4FNUA

Crystal structure of gh36 alpha-galactosidase agaa a355e d478a from geobacillus stearothermophilus in complex with stachyose
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
718
structure length
718
Chain Sequence
KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWAMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELMYAGVALPYRSSDFISMMWRLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 196
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnuA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnuA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnuA02
3D4ZA 1KTCA 1LTDA 3N9RA 4IMDA 4O50A 5HDRA 1OFDA 2BLEA 2PE4A 3GKFA 3WK2A 1L6WA 3R12A 1X1OA 5T26A 1JVNA 3G0XA 3GDLA 1VIWA 3BAWA 3EDKA 1JAEA 2CZDA 4ZMGA 4Z0JA 1NF7A 1F76A 1XH0A 2ATSA 2XVKA 4HNTA 3TH6A 4JFUA 1M53A 1H7PA 5LNRA 3VSTA 1ME9A 3RLVA 3OVRA 4JYDA 1LORA 3GNNA 3VGHA 2E5DA 1XD0A 3WNKA 3NQFA 4N9EA 2V3FA 5LNVA 2WNNA 2GQ8A 2ZZ4A 1B57A 2VFFA 4BK9A 3OG3A 4Q32A 3QPZA 4U4MA 1L0PA 1P6WA 1RQBA 3M6YA 3A5VA 3QQ0A 2VXNA 1PZ3A 2OYKA 1XDMA 4CN1A 5E6YA 1G7UA 2TPSA 1VS1A 2YDAA 3RF9A 2C8NA 3EWWA 4XQ6A 4UTMA 5DBTA 1Y7VA 3BVJA 3M44A 2WSPA 3B0UX 2QDGA 4GUGA 4IMCA 3MI2A 5KTLA 1GOXA 1HXKA 3A24A 3BLFA 4WX2A 2F7RA 2Z2UA 2FH8A 3ECQA 2GVGA 1OJXA 1WO2A 1V5XA 5AHMA 3LV6A 3TW6A 4JFTA 1GVSA 4JTSA 4KMQA 4FX8A 3UPWA 2WNQA 1SFJA 2Y4SA 3BG3A 3DI1A 2D3LA 4HNNA 3EJUA 2W79A 3L66A 4LNYA 1KXTA 3S6DA 1J0KA 3PY2A 4GJ1A 3G1XA 3VFLA 1K8YA 1DEDA 5DLCA 4MUZA 3WY4A 3MBDA 5K4XA 4MYXA 5EY5A 1DJNA 4CCEA 5CKSA 2E77A 5K9XA 2ZIDA 4M7SA 3GDTA 1BVZA 1UH3A 2PRMA 2QCNA 2QMKA 4RLIA 3TAOA 3NQMA 3L4YA 1LLWA 3HJZA 3UCQA 1KM2A 1OFOA 4TU1A 5HUOA 4MYAA 4HSNA 3W1RA 1TV8A 3PUEA 2E5BA 4PFMA 4AH7A 2B7OA 2VEPA 2NV1A 4IXXA 4WJEA 4JTLA 5DELA 3WNMA 1IIGA 4NNAA 2ZZ6A 1ZALA 4BI5A 3L4WA 4UTHA 3PSVA 2XWDA 1UA3A 5D2YA 2ATMA 1Q45A 1FCBA 5AN7A 3RNDA 5KMYA 3ABOA 4FLSA 1P1XA 2F84A 2XIIA 1K7EA 3LRKA 3QMRA 4KWWA 5MHBA 3CZLA 2OSWA 2GJPA 2F2HA 1EX5A 1H50A 1TTQA 2FPYA 3ABRA 4GINA 2FH6A 3LHTA 3I6RA 1ICQA 4LS2A 2ZXAA 2DH2A 5CGMA 3F03K 3S1XA 1D3CA 4L4MA 5TIMA 2PWDA 4Y9AA 1OHLA 2FPTA 5F1UA 4AB4A 4DF2A 2CZFA 1MFVA 5EMYA 5E0KA 4LRSA 1OGSA 4WF7A 3W7IA 3WK0A 4QAIA 1U2YA 1QPOA 1B3OA 4FIRA 3NGJA 5DBUA 1JXJA 1XCWA 4N2YA 2YIHA 3LRLA 1KV5A 2PRHA 4JYFA 2Y88A 4ZQOA 3II1A 5C6MA 1JRCA 2G95A 1YXYA 3DDFA 2X1UA 4JDYA 1AK5A 4ALDA 1CGTA 1F73A 1TTIA 5LSMA 3PM6A 5D2TA 3KL0A 2JKEA 3LCHA 1MWOA 3HPXA 2AQWA 4JCMA 3UD6A 3SZ8A 2ZRVA 4R34A 4C1KA 3BAJA 4PL1A 2DZSA 2E6FA 2YJQA 3GXDA 2YGYA 5CZJA 5EA9A 4A2RA 2HTMA 3W3OA 1ADOA 3KRSA 1KFEA 3DHPA 3NZRA 2E6AA 2FTPA 3W86A 3TAKA 2OYLA 3QQ1A 3INPA 4O11A 3CPUA 5HJLA 3B06A 4YWIA 1YPFA 2O7SA 5CG7A 3S5NA 3GKAA 2V82A 3DAQA 3STEA 3EKLA 1CPUA 2HS6A 2QCEA 2ABBA 3QM3A 4J27A 4NT0A 1OFAA 4IQLA 4ADUA 4DBDA 1UD2A 1QPKA 5A5WA 1S3HA 4O4WA 4A2SA 1GVIA 3SI9A 4M8UA 2A6NA 3WJZA 1XFBA 1XUUA 3ELFA 3TMQA 1FCVA 2I14A 1JD7A 4WOQA 5KEZA 3KX6A 3G0UA 1VHNA 2WKLA 3TX9A 1QOQA 3FFSA 3PSWA 1JDAA 3C0JA 3MWAA 4X9SA 1H60A 2ZICA 1ZAIA 3DHUA 4GO8A 4HA1A 1BWKA 3DENA 3TKFA 3W71A 3HPZA 4MZYA 1GWJA 1T8XA 4WY0F 2OT0A 2D2OA 2VEMA 3JRKA 2NSXA 3TTYA 4BF9A 4N9DA 4JICA 1XSIA 3TXZA 3WJXA 4LXFA 1X1ZA 5BMXA 3PAJA 3BSGA 1G5AA 3MI3A 4Q4KA 3ZWTA 1A53A 2DZVA 2V5LA 3N3MA 2BZNA 3CPRA 3R8RA 1MFUA 5D02A 3CHVA 1CXEA 4MKNA 3GZ3A 4NXSA 1VYPX 1I45A 3W7KA 3HG2A 3CIXA 3N14A 5FF7A 5A6LA 3TW7A 3MHGA 3ZQ9A 1RQHA 2GVLA 4PH6A 1PV8A 3MUXA 5AOUA 1FWTA 2NX3A 2ZUWA 1TCMA 2YR1A 2VOMA 4JD4A 2QAFA 1DKWA 1CXKA 3C6CA 5H91A 1JRBA 3MHUA 1FCQA 2ZRZA 5TD4A 4AF0B 2AMGA 3BGGA 2BWGA 3CWNA 2EGZA 1TPDA 2EJ1A 3DBPA 4NQ1A 4XTDA 4DPPA 4I7WA 4UXDA 1BPLB 3LHWA 3QRHA 1J2WA 4YCOA 1XL9A 5EMUA 3P80A 3VGDA 3W22A 4P2VA 1WDWA 2B7PA 4I7VA 1VLWA 5BNKA 2QEZA 2CZEA 3WDJA 1X6UA 3GLCA 1CDGA 2A7NA 4B9YA 5U4NA 3W7GA 2FQIA 4GQQA 4JTHA 2ZX6A 1DV7A 3FIGA 2WKGA 4LRTA 1KFJA 3OVPA 4UTKA 1QMLA 4AF0A 2FDSA 4H2CA 3DGRA 3DDGA 4UNKA 1KM3A 1UKSA 3M5ZA 1ZFJA 3QFEA 3BUPA 3CT7A 4M6PA 5D04C 4JL2A 4Y6GA 1DVJA 5G2WA 3S1UA 3V1PA 3M7WA 2G3NA 1E51A 1WBHA 1VZWA 2H3DA 4O14A 4LVFA 1R75A 2GJLA 4GKLA 1EUNA 3V75A 5F4SA 5D09A 2ZX8A 4QM1A 3ANYA 4MZ1A 4PSPA 5G1TA 3I7QA 4X2RA 4E2DA 5HWMA 5FI8A 1CW2A 1H62A 1PHQA 1SU5A 4JL1A 5K7JA 1TPWA 2WNZA 3BVWA 1BWLA 4L4LA 3D50A 3NL3A 3W73A 2QUVA 1W37A 1W3TA 