DHVB 4DWDA 3EXLA 2AV1A 3VXSD 1W0YT 1U3NA 5CSYA 1DSWA 2JF6A 1O4UA 1K8XA 3UTTA 5FF2A 3WK3A 1OTTC 3EFOB 4DO7A 3QDGD 5E8PB 4PJBB 2ZYHA 4GBXA 3S4SA 4H83A 2W9LA 4KZ0A 3BT2H 5E2TH 5B38G 3T0ED 1QZNA 2A99A 4MLJA 2HP4A 4G7EB 3OKOB 4BK5A 3T2PA 2OU4A 1QVOA 3V7AE 1K03A 2G3MA 2R0KL 4DEUA 2IV9A 4KK9C 2IW0A 2BXZA 3T2NH 4YNYA 3R8BB 4H20H 3VFVA 1CL7L 4EDWL 3NA9L 3DG6A 1TUXA 1TMQA 2WXQA 3MUHL 3SDXB 5HPMA 2W0KA 4JK0D 1XP3A 2A2QT 3VXUE 4FTDA 5EO0A 3QI9B 1FO0B 3RR4A 4LQ1A 4U5KA 5B7EA 4C6FA 1TTUA 3C9NB 3HI5H 4JTQA 4P2VA 2PTDA 1T7VA 3A4XA 3DMMC 4MMXA 2AKMA 3HPFA 4KTGA 1ET5A 4NS0A 1AR1D 4UCFA 2G75B 3BUYB 2YSWA 1WAWA 3BGMA 4UNKA 3KYAA 4EV5A 4HA0A 3GTIA 3O07A 4Q33A 3IUDA 4AQ0A 3ESMA 3AICA 1DQKA 1S7QB 4H8NA 1W5OA 3HAEB 4CUCA 1T22B 4HS6A 1RULH 3HZKA 3BPWA 1RZKC 4V15A 5DZNA 2FGLA 2G0WA 4WKZA 4BQ9A 3PZTA 5AALA 3VFNB 4I18A 1UQZA 5I1GL 2DZWA 1XLLA 4A22A 5F0PB 4OQTH 4LDEB 3O8XC 2P80D 5CF3A 1OC6A 1I8UA 3SCTA 1WKEA 4CD6A 1WP6A 4HBQA 4NP4L 4HA4A 1FVEB 4JFPA 1ZGLM 3C60B 1F41A 4K0OA 5I17B 4E0RB 4OLYH 3JWOC 2V2WA 3I6GB 2EDQA 1JE6A 4KPLA 2IIJA 5DHYB 3VQMA 1EDGA 5H8UA 4K2UH 3VOGA 4YS1A 3O45A 3CFBB 1PTAA 4ML9A 1CGSL 1M7UA 3VNZA 1OF2A 3GW0A 1T1ZB 3ZM8A 2ARJQ 2QCFA 5CD3B 3L5WA 5EUOB 1HO1A 4XP1L 1IGTB 4LVHC 4K38A 3UAAA 3GBNL 3EG9B 3GVGA 4WSHA 4OIBA 1DFBH 2P5WB 4CSTA 1QOXA 4TVPE 2W66A 3D51A 3HVDA 2X0SA 4NN6C 5C08A 4CNSA 1ZCRA 1IFHH 1WFTA 1TPXB 5H91A 2FL5A 4N0RA 1AXSA 3ARUA 4H4NA 4BH8B 1KXTA 1DCEA 3M16A 5IWLA 5DZPA 3HG1D 5HDWA 2LABA 4B5NA 3QZEA 3VXMA 4ADSA 3SW6A 5TJWK 4EX4A 3S3PA 2E47A 1P9MC 5I73B 1C8PA 3T81A 1OY0A 5LAPA 1TU5A 4RISH 4N9DA 2GEQA 1NGZB 2ZKYA 2AJYH 1S2WA 2OMUA 3LBCA 4IRSA 4JIPA 4LGSB 5E1AA 1QHOA 1KYAA 1ZS8B 3V6FA 3GXDA 4EAMA 3APCA 3AXMA 3F3HA 4D8ZA 4U7MA 5DCCA 4LAJH 4RQQB 3PWUB 1YEJL 4KDTC 3L4TA 4IQEA 1N68A 1FWBC 4JFEA 3O6LH 4CILA 3E1ZA 1BQHG 5EMKA 3NVQA 3MSDA 5FGSA 1QR1B 3ROOB 1Z2KA 1IGSA 1T5WA 5D37A 3SKJH 2EDNA 5K59F 4LCWB 1VHNA 3KJ6L 3ROLA 2MOQA 3VXPA 3LHTA 3WTWA 1E5NA 3PS6A 1LQAA 1SDDA 2RBLA 1MELA 3QAZC 4JFFB 1DVFB 1YVLA 4PUUA 2CZ5A 1C8XA 1T04B 3VABA 4X6BB 5EBWB 3V5DA 2GCYA 4LLUB 5BO0D 1M5WA 3LENA 3PXHA 3VZZA 4J1UB 3AMOA 3VKAA 4OW6A 4PWFA 5DCEA 3UCQA 3M4HA 3B05A 4ZFGH 3UZWA 5J6HB 4AE0A 4U6XA 5DC9B 3K71B 4F2TA 5M03A 1JN6B 2WLZA 4P3CH 5BRZA 2GUOA 1K9TA 4L6OA 2FJGB 5I6NA 5E6ZA 3LSOB 1GOMA 3ULVF 4XMLH 3ITVA 1B4EA 1NSUA 43C9B 3O4LB 3F12B 3V6OE 4I8YA 1YDPA 3VFOB 2YEZB 3S34H 1E27A 5DURD 2OXNA 4G2DA 2DWEB 1ND0B 2P1YA 1XLBA 2B08A 3S2CA 3W75A 1P7QA 4GPVA 1OACA 4PUJA 4DPCX 4ZAKA 4UBPC 4GG8A 4X9GA 4Y4FA 3QUYC 3TZVD 1A4AA 2GBTA 1X7QA 2PWGA 4JKWA 4ONOA 2P8PB 5TAOA 1URIA 3SGDH 2ITEA 5CN3A 2QV2A 1IC4H 4Y16A 4L3ED 3ZE2E 3LLDA 4FFVD 2ZSVA 4XCCH 3T4AC 4G8IA 2FWUA 2J8OA 3GTXA 1AXTH 1TB3A 2RFXB 1P2CB 4AHOA 1IFGA 2MHAA 2J1KA 8XIMA 4GB9A 3P62A 4P7LA 2H2SD 2ERJB 2CLEA 3TO4A 4A7QA 2A0LC 2I24N 2B1AL 4M1BA 3QCVL 3G2GA 1FKWA 3QUMB 4HMCA 4BCXA 3MBWA 2XYLA 2AQQA 1R17A 3OXRA 2FZNA 1CK0L 2BNQA 5LBSA 1DANU 1FCUA 5FFOA 4ZPVA 5IJBC 3KPSD 3FN0L 3CDZA 3EO9L 1E30A 4YFEA 1J05A 4GEJA 1G0DA 4TM9A 1FWIC 4JFXA 1Y5WA 3IDYB 3GSUB 3Q4DA 3DHDA 5D09A 2E7LA 1FNSH 3MCLL 4WJ5A 2XDHA 2WVVB 4Z0XA 1CLOH 2WV8A 4S3EA 3F01A 3KGRA 1KENL 3RRXA 4N5ED 3LHYA 2BSTB 2PTVA 4XVJH 5D6CB 4M8RA 4FYTA 2JB6A 5FUCC 4WJXA 1JMZA 4J8RA 4D9RD 2QDVA 1U93B 1PMYA 2BJMH 3CFJA 3EMCA 2YW3A 2NR6C 3LTVA 5LYRA 5IB1A 3T65A 5D7IA 5KBDA 3BUBA 1TETH 1QFWM 4XR8C 4N8CL 2QVIA 1HKFA 1ZLWK 4GKTA 2Y22A 4H8HA 4PJGB 4G9FA 2A2IA 2VR5A 1LO5B 4OWGA 3FT3A 2XT1B 2VWEE 4X4YA 3GEWB 3UTOA 4C4KO 2VSMB 2WQXA 2P8MB 1G7QB 4NUJB 3MTRA 1A4JB 1V8HA 5CC5A 3AS1A 5FUZL 8FABA 2OZ0A 4IGNA 2YA0A 2Z0UA 3NIFB 4YSPA 3UGXA 1RKRA 4HULB 4AVFA 2RGSA 2BPBA 3EB3A 3RUGB 2AK4D 4IQDA 3K6DA 3ZYZA 5FXCH 3VFWA 4MADA 3CHVA 4JZOB 1DWHM 4L8DB 3O0RH 3VZXA 2Y7SA 5L4MA 4TLKA 3JZ7A 4YN3A 1KCLA 4ZUTB 4TTDC 5D70H 3LB6C 3GMQA 2EILB 4KK8C 4HPOL 4JIRA 3EYOA 5IMMA 2VDLL 1VACA 4GKSA 3BPLC 3D3VD 1E9OB 5G55A 2OJ1A 1JCYA 3RLGA 1P4IL 2VZTA 3W53A 1B9KA 3G5EA 2WIIB 2VDRB 1W5MA 5KN5A 