3S5OA 1JJKA 3KEHA 1B4EA 3VE9A 4N6FA 2QCDA 3MJYA 1FDYA 2EO7A 3TV8A 1KBJA 4XB3A 1UKQA 3IVTA 3W7DA 4IX2A 1DQWA 2X1TA 3Q2DA 1U5JA 1KGUA 4H4IA 2R14A 4HPJA 2RFGA 2IQTA 1KXVA 1GQNA 5AC7A 4Y90A 3NQEA 3W1MA 1B4KA 1SZFA 4XKYA 3P5YA 3P67A 2ZFAA 3TK7A 1KM4A 4Z08A 2PWFA 4RKAA 3IJ9A 3VSUA 1KBKA 2J9YA 4ONVA 5EPDA 3TE9A 2HSAA 3AJXA 1WP6A 5EKYA 1QCWA 2WOQA 2C13A 3L67A 1IGSA 1XUZA 3UZ5A 3EKZA 4E2BA 1OK6A 1P0NA 2FLIA 3NDOA 3QEZA 4QAWA 3IEBA 3N34A 2ZRUA 3BMWA 2O7QA 2WSKA 3NXFA 4UFHA 4QSHA 2VEKA 1WOAA 2Y63A 1M7OA 4O0ZA 3GXPA 3NL2A 3NR0A 5AHIA 1I2NA 3NQVA 4WSKA 1WA3A 1O7DC 2BHYA 1NF0A 3VGFA 1C8QA 3A9IA 5A2AA 3FOKA 1W1ZA 3G1DA 1VCGA 4JY8A 3D4YA 5E0FA 2DIEA 1XBZA 3P8IA 3G1SA 4EWND 4PL2A 2ZZ7A 3BH4A 1DQXA 4YL2A 5BMWA 4JR5A 5IM51 1F5ZA 1A5SA 2WV8A 2E68A 1H3GA 3O15A 2OT1A 2B0MA 4N4QA 4J3WA 3KL5A 1Q6RA 1HVXA 2Q8LA 2ZX9A 2X2JA 3QGVA 2YSWA 1L6YA 3FYPA 2NUWA 1IXNA 4JX5A 1JGIA 1GEQA 5AHEA 4LPCA 1CXHA 6ALDA 3F1QA 5HINA 4YMZA 1TPVA 5F2LA 5DCBA 4O18A 4JFWA 5C55A 4ADTA 4GBUA 2FGZA 1G4SA 1QHPA 3NM3A 1LLZA 3H55A 1FQ0A 3LB0A 3QPYA 2VENA 1H7WA 1TQUA 3DH7A 4RZ4A 4O12A 3W1TA 4MB1A 2WVVA 3TSBA 3HG3A 2FHFA 2Y24A 5F7UA 3L9CA 5CZTA 1THFD 2NWSA 4N6EA 1H5YA 3ABSA 3GNDA 2Y89A 4JYEA 4POCA 4XUGA 1J5TA 2QPSA 4FNUA 4FX6M 1IXQA 2RDUA 3E0IA 1SQ7A 3C2VA 4OBTA 1GG0A 5I3KA 4J3XA 2GQAA 1ZJAA 3W7OA 4NUWA 3GIYA 2DZWA 1UKTA 4IMGA 2CLHA 3ZS4A 2FFCA 4HOXA 4UQCA 2QUTA 3SW6A 3E49A 3WMSA 1HT6A 2Z1KA 2CWNA 2ZRWA 3PBUA 4WXYA 4UTWA 4DO5A 4NJKA 2X1RA 2JGYA 3PBYA 3GDKA 3W1PA 1RPKA 1WZKA 1VR6A 4FNRA 5DN1A 4NNBA 3WK1A 4N9BA 3NQ2A 2V0TA 1BSIA 3LBMA 2EACA 1F6PA 4UTIA 1JG9A 1UD6A 2DU2A 2E6DA 5FEPA 1ICPA 1D9EA 1BAGA 3ZSTA 5CSSA 4RR4A 3EJRA 4J3TA 5K9CA 1QO2A 3MYPA 1SSGA 2FB3A 4H8UA 5LNSA 1KFBA 4KKXA 2P0OA 3EWBX 2ZUUA 2C3ZA 1TPH1 5D03A 5DFAA 4ADSA 5GVJA 2ZXQA 3WEMA 2E4TA 3PBWA 1PJ9A 3CEPA 5HWNA 2ZXBA 2WKJA 4MY9A 2R8WA 4K6AA 4LC8A 3RILA 4FLQA 1WOBA 1QWUA 4O10A 4FMVA 3KAOA 3SECA 1HL2A 3LHYA 3BV4A 1VFOA 3YPIA 3HOJA 2V5BA 4FF7A 1H1YA 4UNLA 1PAMA 3UEQA 1OK4A 3W83A 4WY0B 4CCDA 3VX0A 2ZTJA 5K3VA 1KCKA 5HWJA 1HX0A 5LZLA 1P5BA 3VMPA 1FWRA 2FHBA 2D3NA 1HG3A 3EWXA 4C1LA 1UUOA 4CNPA 3TIMA 2XN2A 4BA0A 3RMJA 2DJLA 3WEOA 5A6MA 4H6KA 1AVAA 4LVDA 4FNSA 3EXSA 2V3DA 1TREA 2PWGA 2OJPA 1UASA 2C16A 4MFDA 2ZYFA 1X7FA 2NUYA 1WPCA 1GPWA 1DHKA 2D0HA 1JCNA 4J3VA 2RDTA 3FYOA 3Q37A 3B0PA 3WFAA 5LHFA 1HO1A 3NVTA 3DKJA 4J28A 2Z1BA 4OE7A 4WY0A 3BVXA 4IPIA 3DU0A 3GR7A 3LTPA 1CXFA 5C54A 1PVNA 3L65A 5CPMA 3UZJA 3QC3A 4CNNA 4O1DA 4M7TA 1OB0A 3BAIA 2D0FA 3HIJA 1TYGA 2FYVA 5KZDA 2P1FA 2Y62A 3U8GA 2R94A 4MIMA 2NZLA 1ZY9A 3D0CA 2VFDA 3BUQA 1G9HA 1A5CA 4O1CA 4A29A 1OVDA 1K3UA 1PZ2A 4MLJA 2EABA 3OLGA 3CTTA 2YFOA 3CIWA 1SW3A 1MXDA 1N8FA 1SMAA 1EH9A 1SPQA 1G69A 3GYEA 3FLUA 3DFQA 1WV2A 3P61A 3ATYA 3TSMA 3BC9A 5DO8A 1TQXA 3PG8A 3L2LA 4NJIA 3W7QA 1AW2A 1JL8A 3WNLA 4IGHA 4N4PA 1XD1A 5HQEA 1IIHA 4PCTA 2X30A 2BXYA 3FJ6A 5FF4A 3BVVA 2FE0A 5C5YA 1W5OA 2Q3OA 1R47A 4AHPA 4O52A 4X0NA 4YXGA 2YW4A 1CIUA 2AAMA 5AHFA 4FNTA 2DZPA 4R53A 5CPLA 4UTTA 2CXGA 3RU6A 3QW3A 1QAPA 3W1XA 3NEVA 2OYMA 4UOZA 4NZFA 4NI3A 4JS3A 3P84A 1F05A 2WANA 3KVJA 2WSRA 1H7RA 1WXJA 1S5VA 2A7PA 4M5PA 1C8VA 1IZJA 4O16A 1IZKA 5D2VA 3IV3A 1QX1A 4J3SA 1TMQA 2YZRA 4O19A 4UC5A 2DZTA 4JTGA 3JS3A 3CZKA 1G4EA 1M6JA 1VH7A 1K03A 1OX4B 4O4VA 3K8KA 1VPXA 1E3XA 1R33A 4UCGA 1IXPA 3C2OA 2OSXA 2VRQA 1FX6A 3W7NA 3P5ZA 4FHAA 4XTIA 1FY6A 1L6SA 2XFWA 2X2HA 3N19B 4HP5A 5F1VA 1HTYA 4RJEA 1RVGA 1SO5A 2VT0A 1ZCOA 4RCXA 3ZOAA 1OFRA 1SO3A 1XH2A 1UUMA 3L2MA 1V3LA 3C2FA 1UD4A 1TPC1 4BWLC 2CLLA 2AAAA 2PCQA 1ICSA 1NSJA 1SFLA 2WQPA 2TMDA 1H51A 3F4NA 1KFCA 1FBAA 1H7NA 2CZ5A 1I2PA 3NQDA 1HFBA 4ORIA 5I23A 3NQ7A 2ZUSA 3UXAA 1KXQA 1TO3A 4QITA 3KVLA 5L6UA 1S46A 1QR7A 3L5LA 4UTWC 1YDOA 1TJPA 3L4XA 4LT9A 1XDLA 1W5MA 2ZA2A 2V8ZA 3LHUA 1QI3A 1NFBA 3NQGA 1XH1A 1I2RA 3GXTA 1WBJA 4UQAA 4PTNA 1XBYA 1MVYA 4EIVA 1TPEA 1DJQA 3M5YA 4RZ5A 4WQ6A 2YFNA 2OSYA 5F4WA 1G94A 5CXPA 2YKKA 4K37A 3NAVA 2GVJA 1OYAA 5AYXA 1SZNA 4MVAA 3EEGA 4HNUA 2OMAA 5HMSA 5KINA 3S5ZA 2J25A 1SUXA 1VHCA 3SR7A 1DOSA 4OHQA 2Y7FA 1LRQA 2QAPA 2J27A 3UG4A 4LQ1A 4EF8A 4AWTA 1TQTA 3UWZA 3K30A 4QNEA 4K36A 1J0HA 2GJRA 4HSOA 1M7XA 3LCFA 5EL1A 4OT7A 1VGAA 3CWOX 5J5RA 1G7VA 3NPUA 1W3IA 3WY3A 2VEIA 1EB3A 4O13A 1JDCA 1LWHA 2AGKA 