4PJ9A 2ON3A 2W61A 3I6SA 3T4CA 1LBMA 2IBZX 3PLYA 1HH9B 2WJZA 4W6XB 4CVZA 3EH1A 2A3HA 4L5FH 1FBIH 1YN6B 4JDEB 2FEDD 2DVUA 2QTEA 2K7PA 5AKVA 1VZIA 3UGVA 2FYYB 4QRSB 2FWOB 1PDKB 4AGQA 2KYIA 3KW8A 1P7TA 1BYDA 3K1KC 1OAXL 4NAMA 3J7HA 4CU7A 5FJOA 5E1IA 3W28A 1CGUA 1S3KL 5FJUA 1NM4A 3BLPX 1DVJA 1UEYA 5KYWB 5BXSA 2ITCB 2R23A 4BSJA 2R24A 2O92A 2ZX8A 4Y1AB 5KBPA 1Z0MA 3VC6A 1V5JA 4M4PA 2AJZB 1TQBC 5HJBA 1Q8JA 7XIMA 5DN1A 3CUZA 1RK1A 1XL9A 3WXVL 1XF4A 1HHJA 3TBBA 4TPRH 3SKOB 1B3OA 1ZVNA 4ZSOA 4DETA 2OLHA 2R0LL 1JQVA 3WJZA 2E74C 4FL4C 3KHOA 3C6SB 1IE4A 2DQIH 1ISYA 4R83A 4DGWC 1PDZA 1U3HC 1OGAA 3D0AA 3APGA 4HG4K 4CD5A 4WTQA 3MRPB 1F6AA 4H1LA 4ZNEE 3PV6B 1P5UC 4APQD 1N4XH 4MZ2A 1FNLA 4GY0A 2V9UA 4IPPA 2XWTA 1SEBA 4J3XA 3GPSA 5E4OA 2HRHA 3FS2A 3MDWA 2EG6A 4HIIB 4LBUA 1WX0A 5JH2A 4ZYKB 1Y1UA 5C0ND 3QUXD 4GW4A 3VA2C 2MCMA 1TVPA 1HJCA 5IESL 2APVA 3T0WA 3UWUA 5DXWA 3LHAA 4OZFA 3P61A 5E99L 3C6LB 5JW4Q 3FU9A 4LAMA 3TR2A 3GTFA 3LEYL 1KTJA 1X5FA 2IG2H 5L4JA 2NX9A 1O60A 3S35L 3IPFA 1JZ8A 2CBOA 2EEFA 1A7QH 1C91A 5MEQA 4U6VH 3WSQH 3RMJA 1V3KA 3G9VA 1YPXA 4E5XB 3FQNA 2WLJA 3N2TA 4U1NA 3DECA 4MJ4A 2CZDA 1WF5A 3FPXA 3BG9A 4QNWA 2XRAL 5JUEL 5C9XA 2W94A 4LUIA 3UP8A 2EDHA 2G95A 3S36H 5DGQA 1LO0L 1BEXA 5GHWH 3DBXA 1SUXA 5IBLD 1CDUA 5HI4D 3V0WH 4Y9AA 3SE4A 3TV3H 4DT2A 1WO2A 3OHXC 4GP5B 5JXEC 1OYAA 4UQ9A 1KBKA 1OFAA 3EOOA 2HTAA 1SMAA 5IMOB 1S7XA 2VYRE 2GC7C 2L7JA 3CB8A 4FTVA 4PJIF 2HFGH 4DUXA 3QJFB 4ZEPA 1Q0XH 1WK0A 3UH8A 3RFZA 4NAQA 3X2QB 3VYPA 2C5DC 3MDJA 3TTEA 3H22A 3KLSA 3B5TA 3V4VL 1N26A 1LM1A 1UH2A 3SY0B 1RMFL 3W7MA 2N01B 2JJTC 2PPCA 4ZUVB 4RUBA 4TKWA 4NASA 4W7WA 2FGWH 1F6PA 4XPFL 3E3QE 4OB5L 3ULSA 1NOAA 3S0PA 3AU2A 1F5WA 3QFZA 3FIGA 1A7NH 5IFHL 4IMLA 4WKAA 4N87A 3WLJA 1ZBVA 5T9BG 5DEJA 1NLBH 3MLWL 2EYSA 4PIBA 1JF1A 1SBSL 1YNTA 2YCIX 4PS4H 4HUWA 3ANVA 1WA1X 4QHNA 1ZHKA 1NAML 5AUMA 2G50A 2X1PA 1YKWA 2AGJL 2O61B 3INUL 4H40A 4UQCA 4ALAC 4OD1L 3E02A 2P5ED 5D7LA 4GI6A 5L2KD 3GNNA 3SQOH 1NA8A 1ZV9A 4XNBA 1AH1A 1SVCP 3OBAA 2Y5TB 4F3FA 3ATEA 1VFBB 3S36X 1I3VA 2DJ4A 4FQCH 3QUZD 5HATA 3PK7A 3N3EA 4GKNA 3HBZA 1E8XA 3I9GH 3RX2A 2QQKL 4X2RA 3WLRA 3CHOA 4LE8A 1I2OA 4L4VB 2WHKA 3FB8B 3WS6C 3H2WA 4RL3A 4XZMX 1NFIA 1MVFA 3QEUB 2V2TB 2FQFA 4AEIL 2XDFA 3U30C 5BRPA 5CSBA 1CFSA 5GGUB 4KW2A 4XBPB 1RZMA 1I7UA 3EDFA 2Y61A 3FMGL 4OFIA 5FF4A 4Z17A 4L1GA 1BF6A 1FL6B 5DWPA 1F6LL 2W59A 4YHPA 4WEEA 4U1JB 3SX1A 3IMRA 4IEFA 1QLRB 4JFHD 5SV3A 1ETZA 1BMWA 2BVOB 3PUOA 3VFGH 5LGZA 3EOAB 4EPDC 1HINL 3DARA 4V1XA 2E28A 3LV3A 5GJSH 4BM7A 2UUDH 4NQCA 4UQ2A 4X6CF 2CR3A 4GYPC 1TJIL 3WFHA 5ITFA 1T99A 1NPJA 2MPAL 1M6UA 3TEUA 3H7VA 2PDIA 4NZ3A 3MRLB 4L2YA 1JWSA 5JIHA 1X44A 4HT1H 4AGMA 1ZFJA 5CZKA 1TCRB 1KELH 1U3HB 2YAHA 1DN0B 2BS9A 3KPSA 3LHPH 4JCWA 5EA0H 2Z93B 5K1JA 1E67A 5BV7H 4XN5A 4RA3A 2D2CC 2F0CA 1C12A 4Z2HA 1V79A 4JTFA 3RNQB 2WXGA 3BE7A 2ZP9A 3GB6A 3QZBA 1HOCA 2HVKB 1T3FA 3BESR 1TLKA 5CAKA 1UIOA 3GG8A 5LN8A 2DEPA 3SKMA 2H90A 4O15A 2HCZX 1EDYA 1PF3A 3LKQA 1E4JA 1CGXA 4LEQA 2ZG1A 5AW2B 2Z1KA 5ECUA 3CFQA 1L9RA 1IWPA 4IGHA 4KCWA 3EX6A 4YHMH 1WGOA 1G87A 5KSAD 4QXUH 1I60A 3MJ6A 1B6UA 4HFUL 3IIXA 1KCSL 4YHYC 3EWDA 2CFGA 4I1PA 4Z7QE 4G6JL 3ACTA 2OFJA 2OG9A 4X8XA 4D0CB 4F8LA 3AIVA 3QV9A 3EBVA 2P8BA 1GPOL 4YQXH 5E0CA 3T0VA 3FYIB 3BSHA 4OZ4A 4MMWA 2AK4A 3ESVF 4QOKE 4KQNA 4MMHA 3ARGD 4FF7A 3ZZSA 3K6SB 1RLCL 3TA3D 2PYED 4LVBA 4AD5A 4X99A 5GGVY 3C12A 3MFFA 2YQGA 1HW6A 3U2CA 3DVNA 4PV9B 4IBLT 5C0CE 2EDMA 2ZIDA 3QJHA 1BVNP 3ULUD 1YX1A 3C2FA 4GY4A 4YHZH 5A8PA 5C07B 4OGYL 3UO1H 4HS8L 5GSRB 3VCCA 2VDHA 4BZYA 2GAZA 3CK0L 2FO4B 2W3ZA 2FGZA 4XAZA 1D5MB 2Q3AA 3AU1A 4XX1E 3HG5A 4TX9A 3VB8A 2FQIA 4B0MM 2Z8RA 2VXNA 3AYSA 3NO1A 4YDKL 2JKLA 4FXKC 2BC4A 4FB7A 1JNEA 5EFDA 4CDHA 4NZTL 4YXGA 4HCRL 1X1IA 3VIMA 4KDVA 3KAAA 4M6AA 3ME0B 4OZHF 3KVJA 2I5YL 3G5WA 3EBAA 3RWFA 2BXVA 1HL9A 2BP8A 3DGRA 3LMZA 4AQLA 4ZUSA 3HZVA 3MNWA 2F18A 3M07A 2XPYA 3DK0A 4GZIA 1GOGA 1R3HB 2A9CA 4KEUA 4HEME 2E9MA 3TW9A 4DPQA 