4JGDA 3GDMA 4HHPA 4HT3A 2F7QA 3PWAA 2C6QA 1PIFA 5D38A 1SW0A 2CLIA 3ZT5A 1QHOA 3W38A 1SSDA 4BI6A 1KW1A 1IXOA 4O8RA 3TSDA 4NX5A 3GBDA 1HWWA 3LPPA 1JF6A 4AXKA 1MXGA 4DO6A 4MFEA 4JXCA 4NJJA 1TV5A 3A21A 1UCWA 4I9AA 1HTIA 2WVUA 4GUHA 3EDFA 3WNOA 4UQEA 3HF3A 1V3KA 3UWWA 4AWSA 2JKPA 4XWUA 1GJUA 3NOEA 6CGTA 1HUVA 3LDVA 3W7PA 1R2SA 4MAZA 4NVTA 3GB6A 4RZ6A 4A3UA 4ML9A 3QMTA 3W1UA 2W0UA 1JD9A 1K7FA 2ZDRA 5D32A 1U30A 1QNVA 3W7MA 2FPVA 3CGTA 2XWEA 3QYQA 5AYYA 2QCHA 4TVUA 3G1FA 1A50A 2VELA 1A5BA 3IVUA 1W5QA 3D51A 2DIJA 3S5YA 4IMEA 3LV5A 4WXZA 1DBTA 4N9CA 3EWZA 5F2GA 2H6RA 3CQ0A 1A47A 1JCXA 2QCCA 1EP1A 2ISVA 4XZ9A 2TYSA 3N2MA 1D7FA 1VB9A 4LS0A 3CTLA 3LCWA 1AL8A 3A23A 3BMVA 3VNDA 3EXRA 3IGSA 4S1FA 5FESA 4EVZA 4UNIA 1XKYA 2Z6JA 4U3CA 3C3NA 5CZ0A 3AMKA 4X9YA 3SGZA 4QQ3A 8TIMA 2ZUVA 2A5HA 1UOKA 3LGEA 1QPRA 4LV9A 2EADA 3DHFA 3WNNA 1TPB1 2QUUA 3CV5A 1GG1A 1K7XA 2Z6IA 4PEEA 1VJIA 3PB2A 2A4AA 3G8RA 1PS3A 4UTTC 4QNWA 3W7CA 3L5MA 3TOPA 1NVMA 1MSSA 5I5RA 4LC6A 1G1YA 5F2MA 1JQVA 3PC0A 3M43A 2YA2A 2PURA 3EX4A 2VNCA 1LBMA 4AHOA 1Q3NA 1UD8A 2GQ9A 2X2IA 1ZNNA 2VKZG 4AEEA 4GI9A 3QZEA 3W72A 4J7RA 1DL3A 3ZT7A 3GX9A 3LHZA 1VCFA 3DX1A 3UQNA 4TIMA 1P0KA 3L4TA 2NLIA 4S2CA 1GJPA 3S8HA 3L4ZA 2DZXA 3AXIA 4ZQMA 1UD3A 3BCFA 2B7NA 3QW4B 3DX2A 4CGTA 3S2CA 1SZGA 3CZSA 2QJGA 2V2CA 3DHDA 3TQVA 3KE0A 3BAYA 3N73A 3SFKA 3PVFA 4U33A 2V3EA 4K7YA 3FW6A 3DFTA 5AYZA 5DY3A 4PCFA 3PS7A 4B9ZA 2QCLA 3N2XA 3KL3A 3UERA 1LYXA 2ZZ1A 2Y2WA 3ZWSA 4J9JA 3DXIA 4CQAA 4GO9A 3O07A 3KFTA 3THQA 1VC4A 4ZVJA 4UMBA 4YCPA 2RH9A 1PE1A 3T40A 1RR2A 3FS2A 1EWEA 5U7SA 5TBOA 1NM9A 1TPUA 1PHWA 2E5CA 1MXSA 3NA8A 3W2KA 3RLUA 3O6CA 3UWYA 2JBMA 3B03A 1ZHAA 3B4UA 1KXHA 7CGTA 1MW1A 4X3ZA 3UY7A 3BW3A 3VI2A 1B2YA 5I0DA 5H2ZA 1WZLA 4OV9A 4HNVA 3T44A 2VC6A 3FAXA 1V3JA 3KLKA 1NEYA 3CLMA 5D2XA 2WC7A 1ZJBA 5I3GA 4FO4A 4CCCA 5KZEA 4GNJA 3LXCA 2A0NA 4FLRA 5I3FA 2CFFA 3P81A 5CGQA 3L21A 3TCEA 2ZZ2A 1UH4A 5KZMA 5AC6A 5A8GA 3W7JA 4EF9A 1TPFA 3DZ1A 3BG5A 2NWRA 3S42A 1Q4NX 3NG3A 3CEUA 3CB8A 4GI6A 1YDNA 5EBUA 2C14A 1W9XA 5G1YA 4LW7A 2RHGA 2F1BA 3VM7A 1PCWA 3S0CA 1CI1A 2BXVA 5SWUA 3CZEA 4O15A 2NT0A 3W37A 1XBVA 4ATWA 4TR9A 4BR1A 4UTJA 2V9DA 3HQ1A 1TJRA 2QCGA 3HG4A 1RQEA 1SO4A 3C8FA 3H53A 4DXVA 1ZENA 4RXFA 4GUFA 4RK8A 1TTJA 4K8HA 5HR7A 4NX0A 1O95A 3KVKA 4UTUA 3VGEA 1RD5A 5EYWA 1P4CA 4GWEA 1XGZA 1PPIA 3LXAA 3AJ7A 3O1NA 1BG9A 1DTUA 2EAEA 4O57A 4G1KA 3STCA 4DEFA 2G97A 1YADA 1QI5A 3HGSA 3L0GA 1OFPA 1GVQA 2H8ZA 1QWGA 1B0IA 3HZ3A 3FA5A 3HBLA 5K2ZA 3NQ6A 1GTEA 4RX0A 3IK2A 1OSEA 4WUIA 2FJKA 5DXYA 1JR1A 1W5PA 4S2BA 5I3JA 4AYSA 2TSYA 3P82A 3KWXA 1OFBA 4IUOA 3NL5A 3GDRA 3A47A 1TCDA 4JIQA 3I65A 3OHIA 4ORMA 3W85A 2R91A 3PF3A 2ZBTA 4GI8A 1BKSA 4E38A 4DF1A 4HPHA 4CKQA 1ALDA 3VMOA 2ALWA 1PEZA 3BUIA 5I3IA 1T99A 5DY2A 3P60A 4BWLA 1C29A 1AMKA 3VKJA 3BLEA 1TMHA 2HS8A 1D3HA 1K8XA 5I3HA 2JGQA 3I7RA 4FEZA 1ODUA 2J88A 2HMCA 2C1HA 2FB2A 1U33A 1FUYA 4UR7A 3WK3A 4UOQA 3LRMA 4QISA 3U2OA 2G3MA 1JUBA 3BSHA 3WDHA 1VCVA 1YTEA 4LS1A 3IIXA 3TXVA 3BCDA 3K1DA 3G18A 3P8JA 4MPQA 1CGXA 3TC7A 1QI4A 4PCSA 2WCSA 1XM3A 4MJMA 5BRPA 1G4TA 4UTLA 4U2YA 1ZAJA 1EHAA 4JEQA 1BLIA 3WELA 3C56A 5L9FA 3DFNA 1C9DA 1FWNA 1AW1A 3W7RA 2JK2A 2Q8ZA 1ME7A 3LCXA 4R33A 2QDHA 2JKAA 1CGYA 4UQBA 1QFEA 4W93A 4ZQCA 1OX6A 3WJYA 1ML1A 3W87A 1WQ5A 2WPGA 2VFEA 3ZR5A 1KLYA 1JFHA 2GVYA 4Z1BA 5LKYA 5I24A 1I4NA 3FJLA 1FWWA 5DCDA 1J4EA 5E70A 3WNPA 3NPVA 3EB2A 4LY8A 2TAAA 2Y7DA 3CU2A 3Q58A 5A2CA 4OGZA 3A4AA 5LNWA 2J9ZA 3TFXA 2F18A 2NXGA 1IV8A 4OKDA 1GTHA 3GXFA 1W8SA 5HNRA 2D73A 4AEFA 4YLWA 4UFJA 3GAKA 2KZHA 1OYCA 1GT8A 2H90A 4QIUA 1XSJA 1H1ZA 4GUJA 4A22A 1YTDA 3LXBA 3B0VC 4IMFA 1JQXA 4FIQA 4NNCA 1E3ZA 2CHNA 1VAHA 2FIQA 1CXLA 4B5NA 3NPXA 2C7FA 2ZXDA 4UMCA 2OW7A 3LBCA 4GFSA 4JN6A 4H8VA 1TTPA 1KBIA 1KBBA 1LOLA 3ABQA 1JI1A 4Z1CA 5G2HA 2CLKA 3WY1A 5E93A 2QF7A 1B9BA 1YTKA 5BOOA 1KTBA 3U6WA 1AW5A 4JX6A 3BG9A 1XI3A 4PODA 1E43A 3VGBA 3VGGA 3W6YA 2OX1A 2WCGA 3TMLA 1YYAA 4JDBA 1RP8A 3HGRA 5FEWA 3AO0A 4LOCA 1M7PA 3OLIA 3G1VA 4MJZA 1CLVA 4CNOA 3BVTA 4JIPA 1WX0A 3L4UA 1X8FA 4LU0A 4A21A 3HPSA 1QPNA 4MZ8A 3MMTA 1CGVA 2VFGA 1AQMA 4UFIA 3C2EA 4HN4A 4ZZ9A 1VFMA 2E8ZA 4LV4A 5CPNA 3BAKA 3TNOA 3DC0A 1UJPA 2GJNA 3DKLA 1HL8A 3SY5A 3G22A 4UR8A 4KFPA 4AAJA 2UV8G 4K38A 4DBEA 