2ZXEB 1IKNA 3N9RA 3AWOA 2EXOA 1W2ZA 1Z9SB 4IIZA 2P24B 4XUYA 3NQ6A 5FKPA 1XIGA 3MBED 4NPYA 1NCTA 5INDA 1O75A 3BP5A 4WGXA 4BWWA 4GIRA 3WD5L 1DSFL 4QRFA 1PZDA 3L8QA 3NG3A 1DVUA 3P73A 4WEBH 1B2WH 5F3HB 1BYNA 4CN6A 3C4UA 4ENLA 1FH5L 1UFGA 4Q9QH 5FYJE 4PJFA 3NH7L 3VU2A 1K1DA 3ABGA 5SV4A 5BOZG 4DQOL 5KTEH 3ECQA 2X4OB 1B0IA 2PDWA 3TH2T 4OCRL 2Z65C 1TTRA 3ZBMA 2HJKB 1MH5B 3H2AA 3ECWA 1KXHA 1J8RA 4HJGA 2OMYA 1VLIA 1ML1A 2WZHA 2TSBA 1LEKA 2UX6A 1QI4A 1XIEA 2TRHA 5MERB 3FTWA 4XO4A 2ANUA 3UWZA 1FPTL 4U4MA 5CWSA 4M43L 2XKSA 5TDNB 2YXVA 1W0WB 1A80A 4WFHE 3KP1A 1BW8A 5HHME 3N12A 4AYGA 2W79A 4HIPA 4WU5A 1NWPA 2Y74A 4ABVA 4KWSA 3VFMA 3DX9B 3TA9A 4PJEA 3PF2A 1TYRA 3LCYA 5AYZA 2VXSL 1MI3A 2ZXCA 3MO1B 4F7EB 2UZIH 2EGZA 4IGBB 1SVBA 5HUOA 4OM1H 4PRHD 1ZHLB 2MJWA 1Z3NA 3FUDA 3BZDA 4KAQH 4HTBA 4PJAF 1WB0A 5D1ZD 1IT9H 5AVVB 4DK6A 4FQQB 3ZJ7A 2WN2A 3RWGA 4I0PC 1CYXA 1IEHA 2WTRB 3TIDA 1PD1A 1QLFB 5F7UA 3W88A 2FAUA 2HFFA 2CBJA 2I07B 1IC5L 4KS0A 3CXHK 3D0LB 3TCLB 3CHCA 4GYKA 3VIOA 1XIWB 1KWKA 2B1HH 5JR1L 5F7EL 5C0BA 4HNCA 3FOMA 2PP3A 4PFMA 1HAUA 1FFTB 3MHFA 5LB1A 1O9VA 2ALAA 2YLAA 1YN7B 4GUGA 1FZJB 1AIFA 4O5LL 5LHEA 3OB8A 5E94A 4Z95H 4X6FA 1XT5A 2A85A 4IU2B 2IWEA 5FL1A 3WUBA 4O2CA 2J9YA 4L4TB 4JUTA 3K6OA 3QPKA 2V8ZA 5M3WA 1JYXA 1B9BA 5I75B 4V1DA 3G1HA 3QPQC 1BFVH 4XP9L 2OZ4L 1XH1A 3T2NL 1WA0X 4YHOH 4ICWA 1RZJH 3OLDA 5K2ZA 3LEVL 3LD8C 4Z7OE 4YDVB 2QZRA 1TVBA 1BPVA 4CCDA 5EV7A 2UUDK 3PNRB 1R0AL 3PGCA 3O9NA 4DN1A 4N8VG 4QEGA 3T8VA 5I9QC 2QCLA 3PJSA 3FNDA 4GH3A 3DTXB 3LCLA 3OXSA 5JNYA 2E25A 3GSXA 1EAOA 4MLRA 2DSUA 1DBBH 1BEUA 3KBNA 2VC6A 3FRUA 3QW3A 5KW9L 2BSEA 4GISA 1U8LA 2ONEA 1QA9B 5EULV 4HIHA 5A3ID 5CSZB 2FTAA 2AEIT 1AKJB 5CR8A 1IM3A 4DGIH 1CF8H 4Y8AA 4F7MA 1TZOA 2V7HA 4UNVA 5D7KD 4N2DA 2A1WL 3RPKA 1WISA 3T42A 4OK4A 1T0MB 1UM4L 1O12A 4Y5VC 3EH3B 4Y89A 5KJ4A 4FXKB 1NC4A 3VG0L 4ORGB 2WQUA 1CENA 3VNIA 3C86A 3V4VA 1F6FB 4XBJA 2R1NA 4ELMB 3U6WA 1K1WA 4K7PY 2YD7A 4JZ5A 1K02A 4O17A 2A9AA 1D9KC 4LOUD 2CJ3A 3S4CA 1MCWW 4K2UL 4ACTA 5LKYA 1I8MA 3TBYB 1EP2A 2VP8A 1KXQE 5CEYB 3EGDA 4C7DA 5FSEC 1ZVSA 3PAJA 2RGLA 1YNKL 2IH1A 1GS8A 4LFYA 5GGSB 2LU4A 4AVOA 5D2LB 4YE4L 3A3YB 3O3BA 1MHCB 4PMUA 4D1IA 1PVHA 1S7WA 1RHCA 2G2RB 4RNJA 1VB9A 4KUCF 1IGCL 3CD4A 3V8OA 3GC4A 2G5BA 1HL2A 1GVFA 2EECA 1CT8A 1CE1L 3U2EA 4Y2DA 4QRPE 3G5YA 3BOFA 1NFAA 3VX1A 3FFCD 4Y4HC 3DK2A 3RWHB 2EKSB 2Z2BA 4BDVA 1OP5H 4QLKA 5SWSA 1BRLA 2X2JA 1EX1A 1C7SA 4BIKA 4F7CB 2DT0A 4MLIA 4D9QE 3H2MA 2FPYA 1TTPA 4KRUA 4DFHA 4XBEL 1NMCC 1WAAA 3IDJB 4KESA 2GLKA 1VBJA 3V95A 1RPXA 4OFYD 2H1PL 4XK2A 4AEHL 3F2BA 4C56E 1W31A 2P9RA 4TQ8A 4PUMA 5DYFA 4JTTA 2Z3FA 2TYSA 2IKGA 3KIIA 5GS0L 5DYOA 4Q4OA 1IF2A 3BE1H 4HF5L 4BFGA 1WBJA 2EVFA 2AS5M 1MCNA 4C6BA 2VISB 2PDJA 3LHVA 3P3UA 4QNPE 2BHFA 3BPNC 4YCPA 1R19A 3KTCA 1OLZA 3L23A 3QFDA 4DJFA 5EEWA 1ZVHA 2DP3A 1FIGL 2J5LC 1CMOA 4M51A 4MZ8A 1A3ZA 3G5VB 1FQ9C 1F1GA 4NO0A 1YG9A 1OCCB 3D06A 1DQDL 3UO8B 2J4GA 2AI0L 4HIJA 4LSSH 4TSCL 1A7OH 1RZQA 2DQCH 1NEPA 1A0DA 4BSVA 1A7PL 1N64L 2YPLD 2K8MA 4PBDA 5F1OB 2RUSA 4BEIA 4S3FA 3BWAB 4O18A 1T1WA 1RZIB 1F2QA 4I9AA 4FQIH 5JXQA 1UT1A 4C6CA 1AO7A 1T4KB 3TTOA 2INEA 1IBDA 4U0RC 3BTNA 3GXMA 1N59A 4OF7A 1B31A 4ADUA 1V7ML 3TN4A 4JM0A 4WU7B 3UTZA 2QVKA 4M6OL 1QW9A 5CJ5A 4MA3B 2WNKA 2DQXA 3AMCA 1UCBL 1GC1C 4RDBA 5E5UB 3H9SE 2IQAA 1AJ0A 4ZW7A 3HFYA 1L9TA 1TFHA 1Q0EA 1OAQL 4HWEL 2B4CC 2YIHA 4BZ1A 1T41A 4AIUA 1R24B 3G1SA 3MMUA 5GS0D 4HEPA 2VVNA 3WLSA 3OMZA 2FT7A 3E6HA 4AAJA 3IVSA 4M03A 3O6DA 5F70A 4AITA 3MO7A 3LD8B 2BMKB 2ZKHL 2G3XA 5IHBA 2EE6A 2DWXA 4MJIA 3NQKA 4FXLA 2ZP8A 3MNVA 5IJKC 1DE4A 4KY2A 5BNKA 4E41E 3LB0A 3TJIA 1UZ8A 3LTSA 3QSKB 3UG3A 1XGRA 1FG2A 2PDGA 1QT1A 4K5PA 3IDGB 4DKTA 1H8SA 4FQ1L 2CHDA 2GITB 2E09A 3GU9A 1PZAA 5FKAA 1JJUA 1NL0H 1JDCA 2PU1A 3QO0A 2WXFA 2XFXA 4Y5YB 4TQHA 3JU2A 3AG3B 1FWAC 2JGQA 3E12A 3Q8BA 2JIXB 5IHZA 4PV8A 3RSYA 2Z7GA 1PYFA 1WYIA 2Q8AL 2GHZA 5I02A 3RVTD 1WDSA 1ORQA 4I3GA 1LLWA 1BEYL 5FO7A 4M1RA 1JDDA 3MCYA 