3OA3A 4CQ8A 2WJZA 1SZEA 1L9WA 3P62A 4JCLA 2NUXA 4AVFA 1XC4A 4P61A 3DX3A 3LTSA 3P7YA 2XVLA 4GIAA 1GVFA 1E40A 1I2OA 1LOSA 5CPOA 4UFLA 1EEPA 4TX9A 2F7PA 4O28A 1NOFA 2F1AA 3IGUA 1ZJIA 4Z1AA 1G67A 4ICNA 1VYSX 3AXHA 2CLOA 3OLDA 1WAUA 1OFQA 3W1NA 1IF2A 4Y96A 1J0JA 2CU0A 4FNPA 3EX3A 1K8ZA 1N7KA 1Q6LA 3VMNA 1DORA 1LOQA 4DO4A 3L68A 5D2WA 5A2BA 3F4WA 2YA1A 2OCZA 4ZQPA 3MP5A 3IIZA 1EP3A 3G3DA 1TQWA 3UPBA 4DF0A 3KOFA 3M9YA 5CLTA 3GR8A 3W2LA 3O8AA 1G6CA 4JX4A 1OT2A 3L5AA 4OWGA 3CC1A 1GJWA 1F6KA 3S1VA 4JNMA 2V81A 3OBKA 3VNZA 2FHCA 1JCJA 1LWJA 4LTSA 1LRNA 2ZWYA 4Q33A 5D30A 3W7EA 2ZWZA 5BRBA 1XSKA 5E9AA 3EJSA 2YA0A 1H61A 4UZSA 1L2UA 1UH2A 2YXGA 2CLMA 3LHVA 3W75A 3IRDA 3OIXA 4UFKA 5KSWA 3UXDA 3NZ1A 4BI7A 1UBSA 1OX4A 2ZRYA 3LCGA 3VO0A 1VJSA 1F7BA 3VM5A 3VX1A 2ISSA 2PRLA 1QW8A 3TA6A 2A6LA 4OJYA 1MW0A 1KFLA 4IOTA 1F2JA 2NXIA 3M5XA 3BUDA 2E0PA 4NXKA 1PL9A 5D33A 3W2NA 1Q6QA 2CLEA 4FXSA 5FF2A 4JFVA 3OVQA 1YXDA 2RKXA 3STFA 1SW7A 5LNUA 3HGOA 4KWVA 2F7OA 2WVSA 2I9EA 3CM4A 1CGWA 3L4VA 5ABTA 5FF0A 2P10A 2Q3RA 1BEUA 2BY2A 3EWUA 2B7QA 3ZT6A 4WSJA 3TQ0A 3W9ZA 3W70A 5DCEA 1H7OA 2ZRXA 4E2OA 4U2ZA 4PSRA 4FX7A 3WN6A 6TAAA 3HMJG 1R2TA 4M56A 5IBXA 3TJXA 3UG5A 4UQDA 4PA8A 4QJ1A 2PWHA 3B8DA 4OV4A 1XCFA 3G24A 3GVGA 3IGXA 3O16A 5CZSA 4LVAA 1SO6A 2E1DA 3HG5A 2X1SA 1V3MA 4ZQRA 1BF2A 1ME8A 4CLMA 5E1QA 3EX6A 1YPIA 5K9DA 3RFAA 1LROA 5G4EA 1OG0A 3CZGA 3BLKA 1W3NA 3A5FA 1CX9A 4M6QA 1Z42A 4MY8A 2G96A 3HGJA 1O5XA 1LBLA 4UZUA 3GK0A 3GXMA 1DHPA 1XCXA 4LVGA 2YYUA 4ZQNA 3ZSSA 4KWUA 7TAAA 2NV2A 1I2QA 4JTUA 2E09A 1GZGA 4HPXA 3PG9A 2ZZ5A 1W31A 3UNDA 5AB3A 1MW2A 4OU1A 1AQHA 2TRSA 4HKPA 3TTSA 3W76A 4FB7A 3TQKA 1O4UA 3R13A 1ZAHA 3DFOA 3LTYA 4MY1A 1MZHA 1MEWA 1QOPA 4IWWA 3LCLA 3GAYA 3LOTA 1D3GA 2BY0A 3DFSA 3KHJA 5HXMA 3BPWA 4CQ9A 4K39A 3MW7A 3BLPX 3K8MA 1CXIA 2DZUA 2ZTKA 2EKCA 1Z32X 3M0ZA 4JTJA 5FEZA 2A21A 1EO5A 2C18A 4EOUA 3FKKA 1KA9F 1EWDA 5DXXA 4IXHA 3QH2A 5AC8A 2A7RA 4E0CA 3BARA 4JTIA 1PS9A 1R34A 3M1ZA 2XN1A 2YCEA 3TDFA 1KGXA 4UMAA 3TROA 1OT1A 3LI1A 4UFMA 4GUIA 4ZL1A 1ONRA 4IJBA 2GUYA 3LERA 1WZAA 3KLLA 1LZOA 3UWQA 4MLRA 2H8XA 4NJHA 3NQ8A 2VFHA 5HPOA 2EEXA 1NAL1 3TONA 4DPQA 3OEXA 2PWEA 3W1AA 1FDZA 1W5NA 4RV8A 1J0IA 3WJWA 1KB3A 1JUEA 3DFPA 4WOZA 1T96A 2C0AA 1OF6A 2LLEA 3VCRA 3W1QA 3A22A 1VLIA 5CGTA 2BHUA 1O60A 3NPWA 5G4WA 3NQCA 3QJAA 1W0MA 3OLEA 1LRTA 3W84A 1GYNA 4IX0A 1VRDA 2V2HA 3K8LA 2VR5A 1Z44A 4GE8A 2EQDA 3BLBA 4KFOA 1WZMA 1AMYA 1Y0EA 3EDJA 3DX0A 2Y5EA 2CW6A 1YLVA 2J6XA 3BUBA 1RPXA 1UB3A 5D05A 4CVWA 4NU7A 1PIIA 3R2GA 3SSJA 3ZR6A 1G4PA 4XBSA 4KFNA 4CN6A 3QF0A 3MHFA 3L0NA 4DQWA 3ATZA 3STGA 3FKRA 1EA9C 3EXTA 2NXHA 4AMXA 5FEXA 1VFUA 4WZHA 2X16A 3RIKA 2IGTA 1A5AA 5CSRA 3H54A 1ZS2A 5E6ZA 4HIBA 3NYZA 1TQVA 2QMJA 4R7JA 2NT1A 1MO0A 2F7FA 4H7VA 2A1YA 3MI6A 1OABA 3W23A 4M19A 4X22A 4JTTA 3QSRA 2B4GA 2VUYA 4HOWA 2BHZA 1JI2A 3WFZA 2Y7GA 3PBVA 3M5VA 2QKFA 1W54A 1TIMA 4I7UA 3PR2A 2ZCGA 1JF5A 2ZZ3A 2WNWA 5AHLA 1GCYA 6TIMA 3A6OA 1JULA 4K8EA 3R5EA 2XVGA 3WENA 3HB9A 3LLFA 4OIFA 1CGUA 1UA7A 3O06A 1QDSA 4JTEA 2PC4A 1LDCA 1FCUA 2QCDB 3W7HA 1YXCA 4MOZA 4OQVA 4IPJA 4FNQA 3P74A 1KWGA 2ZX7A 4AEOA 2YOCA 3ZR4A 3W2JA 1KV8A 1EA0A 3W7LA 3LPOA 5LGXA 3BK0A 3R89A 1HO4A 2EAWA 2DH3A 5LHEA 1TRDA 3PB0A 3W2MA 3S1WA 1AL7A 3EDEA 4AMAA 2YYTA 1KWKA 1BTMA 3Q94A 4XKYB 3WY2A 4AIEA 2ZA1A 1R46A 3AMLA 2ZA3A 4AW7A 3G3MA 4NZJA 5F2IA 2ZE0A 3TUUA 3W1LA 2CLFA 2WSYA 3NNTA 2I1OA 1VQTA 2C19A 2E9BA 1GVRA 1V7YA 3EX1A 3JR2A 1CYGA 3T55A 2GPTA 1RZMA 5IBXC 1LM1A 3KRZA 3W07A 1SR9A 3ZFHA 3UY8A 4AMWA 3MP4A 2GOUA 2XIBA 1JXKA 3GXIA 2BX7A 2EPHA 1GYLA 2A2IA 9CGTA 5F4XA 2W6RA 3IVSA 4FXRA 2BTMA 4D2JA 4W9TA 3B05A 3L2IA 4GC4A 5K4ZA 3W88A 3LX9A 3LI0A 1EO7A 1EP2A 3G1YA 3G0SA 2RDWA 1R30A 3E96A 1UD5A 5J5DA 2OZ0A 3B04A 3UWUA 4J3UA 2H3BA 3FEMA 1LP6A 2F61A 1KFKA 5HULA 5D37A 1TQSA 3O63A 4O17A 3M16A 1KTNA 5FF3A 1KM1A 1JUKA 2WPBA 4FLOA 3KVMA 1QO5A 3EJPA 3RK8A 4LWWA 1T0OA 4TO8A 5G5IA 3N9SA 1PIGA 1H63A 4TMBA 4U31A 3TFCA 3PUOA 2ZUTA 3EWYA 4LUIA 3TJLA 3G8EA 3CZNA 3D52A 2BY1A 2VRKA 3HJEA 2A85A 2NX1A 3GXNA 2QR6A 1MEHA 3IIVA 3TC6A 2WVTA 3O6DA 3O05A 4JTKA 1K02A 3LCIA 1JCMP 2NX9A 1MEIA 3BGJA 3VE7A 1EIXA 3S9YA 4O1BA 2WVVB 4HOZA 1KGWA 2QCFA 2GUUA 2QLYA 3EJQA 3NL6A 5C2XA 1QPQA 2Y6ZA 1OFEA 4O0KA 3TR2A 4UQ9A 3DX4A 1FXPA 