4OJCA 1HYSD 2UY3A 4XE0A 3CE1A 4YSQA 3BN9D 3JUYA 4XTDA 4LCRA 4M5SA 1OSEA 4YPJA 4N22A 4GI8A 1IKFL 4BZHA 4JB9L 4UTLA 3HGOA 3RF9A 3RDKA 1ONXA 4ZNCD 4EZJA 5DUJA 4JRXE 3RM9A 2GSGA 3FRPG 3K2IA 5J1AA 1R9YA 3TH4T 5GJPA 3E8UH 4G80A 3ZYJA 4DPAX 1JPIA 4HCRA 3CVCA 3K3QA 2Z1VA 3U2SB 3UTQB 2W65B 1VPOL 5I8KL 4AD2A 2VELA 3UJJL 1XF3B 3QHZH 1IZJA 5FWRA 4UTHA 1UB5B 5I76A 1LT8A 2EIEA 1EQPA 1ZHBA 4TQEH 3UFYA 3HMXH 1F58L 5DT7A 3WD4A 1P1VA 2QT6A 3V0UA 2FPTA 1OF8A 2KI6A 5IM7B 1EO5A 2V5MA 1WZKA 4Y19B 3F05A 4LSRL 2HWZL 3N42F 1FWHC 3WD1A 2NUPB 4M02A 5F9AC 4RZ6A 5HD8C 5C2UB 3OG6B 1QRKA 2WLLA 4HZ6A 4PRNB 2CCLA 5D70L 1C82A 5AYUH 1EZVY 2YN5A 1GYVA 4L29A 1KBBA 4U3XA 3QNYA 3VUSA 4IU3B 4X80H 5AVZB 2DQHH 1DLFL 4MKMA 4F0SA 1CFQA 3GZPA 5K9JL 3KBVA 1ZY9A 2IAMA 3QDJB 1S78D 1TZIB 1G9NC 3KRSA 4LSVL 2OXHB 4K9EH 1J0ZA 2L3BA 5A6MA 4PV1C 2LFEA 1IQWL 4Z2JA 2FVKA 2P7TB 1E4WH 5M94B 4R5TA 4Z8FL 2EVHA 4ECNA 3FYEB 1VYRA 5AVQB 2V9TA 5FW7A 4R90H 1WPCA 1ET7A 1QSED 4K5MA 2NX5B 4KX9A 2YD2A 4LU5H 4XNQA 5BO1L 5J89A 2B5IC 1CBVH 2Z4TA 3S9DB 4MWAC 1XCWA 1Z89A 1F8MA 4G1NA 4I7ZC 1MPAL 1UJTA 3EOSA 4UTBH 2CLIA 2EIZB 2IALB 2J2ZA 1RWFA 5AYYA 1JHTA 1RIUL 4PJBF 1EQCA 2WW5A 1MI5B 1GGCL 4MDJB 2K9FB 2JK2A 3BMXA 4UZGA 3V4LA 2X4RB 1XEDA 4XKYB 4N42A 1J8HB 1A14L 3CQQA 5E6UB 5G4NA 3Q5TA 1DWAM 3NESA 1BFOB 1OP5K 3KLQA 1MNUL 4LMQE 4Z77A 3H2CA 3X40A 2CHZA 1TQJA 2OSWA 3RP1A 3SDXF 1XIJA 5CZSA 3X12B 1KN4H 4ABUA 4J27A 3D39E 4D8AA 3CUJA 3O6AA 3JQOB 1A6WH 3TYZA 3P77B 1BVZA 3RG1C 3SCVA 4HOMA 1JGVH 4O02B 5A6TC 1RAKA 4WAFA 3U5YA 3L4UA 2C14A 1FY6A 4YLBA 1FGVL 5DJDB 2DMBA 2PTZA 1CLZH 4XGZA 4PRIB 2E22A 5KZMA 1JD9A 2J27A 2A1YA 3D30A 3FCTB 1LF6A 1MJJA 5EZJB 5J06A 2OTPA 2JJUA 3RPTA 4OGXH 4ZUWA 3WJWA 4YBHA 3O06A 1NC2B 2NY1B 1XCTB 3HG3A 1AZUA 1K7FA 2XVLA 4DTGH 1OM0A 2UXFA 3W2MA 2FK9A 2F53B 3OKLA 4PGBB 3MOQA 4KZCA 2WWMC 2N4IA 3B4NA 2PWEA 4Q9RL 3C5ZD 3SJVB 2EPLX 1E5UI 4KCTA 1YTDA 2QF8A 2ICCA 4P59L 2SFPA 2DQEL 2OMVB 5INCB 4A2SA 3B9VA 3DYPA 4UYPA 3T77A 2Q7YB 5GS3A 2NXZC 3MLXL 4XIAA 3VG9C 1KLUB 2NY5C 3DO7B 4P57B 4MNQD 1V02E 3BO8B 2G3IA 2OMZA 5D7JB 3W1MA 4H0LC 4FULA 2R2EA 2BVEA 4LLMB 1GOHA 4PYHA 5FYJU 3V4UH 5EUOF 3T40A 3DV6B 4A6YL 3NSYA 1R3JB 4HGWA 5MEND 1FIEA 5DJ2B 4JDBA 1DWJM 2BTMA 4L9LB 1XSIA 4ATTA 2ZCKL 2BNUA 3FULA 1YY9D 3KDPB 1Q8AA 4QRQA 2F54B 2GVGA 3W1QA 3GLAA 3JR2A 4RFNB 1HKLH 4AV5A 1IEQA 1ZJIA 3T09A 1KIRB 2L7QA 2VDOB 5E5MA 3QHTC 4GW5B 4AWUA 2ZD0A 2Y1YA 1DPMA 3AAZB 1T7YA 3SBWA 2B31A 4X2UA 1ERNA 5BZAA 4DJDD 2POTA 2NSQA 5E8DH 1XSOA 3GFXA 4AE1A 2B20A 2HS6A 1H7OA 4LLWB 3FXIC 3MXWH 2FMOA 3T7VA 2V9RA 4APXB 1QHPA 2H2PC 1B0GB 3S46A 4DVOA 5SX5H 2I9TB 4G9DB 4CGTA 1WZ1H 3FQXB 3G9AB 3FCSB 3AQXA 3QQ0A 1DVXA 3D18A 1JCKA 5KSUA 3NQGA 1VENA 1SZFA 1XC4A 2FH8A 4DZHA 1XRVA 4YEEA 4W85A 5FYJH 5E9NA 3P80A 4AQ1A 1KCUL 1KJ3L 2X1XR 4EXAA 5I16B 1KIUB 3MV8A 4IMAA 1LILA 4AZUA 2QJIA 1P0DA 1JWMA 5TDPA 3PTMA 3VKBA 3QA3B 2QHRH 3OG4B 2XM2A 3CL8A 1ES0B 1IGFL 3NN8A 2QSTA 2VX6A 2BZDA 4CC4C 4M80A 1KULA 1EBGA 5BXTA 2DLFL 2X4NB 4UB0L 5A6AA 5IQ9A 2BNRE 1HTIA 5MEOB 2P42B 4JAMB 1K6QH 2YX9A 3LCXA 4HUUB 3M6DA 4RFEB 3SYPA 5K1NA 3HIZA 2BVQB 3FHAA 1FFQA 1I1AD 2X4QB 4QRAA 5EZPA 1KNOB 1PZ5A 4E68A 3WY1A 3KPRB 1UP0A 5EWIH 3A6OA 1RL1A 4CKVX 2VFDA 4ACZB 3G1YA 2DMKA 3RZCB 1A50A 4QDWA 2B5IB 1N0XL 1SJCA 1F3TA 5JOFB 2XTJC 3Q6GH 3GKWH 1VZWA 2VR6A 1W8EA 3GK8H 1R3RA 1QACA 3I6LE 1E2WA 3GR4A 2NUTB 4AENA 4FA3A 2WBJC 5I1CH 1KGJA 1XR2A 3PWAA 2Y36H 1DQIA 4MDRA 2W60B 2PXYD 3O6KH 3ZE0E 1LCOA 5KYXA 5GS1A 1S7TA 3MB9A 2V69A 2R4RL 5CZRA 4EP8C 3GEFA 3IRZA 1U8JB 3P5ZA 3MRDB 3CSGA 5DLLA 4J3ZA 1KJ2H 5DA0B 5LBVA 3NJLA 2EXYD 2VR8A 4O57A 1ZV2A 1WDQA 3IVKB 4PB9H 3WGVB 5I30L 1P6FA 4D0DB 4I2XE 3L81A 1ICQA 4M1DL 1TVLA 2Z25A 1W0MA 1G6RL 2NLJB 3U6XS 1GA2A 1QNIA 4LVGA 4PJ5B 3EXTA 5H37H 4MD5B 2CQTA 2KPNA 3WLQA 5HVHC 2VERN 3IK2A 5HDQL 1J9CT 3NDYE 1MWAH 3QJZA 1TQSA 4BKLA 3H9HA 4F7TA 5HYIA 1GVRA 4PWHA 1YPZE 5BMFL 4F2MA 3UT0A 2DLTA 1EBPA 3KBFA 4QDGA 4EKJA 4WVXA 1CLCA 4U0QB 2GZXA 1QHZA 3DMMB