3IIOA 1SMDA 3GBEA 3EDDA 5CLWA 2X2GA 4H3DA 3T7VA 1VYRA 4BFAA 4UCFA 4JFSA 4AIOA 1TV7A 5HUPA 3WJSA 1YDVA 4JTFA 4O53A 3BO9A 2ABAA 4O1AA 1S5WA 3CLWA 2G5WA 1KCLA 1KLZA 1MW3A 2VFIA 3MP3A 1M5WA 1HL9A 4H8HA 4O54A 2OW6A 1OX5A 3VNYA 3C2RA 2E6YA 2QPUA 3M07A 4TMCA 3FAWA 1O5KA 3LLDA 2Y85A 3USBA 3E02A 1U83A 3I68A 1I75A 4PEKA 4DELA 1Z48A 1EPXA 2XN0A 5G2IA 2EHHA 4U28A 2J9XA 3O6YX 1RP9A 1XXXA 4GQRA 2E8YA 1LBFA 2WO5A 4RXGA 1H7XA 2ISWA 5LGZA 1KM5A 2YW3A 2V30A 3G1AA 3I7SA 1N55A 3NO5A 1GVOA 2EF9A 3UYCA 4Z0SA 1FXQA 3HO8A 2CPUA 3EJTA 5BRQA 3L0KA 3EX2A 1O94A 3PULA 3BVUA 3LM7A 1WE5A 3BAXA 7TIMA 4AYGA 4AHQA 4LUJA 3G1HA 2BY3A 2Y7EA 1QW9A 3T4CA 3MO7A 2YX0A 2DP3A 3QMSA 1KM6A 1PCKA 1JIBA 1QWNA 3SIZA 3KXQA 3M47A 4XBKA 4LVBA 3MBFA 1BVNP 1RV8A 2QCMA 4K7VA 2WSQA 3BW4A 2D0GA 4WLCA 1FWSA 1OF8A 5AHNA 2Y70A 1Z41A 2BSLA 3BLIA 4N02A 2DORA 4WD0A 4Y8FA 3IJ8A 1TSIA 4BZYA 3ZO9A 1S5TA 2DJXA 2Y61A 2YPIA 3SGUA 1JCLA 3TU9A 3C4UA 3C61A 1FDJA 3NQAA 2Z0IA 4UIOA 3NM1A 2BXZA 2V2DA 3VSVA 1F74A 4AWUA 4NJGA 5HR6A 1LCOA 5TQLA 1Q6OA 3UWVA 3E12A 2QV4A 1TRIA 3M41A 3IJ7A 1I8JA 2QJHA 1TQJA 4PC8A 1TB3A 3T78A 1EUAA 4GXMA 4M6VA 3MYOA 3DI0A 1HNYA 3GTNA 1KM0A 3IIPA 3PUDA 3W74A 4UUIA 2C15A 3W2UA 2ALDA 1XV8A 4CN4A 3THAA 1R2RA 3VU2A 1WYIA 3QSTA 1XBXA 5KITA 2J24A 3SJ3A 3BW2A 4GRSA 5AFDA 3WDIA 3UG3A 1W56A 3C52A 3E9AA 3KRUA 5BW6A 2ZX5A 1JDDA 1OYBA 1AG1O 4Z1DA 2QJIA 2ZQ0A 1JCYA 8CGTA 4JY9A
chains in the Genus database with same CATH superfamily
2H9GB 5HDRA 1OAJA 1X1OA 2XUCA 1JVNA 1R5IA 1NF7A 2P0IA 1MUJB 1H7PA 3HE7A 4JYDA 4Z7WB 2LLLA 3FQRB 3VGHA 5LWYL 3NQFA 2JVUA 1JCTA 5KAQG 4NC1C 2K3TA 4HPOL 4Q32A 5DVMA 3MJ7A 4LK4A 1RQBA 3ML8A 5C0BB 3P9LA 2R0ZH 5DBTA 3M44A 3QDJD 4QLLA 4GUGA 2JTYA 4LSPL 4WX2A 5BMFL 4PLKC 2YPVH 2YCLA 4KVCL 4U1JA 4WJ8A 5KVEH 5ALBH 4BQ6A 4W84A 1KT2A 3PBGA 3MVIA 3FFCD 2O9OA 2ZUYA 4F2EA 4ETQA 1KJ2A 2J8TA 2XKUA 2Y2TA 4CCEA 3VXPA 3QNZA 2PRMA 3E80A 2B2XH 3AQXA 1JZ6A 3GI9L 5JTWA 3U3HA 1NBQA 1AHWC 3L5IA 1NFIA 1A8ZA 2Y1AA 2XWDA 1FG9C 4KDWA 3TZVD 2VM8A 4R7LA 2JKXA 4BD4A 3AW5A 4X6DF 3ABRA 1R5VA 3I6RA 4B0MB 1OZTG 3QE5A 4RDVA 3OQRA 5INCA 1J88A 1PVHA 2CZFA 3X41A 4NZ1A 1IB5A 4GRWE 4JRLA 1B3OA 4NIRA 1E28A 1MFDL 5D4JA 1MJ7L 5C86A 2EIDA 5C6MA 1JRCA 4HFWA 1OL0A 2XN9B 4OLUH 4JKWA 4UINH 3UZYA 3QWOA 3L3OB 3OGOE 1BHGA 3RFZB 4G9DA 3S9ZA 2E40A 3RGBA 3UC0L 4XP6L 4I5BB 1KFEA 4W9KC 5EBMB 4M03A 4NYLA 8A3HA 2VDKH 5E51A 2JJVA 1L7IH 5C0AB 3L3KB 4AC7C 3HAEA 2BP8A 1QPKA 1GVIA 4LVHB 5J8OA 4EMZA 4XAYA 1RJOA 4XVOA 3O4LD 1E6XM 4DWSD 1GGUA 3VXMD 3B9VA 1FIGL 4PJIB 2DQGL 4Q7BA 1JPEA 1BZ8A 4AG4H 4PP1C 1GWJA 1J8VA 2OQYA 2R4RH 2VSCA 8RUCA 4PR5A 4YC2B 5C7VA 4FHBD 4PFEA 1A53A 4LO9A 4PBDA 1MQQA 4E3VA 4HXBH 4RWYH 2ZUWA 5HHPA 4FEMA 2LQRA 4DJFD 3WUFA 4AIXA 1J2WA 1PDKA 1SM3H 5D93C 5AVYB 3B3DA 2CZEA 1IQDA 4B9YA 4CADA 3PABB 4AD4A 2PUQT 3ZKMD 1NICA 2WMIB 2F68X 4OM0H 4M6PA 4EQ2A 1MLCB 1MZZA 5KTEL 2DS4A 3UXLA 2F74A 3LKOA 4OJCA 3WLHA 8FABA 5KYXA 4JX0A 3LXUX 4HUUA 1F8MA 3HV8A 3OSKA 2IBBA 5GZOD 1KR1A 4L0PB 1AP2A 4E2DA 3WLBA 4K5OA 1BWLA 2EYRA 3WQDA 3MV8E 2ZG1A 4X0VA 4F93B 3B5TA 4N2CA 1DQWA 4HQQL 1P7QB 4NZRL 3SN0A 2HPIA 2R14A 3FSUA 5AB0A 1E6RA 2BT3A 1EBAA 3GSOA 4HK0B 4G6JL 4G83A 4HQVA 4GW4A 1VGEH 5DYOB 3WLOA 4MNGE 4ZO9A 4OZ4A 4BE5A 5DJXA 4JO2L 1D5ZB 3PGDB 3NDOA 4DGIL 4GLEA 2ZRUA 3D2TA 5J1AB 1M7OA 3NL2A 3LMJL 1L0QA 1BLNB 2D7QA 3VI4F 2YBGA 4LCCB 2GFBB 2NXYB 2PDKA 2B4CH 2XH7A 4ECNA 4HNCA 1R9ZA 2L7EA 4J1UA 3HZMB 3Q8EA 3BEVB 5D7HA 1Q72L 3P30H 3ZO0A 5CN2A 4B96A 4NI6A 3FRUA 1C93A 4G8GD 4P2QB 2HB0A 5EWIL 2Q8LA 1UI8A 2A6DA 2BP5M 2DLFH 3KZ8A 3AAZA 3MA7B 1QHPA 3SDXF 4XZHA 4HVXA 2Y24A 2BNJA 1BZ7B 4FQQB 1THFD 1AIFA 1TVHB 2O61A 3CCHA 3SBRA 1S38A 2C1OB 7PCYA 3E0IA 1NMBH 2WWMC 4PU2A 2DZWA 2PF6A 5JNYA 2ZRWA 3W1ZA 4PRHE 2X1RA 2GSJA 1WZKA 2A3LA 4OJFH 2NQ5A 2EACA 1JG9A 3OZ9H 1K4DB 1AKPA 3FSZA 2CPCA 5DZAA 2A0LD 2C7UB 1BAGA 4K7PX 2M1KA 4LEXH 4JQAA 3ENEA 3DXAB 4J3TA 3MYPA 3ZQXA 1TVPA 3V7PA 1E27A 4XO5A 3I9GH 4K23L 3THUA 1XF3B 2L8AA 1C5CH 5HVHB 3EYSH 2DWEA 5BZAA 1XIWC 1OCJA 6FABH 3ZDZB 1THAA 4OFPA 1DIKA 2IAMB 3C12A 5A6MA 4XVSL 2NUYA 3FYOA 2X4UB 4KF1A 3U1PA 4OTXH 1R0AL 1W9DM 1PTZA 3LSOB 4EQ3A 4L2YA 4MPKA 4MWFB 5EIIA 2LABA 3WHXA 3B9KA 2HH0H 3AAMA 1MZRA 4OFVA 3HQPA 2W59A 3IK4A 2VWSA 1J8HD 4OCNC 3FSAA 1R47A 4K7FA 3FQNB 2PZNA 1RHCA 2AAMA 3OR7B 1VJZA 3L95B 3PP7A 4X99B 5C92A 2DQXA 2CXGA 4LEBA 3E5PA 1RZGB 4DSYA 5JIDA 2QGBA 3QOMA 4RH4A 3D46A 3D39B 1U8LB 1H5BC 4UC5A 1RK1B 5IW1A 5EO0A 1K03A 1EFXA 4XP4H 1BYBA 2K1MA 4XTIA 1UZ6E 1EIBA 2XFWA 4OK4A 4GY7A 1OIMA 4ONGH 5DMNA 1UUMA 5FGRA 4M3KB 3CV1A 4KI5C 2PCQA 2EJAA 1ICSA 1JNNL 4DGYL 2CZ5A 5IVXB 1U8CB 3E0LA 1XGQB 3UH8A 3N0PB 2ZCLL 2ZSWB 3H2MA 4HUNB 3F6JA 4HUXB 2FAUA 5HYJA 4H1LB 4NZ5A 1POKA 4UQAA 4EIVA 4W70A 3LEXB 1K6AA 4WQ6A 3N17A 3T8QA 3V6FA 4NQTA 1QR1B 1BRLB 3PRZA 1GKRA 1G43A 1F2QA 5F1SA 3IF1B 1E6PA 3HN3A 4HT3A 1G6RH 5DZOA 3ZT5A 4KTYA 2G4FA 5C0QA 1M05B 1UKPA 5IR1B 4PJFB 2ZP0T 2IV8A 1RHHA 4WWKB 4YDJA 3G6JE 5GNYA 3RVTC 3WH5A 2GHWB 1MRQA 3GB7A 5F9WB 4JM2D 3WTWA 4A3HA 1UEYA 4PMZA 3WTSA 4RZ6A 3QPXL 2HUHA 2B16A 4KV5E 3VI3F 1XIBA 3NESA 4YAQA 4F0KA 1I53A 3QORD 4KK8D 1RXOB 1IM3D 3NCEB 2CLRB 3MLVL 1MMXA 4HCLA 4MBRA 4IDLA 1CBJA 4BZHA 4WJ5A 3HIZA 3WIFA 3N6JA 1RSYA 2M8XA 4PRTA 1JYXA 1AD0B 5FOBA 1U91B 2AXFA 2EADA 5CPTA 3E38A 1K7XA 1MH5A 4P23B 4X50A 5C9WA 3TWCL 3C9NB 3RN6A 1V7WA 3L5MA 2I25N 1U3HB 3IPBA 4PJ9D 3GSNB 1Q3NA 4D9LL 1H09A 3RTQD 2VR6A 1I60A 4QRQB 4DP0X 3ZT7A 2OJZH 2G2RA 4WU7B 2B7NA 4ZRGA 4P2CG 3RYSA 3PJUA 1JF1B 3FUFA 3COOA 1TKWB 3X17A 4ZMAT 4IL0A 1T1XA 5ACMA 1MJJB 1INQB 1RZFL 2CR3A 1PO9A 2ED9A 5D7LB 1PHWA 4ZGYA 2X7LA 4HIEB 1KUMA 2BB0A 2JBMA 1SDDB 4X42A 2P4AB 4QTHB 2UVEA 1HHIA 3GG7A 3H7BB 4NO5B 1NEYA 2BMKA 1XLGA 4L1SA 4WCYH 1NFAA 4KQ4L 3BSZL 3TVMA 5EUKB 1DVFC 4Y5XB 2ZYSA 4PY8I 3N3TA 5D9SB 4CSPA 4C5YA 4U1NB 1IBYA 4YXHH 1UC4A 2FJFB 4N90D 2C9VA 2BXVA 3CUJA 2NT0A 4FEIA 3IKKA 4QOKE 3ZMNA 4FQXB 3H53A 4PTDA 3RCYA 4RXFA 4K8HA 2XETA 5C9JA 5DTFB 5EYWA 1A25A 3NREA 1G1KA 2DQDL 4WRHA 3DCPA 3TNBA 3WJJC 3L0GA 5F71A 3QFJD 4D6CA 3OO2A 4TQIA 5CEXB 4AYSA 4OJZA 2CAKA 3QDGE 3LSBA 1DJIA 4LHQB 3CXHJ 3P60A 1A7OL 3AFJA 3THML 5HI3C 3AQUA 4N8PA 1JFQL 3NIDB 3ATFA 3MFFB 2I32A 2IOIA 3XINA 2J88A 4JW3A 3N4EA 3WD4A 2JF7A 2CK0H 1MFEL 1QLRB 4MPQA 4WUKH 3AHZA 1QI4A 4QLKA 4MJMA 1XM3A 2MNWA 1ZAJA 2QVHA 1UATA 1BLIA 5A94A 4RGNC 4ZK8A 3H9HA 1Z7AA 3LCXA 4WW2B 4B5WA 5F9OH 1H0DA 1QFEA 4U6VL 2VLKB 3ZR5A 3WUEA 3KS0J 5DJ2B 2YD5A 1NBZA 1SHWA 4PJIF 2WBJD 3CQKA 3N43B 1I8KB 1MJUL 5A2CA 1JPMA 3A13A 2DI8A 3BLCA 4IG2A 3BGFB 2H0PA 1ZVSB 5DJ0B 5DD3H 5TK4A 1H1ZA 1U8KB 2ZJSH 1GOFA 2IQ0A 4S38A 4ZO7A 3U4AA 4OLEA 4ZNCD 3VDGA 1W0VB 1N0XH 1X5GA 3U0WH 3P0YL 5GS2H 3CUFA 4POYA 4YO0B 4H2HA 1XYAA 2VLME 1WKFA 4FFYH 4FXLA 4MJZA 5A2KH 1VACA 5IP4A 4LU0A 2N0MA 3QZWG 3FB6B 1HHKB 4M5YH 1W2PA 3S4DA 1S2WA 1E2ZA 5A8MA 1BMGA 2WVYA 5CKGA 5FJUA 2QFPA 1HL8A 1CTNA 1HYRC 1W91A 4BK5C 3WHE0 1WIOA 2R69L 5HHNB 4YR6A 3NP4A 1RY8A 1FFOA 3U0TB 1NEZA 1NTHA 4MNLA 1SJCA 4LT7A 5ADPL 1T4KB 5D1XD 3E6FA 3VWKD 2OXNA 3D18A 2R24A 3F85A 4AI7A 1I1YA 3E3QE 2WZHA 4R96A 4ZB2A 3QDMD 1TQWA 2BOEX 1OTUD 3KIIA 3IDUA 1NCJA 3ZGHA 4TKWA 1ZLUH 2PLMA 1N2RA 1EQWA 1FH8A 5T9BG 3RDJA 3NOIA 3I10A 4YXLH 3QFGA 4WO4C 1QNOA 1XSKA 5E9AA 2YA0A 1OGTA 3WFHB 1UH2A 2AS5M 2LFGA 3LHVA 4ZX4A 4IBWA 3NZ1A 2R0LL 4RGOH 5GS0L 2J75A 3W39B 3FCSB 2FIKA 2WXGA 1F7BA 1P6BA 1BMZA 2FTWA 3E3HA 2Q9OA 1WBXB 3WLWD 3N85L 4Q3MA 5IWLA 3ITCA 1CGWA 2QQNH 3GPSA 1S9XA 4QAMB 3VUSA 2ZRXA 4LPTA 4FX7A 2WWKT 1EERB 5CBEA 4UQDA 3O16A 5CZSA 1Y6MR 2GY5A 3R8HA 4TN9A 5JIIA 3HG5A 3NQIA 3MRJA 4OZGB 3MGTA 1CX9A 3MODH 5FJTA 1Q9WB 3CFEB 5L9DH 3LZRA 1CF1A 3C08L 2UXGA 2G3FA 4KXZH 3CDGA 1W5ZA 1GZGA 1C16A 3JWOH 4IIQB 4ORZC 2CFGA 2XM1A 4KH2A 1RUPL 2OAAA 2PW2B 3W26A 2OMWB 3QZAA 3W76A 4FB7A 3IFOA 4J3OH 3TS8A 5I1GL 3SDCD 5JPNA 5DS8B 2LVEA 5JUVA 1ORQB 4CQ9A 1EJ8A 3AALA 4M6OL 3E1ZA 4FP8L 4JTJA 4TL4A 5FUZL 2C18A 2DYSB 2BC4B 2CQTA 5C09B 1IBFA 3V0HA 3KTCA 4LPYA 4OD3L 4LDCA 5SWSD 2WO3B 4MLRA 3O11B 5F1NB 1R8LA 3FGCA 5HY9B 1RJYA 4Y4HD 1PZSA 3O3BA 1FFNA 4BQ2A 5CU9A 5CBIA 2ANUA 1AMYA 1JV5A 4MX7B 3WN5B 3BXWA 1RALA 4GQGA 3BUBA 3ABGA 2HLAB 1UWSA 4KFNA 1FYTB 1U21A 2QHLA 2CBUA 1VFUA 4Y2OB 2ZAGA 3H56A 1ZS2A 3B7SA 3RWFB 2IALA 1AH0A 4AD1A 3V0UA 4KZ0A 2UWEB 3MI6A 1OABA 3AS2A 4UM9B 5E8OA 2B0SL 3EYVB 4B3KA 3M5VA 4ZMPA 2OEMA 2Z92B 2FQEA 2OO6A 3INUH 3SE3A 1I7TA 2W94A 2AQ2A 1ITUA 1RY7B 1QQDB 3SKMB 2G9HA 3BK0A 1BQHB 1IEBB 5T1JA 2Z1XA 1WJ3A 2KDYA 5JHLL 3LD5A 3MKCA 1LP9B 4IJ3C 3TGXA 4TVCA 4LF2A 3J7HA 3EX1A 1CYGA 1MKFA 4ERGA 2XIBA 2BX7A 2DKUA 3FQTA 4H5SB 2H45A 2W6RA 2I24N 4JHVA 3UTPD 1ORSB 1MJ8L 3GFZA 2NVDA 2KAUC 1GPFA 5J6GA 4IW4C 5JYLA 3IDGA 2WPBA 4FLOA 3T4YA 5DK2B 4XG1A 1BJMA 4IBZA 4NQXA 4UT6H 2WQAA 4ZUUB 4U1IB 3O6DA 2INZA 4I0PC 2I9TA 4XMLL 2AOSA 5MEPB 1W1YA 5ALCH 4LP4A 2DICA 3WTTA 2GUUA 2XFYA 4JPWL 1MWAH 4YHIA 1AZVA 3FFCB 4MJJA 2MOVA 2X0HA 2C9XA 1XPGA 1KV3A 5LNDA 1T5XB 4X63A 4BUQA 3RWIA 1CGSL 3GNML 1W1B1 1LEIB 4KPLA 2Y85A 1LEGA 1I75A 3R4DA 2X42A 4OK2A 1JBJA 4B5SA 2JK5A 3UZQA 1DQJA 3TR9A 3TZVB 3PJXA 2JXMB 2CNYA 1I8LA 4AYGA 2E6JA 3F7JA 6REQA 4W9JC 1Z3GH 1A14H 3MJ6A 4IJTA 2Y7EA 4FKKA 3QMSA 3T0EA 1K4HA 4XAZA 4HUWB 1OF8A 4WD0A 3KNBB 4BZYA 4K9EL 2DJXA 4AC2A 3TU9A 4ZUVB 2QV4A 3TNNA 2MCPH 3S7GA 4M6VA 1ET7A 4G6MH 3W0WB 4QPEA 3W74A 4N8VG 5LQBH 4F9LC 3QDHA 3N6HA 3ZKND 1W2ZA 4ELMF 3CQPA 1NIBA 1P7QD 2N3JA 1AR1C 3BXNB 2W81C 4NEIA 5DR5L 3UA4A 3S3JA 1XH0A 3RWGA 3AT0A 2ATSA 4HNTA 3ULUC 1GVYA 3KYAA 4QTGA 5E6IA 5DRZA 4Y1AA 3O3DA 4TSAH 5LNVA 1U8MB 1TMCB 5LAPA 5JLZB 1L0PA 1P6WA 3FO9A 3A5VA 3O4LB 1P7KB 4L80A 4DWSB 3VXMB 1XDMA 4MMIA 3DGCR 3KYKL 1J9QA 2E86A 3B2UD 1AZ2A 1E2VA 4AGNA 1FRGL 2QQLL 3ESPA 4GIYA 4ZW3A 1W2KT 4S3EA 5IHHA 1LK3H 2HFFA 1AGFA 2XV2A 3EJUA 5IVZB 3UMTA 1KYOK 3HPLA 3MT1A 1Y65A 3CQJA 1MCRA 5JUEL 1K3ZA 5AVTB 4N0YL 2GSEA 1GUVA 5K9XA 4ZS6D 4GY4A 3BQVA 3TBTB 2DT2A 2IG2L 2PYFA 3AI0A 2YGQA 4PFMA 2IQAA 1PZ0A 5GGUB 4TVDA 1XGEA 3RNDA 4IBVA 4HJWA 4QHKI 2ZP8A 1A7PL 2F2HA 4QRSB 1H50A 1YY9D 4IU3A 4GKNA 4RIRB 4LS2A 4JFXA 5HHQB 3QUYB 1D3CA 5HYJE 5DHEA 4K5LA 1JERA 5F1UA 4DF2A 5EMYA 2ED6A 4LRSA 5C0DA 5AKRA 4M6NH 4J2QA 4P4KD 2GJJA 1JXJA 3MJWA 4JHZA 5FA5A 4PP2B 4YSTA 3NFNB 2D23A 4CU8A 4OGXL 4APQD 4Y19D 5D2TA 4PMEA 1NUNB 4BKNA 4JCMA 2YN5A 4MWAD 4C1KA 5F9DC 3HI7A 5FA3B 2GK0A 4GI4A 3HC4H 1GGBL 4P57A 4P9ML 4ZUSA 3T3ME 4TXEA 3CN1A 2H2SD 4PVNA 1P43A 1YAZA 2F54A 4HLEA 5DYFA 4HC1H 1GSKA 3IJHB 2X4PA 4YSEA 3WO8A 3FT9A 2KZKA 4NT0A 2D24A 4ADUA 2IWKA 3U48A 4ZOEA 5BWFA 1NWTA 3SDOA 3B9AA 1R6WA 4W87A 3KX6A 3PSWA 1UR2A 4EOWH 2JELL 1QRKA 3N43F 4G8GB 3BKYL 4KTEH 4URTB 1T8XA 3B2MA 2YXXA 5F0PB 2DSUA 4JICA 3TXZA 3BIKA 3NN8B 5IQ7H 4K55A 1P9MC 4XMKH 4RNFA 3ZWTA 2G30A 1JGDB 2DZVA 1OY0A 3R8RA 1MFUA 4MKNA 4LLYA 3ZW3A 4P5MA 3SUWA 5HMFA 2LFEA 2DQHH 1IBZA 2UZIL 1NP2A 5CIPH 5CS7A 4JD4A 1WDQA 3D39D 5AW8B 3MXVH 3UL4A 3AVEA 2Y8VA 4A2GA 2FLRT 1E1CB 3LHPL 5MKGB 2VX5A 1E6JH 1J5IA 2A7NA 3W7GA 2Q2EB 1MREH 4H88L 1V7XA 2Z4QB 5DFVC 2WVZA 3BUPA 1B31A 1DVJA 5A6KA 1US0A 3F3HA 3LUTA 1GW0A 4POZD 4DY1A 4X2RA 1PHQA 3BN9D 2AABH 3KEHA 1ONQB 4HKZB 4D7BA 5D1ZD 4M6UA 4HJFA 2ADGB 5I6XB 5JA9A 4DP9X 2IQTA 3MR9A 1NCTA 1IRAY 3LS4L 5FHBL 5IKCA 2EG7A 3VIPA 4EK7A 3EADA 4MBOA 3IU3A 1Q4WA 1BD2A 4XNDA 4QJ4B 1Y1UA 3RPKA 4QXWA 5GS2D 2VEKA 1QPPA 4KK6D 1J8HB 1A5UA 3P8IA 4X6DB 3OKEB 1RK7A 5DHDA 1NELA 1BAFH 5IBUB 4OV5A 3TYFB 2ZX9A 1GAFL 1B0WA 3F7VA 4ABVA 1YJDC 1GEQA 5HINA 4YMZA 4ALAL 4C7DA 4D6HA 2QGDA 2IH9A 2F19L 2O6DA 4MB1A 1I9IL 1Q9OB 1UJQA 3ABSA 4POCA 2YSSA 3OPUA 4A7GA 4PJ8C 2FQFA 3WMSA 2Z1KA 3QC0A 1WYJA 5KJ4A 1U3HD 4GYBA 3GDKA 3DX8A 2Y6SC 3WD2A 2DZEA 5LGHL 4X9HA 2E6DA 4KW2A 1A7QH 4LSUL 1I4FB 5FA4B 2WMPB 1QAFA 1H0IA 1QI2A 2C3ZA 3ULAB 4J6RL 4LH8A 3VXNA 2V6AA 1GYAA 1KJMA 3SECA 2VVSA 1ZLPA 2O9RA 3I9PA 4M8QA 5AAWC 4FF7A 1XF2B 1H1YA 1YEWA 1SLVA 3W83A 1CE1H 5IMLB 4ZMTA 1VPYA 2XDHA 3LPFA 1KENH 4LHUG 4WV1B 2GUOA 4FNSA 4YIQB 5IBLD 3MRBB 2HN7B 4PTUA 4YLBA 2CYGA 3WFAA 4JO1H 2J1ZA 4J28A 2CUIA 4PTTA 2YUXA 3ETBJ 2R1XB 5TDOA 4CSSA 3D0AA 3NZUA 2Y9RT 1F8TH 1MQ8A 3WEBA 4JM2B 4XZ4A 3VKKA 3SKUD 3N5AA 4F8XA 4A3RA 4MDJB 1DBJH 1SW3A 1SMAA 1YDYA 3FLUA 4LLQB 1WAEA 2WC3A 1WA0X 4WNQA 1E0WA 1MHPH 3QORB 4YNYB 1XCTB 2HVNA 1IM3B 2OWXA 3R18A 3VFVB 1FWBC 1X1HA 3AADB 1EPVA 4X0NA 4O00A 1BWWA 4LCSA 4K94C 5AHFA 1I1RA 4IEFA 3ZZLA 1P6CA 4JO4L 4AISA 2EEBA 1JZFA 2VZVA 5TQ2H 3LRSB 5I1LA 1DWAM 2WSRA 1N0LB 3PAYA 3TF7C 4GQ0A 3MJ8A 5T3ZE 1QX1A 4J3SA 2WYZA 3HI5L 3MBWB 3L6FB 2J7HA 1ISYA 3OHXC 1Q1JL 4PG9A 2GITA 4U4IA 1SZRA 1X96A 1LQSR 3NAAL 4PJ9B 4P99A 1KLGA 4PUUA 1SO5A 3FU0A 3CVHA 4I4WA 2QUNA 4Z3GA 3C2FA 1YEHL 1H51A 2OPJA 4KI1A 2DM4A 1URLA 1NCNA 2R6OA 3FYYA 4IRSC 4ORIA 3FS9A 3H6OA 1UW9A 4NAMA 3BOLA 5LB1A 3G04B 3VI4B 2RAMA 4FRWA 3LHAA 2OTUA 3SGKC 3WTYA 2EXWD 4RZ5A 2R0WL 1ZLUK 3H42L 2N7BA 3EEGA 1WDDA 2J1WA 4XCCL 2EH7H 5GRUH 1G01A 1LRQA 3R4IA 4HSOA 4HSQA 3CFKA 4PY8J 5E95B 3WY3A 1EB3A 5HI5C 1GY2A 2F7QA 3WEAA 1E9LA 3ZL1A 4DKAA 5I06A 4MS8D 1DVQA 2OJEA 3AQDA 4HK6A 1MFAL 4PFHA 1OM3L 3RIFK 2VISA 3ET9F 5FJPA 2UY5A 3WNOA 3GXUB 1WD8A 1PLCA 1GJUA 1WAPA 4Q6JA 4QGCA 4KAQL 5A6BA 1J0ZA 2DGAA 3VTRA 4H0LC 2ZDRA 4XCEB 5HQMA 3R19A 2IAAC 4JPKH 4DZ8B 2VDQL 3FOMB 1GIGL 5BQ7B 3QFJB 2NQCA 2XBTA 4OZFG 5A2JH 2VDLL 4JY5L 3T8XA 5GXBB 4JR9L 4HEPG 5I8EA 4Q7IA 1BBJA 1FFPB 4UTFA 2K6YA 4ROPA 3FQ2A 2KBGA 5DK0B 1A4JA 5CEZL 3QEUB 2JTDA 1YN6A 2VZSA 4DBSA 2C11A 5JXQA 3MCMA 2ZNWA 2ZL8A 3RR4A 1AZ1A 2HT4D 4XVEA 1DL3A 4XTRD 4EXPX 1LQAA 1NDGA 4UTBL 3S8HA 1YEGL 2V69A 3V4UH 3BCFA 3DX2A 2VERN 3FU6A 2IDFA 3NJLA 3QJQB 2VMFA 5CUSL 3FSWA 2WBJB 2Z64C 5GZNC 1TO5A 3O7UA 2OV0A 4CC4C 3KPOB 5D2LE 4PJGB 2M83A 2F58L 1BREA 1UQYA 5SWZB 3S34L 3W28A 2R1YA 5TBOA 3N15A 4I8YA 2HK0A 2DVTA 1NCOA 2WXLA 1U92B 1EXGA 2WC7A 4UOW0 3NBBA 4X6BA 1UR8A 1ND0B 4KESA 4UT9H 2ZZ2A 1T7XA 5LXGL 1LEKB 3QIWD 3VOJA 2Z8WC 4FI8A 3UDWA 3GSQB 4RAUB 4AZ5A 1D9KA 4OB5H 1S7RA 3FXGA 5HP5A 2YBVA 4UUJA 5HHMD 3EGDB 3HQ1A 1SVDA 4NO3B 5AZUA 3I74A 1ONWA 3O3AA 4RK8A 3SUUA 3B37A 4F9JA 1PPIA 3O1NA 2VOTA 3VXSB 2FT7A 3IWVA 4X5XB 5D1XB 3VWKB 3HGSA 1B0IA 3F4VA 3QZBA 2NLJB 5DXYA 5I3JA 4O51B 2EIEA 3QDMB 3KWXA 4DCQB 2X1IA 1FORH 1LL6A 3VA2C 2YAEA 5EMKA 4LPXA 2Q0ZX 3ZE0B 1BXXA 1E5AA 1PTAA 1TMHA 5I02A 3TIDA 4YXKH 1PZCA 2NR6A 3OW1A 4HU3A 1HILA 3UO1H 3IIXA 3BCDA 4HXAH 1GPOL 2P8PA 4UTLA 3O2WL 4U2YA 1DQQB 3G6MA 2AJUL 2NY4D 1WFJA 1FTXA 2LV4A 5EEWA 4JANB 4OF6A 1AW1A 1A2YB 1B3ZA 1L7TH 3T0EE 5IOPA 4A6YH 4PMRA 4TQHA 3PL6D 1QBLH 2XWCA 4DKFH 1IT8A 5DCDA 4V1DD 3WNPA 3VI3B 4EANA 4HLJA 2BNQA 3FBKA 3GUGA 2P88A 4XX1G 3GKZA 1TEFA 2D2JA 4AEFA 4ACZA 2H90A 2DQIL 3KOZA 4NKMB 4F2MB 1BQKA 2A3HA 2C7FA 2IQDA 1SXNA 4GFSA 4XB8A 3KTSA 4LCUB 2P8MB 3GJFH 3GSWA 3TBWA 4PODA 3B8YA 3CSBA 4I2XB 4GYFA 4J4PD 4ODVH 1HHHA 2IBGA 2PXYB 5AC4A 4K1WA 4Y1AE 4FFWC 1ZCCA 3T6CA 1MEXH 2W95A 5JO5B 3SDCB 1YPZE 5ABEA 4ES4A 1W32A 2R4SH 3FRPB 4PS8A 4ZQKB 1ZE3C 3OA3A 2FEDC 4Y4FB 3PPHA 4OCLC 5FYLH 2WQ8A 1I2OA 2A74A 2F7PA 5SWSB 3DSNA 3TYUA 4XPFH 3G9AB 2HCZX 1VFAA 4HYWA 4LOUD 4O2EA 3V0WL 3GO1H 5FGCE 4KTGA 4A7SA 1Q6LA 4M93B 3SKOB 1QNRA 4Y4HB 4PJEF 5IHUH 1CLCA 4GP4B 1F3DJ 3WTVA 1IGYA 4S1RH 3S1VA 3VFUB 1FL6A 3RGVD 1YEFL 3TP4A 5I2UA 3CBJB 2NY5H 1JNDA 4OCXH 2CLMA 4HIQA 3FT0A 1E0UA 4D0BB 3M0MA 3P4NB 3TA6A 1UXMA 4IOTA 4ZA0A 1U0QA 3MRKA 3C2AL 1FN4B 2XX1A 3RJDA 5E7FA 1W1TA 2WVSA 5AOKA 5ESQA 2F15A 4L8DA 3KHQA 5ETUB 3BSMA 1EEZB 1SLWA 4U2ZA 2Q8XA 3GSMA 6TAAA 1NMAL 4YVUA 3FQWA 3RBSA 2Y7SA 4AYMC 4QJ1A 3K2UH 2J88L 1E5YA 3C75A 4EP8C 1OG0A 4H6EA 3CZGA 1W3NA 3W0WD 4EO5A 1WITA 3F62A 1MF2L 1LE5B 4NOFA 5CJ5A 2E9GA 2OR8A 1F0LA 2KKQA 3OX8A 2F54E 3BFQG 4JTUA 2Z28A 3VYNA 3T4AB 1MW2A 1VGKA 3QIUD 2DL2A 3RU8H 3ANVA 5I5IA 1T41A 4ONHB 2PP3A 3LTYA 4L37A 3B7TA 4WHDA 3BPWA 4O9HL 1SBSH 3MXWH 3NFUA 5IJVB 4HJGA 2PEVA 2ZTKA 2DBJA 5FEZA 1W8EA 1EO8L 4KRTA 4GOAA 2XIOA 1P4LB 3P77A 3QH2A 5AC8A 3ES6B 4E0CA 1R34A 3P9WB 1IVUA 3CXFA 3ARFD 3LI1A 3TN0A 3C0LA 3A67H 4ZX6A 3OEXA 2XOTA 1XHGA 2ORBH 1T96A 5KZCD 1NGXA 3AS1A 2P3YA 1PTDA 1W0MA 1J1XL 1AZNA 3PHOB 3GHSA 2XGIA 3FQYA 4KFOA 4HIIB 3QS3A 3MUJA 4FA6A 1JNHA 1YLVA 4JB9H 4PB0H 5SX4H 1ACYL 4CVWA 1OTSD 4XNMB 3C09C 3ZR6A 3H2EA 3OPZH 4YS1A 4XD5A 3AHXA 2X28A 4M0XA 4AMXA 5DUML 2ITFA 3X14B 4HS3A 2RDYA 5F97E 5B8CB 4JM2F 5B1BB 2A1YA 3LOWA 1TNNA 2ID5A 1D5RA 2DN7A 2OZTA 2VUOA 2QKFA 1V7NH 1QVOB 4ROQA 3NDYA 3WMBA 3DFHA 4YQXL 4OGYH 1CGUA 4JVPA 1X5IA 1XBRA 3QUYD 2GG1A 4PGBB 4OFDA 5DC2A 4I6KA 5T3ZL 1AG0A 1QHZA 5I0XA 3N4FA 1HXMB 4YZWA 4AUUA 4BCYA 5B80A 2HFGL 3EFOA 4YTSA 3TF4A 1R46A 4HVBA 2QGHA 3IXTA 5A3HA 2JI1A 5KSAA 1UR3M 4HYTB 5AVRB 1Z69A 4MA1C 2IADB 4RMQA 2IH8A 5DZPA 4JM4L 2BTMA 1BD2E 4AYFA 3U9WA 1QRNA 1XAUA 4JFQA 1XR8B 3G1YA 1R30A 3ARRA 1I8QA 1LP6A 1KFKA 1G6RB 4P7QA 3KVMA 2VUKA 1CLKA 3LNDA 1A7BA 3LB6D 5IMMA 3M17B 1KCRL 1HJXA 3EWYA 4H9TA 3CZNA 1FNGB 2VRKA 3HJEA 5FYKE 3QJTB 2A85A 5IQMA 3PWVB 3WIJA 2NYYD 4S3JA 3QQNA 3DTDA 3U2IA 3BPCB 1ETJA 3E1F1 1W9BM 4N0CC 1OFEA 4UQ9A 3WQ6A 1RIVL 1RZIA 5CLWA 4ODHL 4ZXBC 4XOEA 3LN3A 3TFKD 2NPLX 4UCFA 3G5YA 5F9WC 4L3EA 2OL3L 4F33A 1S7XB 2JV6A 3L3IA 5M2FX 2OS7A 2NSMA 2DTMH 1YNPA 3NDZA 2J44A 4QHKJ 1U1UA 3TTEA 3OKDB 2YW3A 2ITEA 3NO5A 3UYCA 4PJ5A 2CQVA 4G43A 4Q6IC 4M43L 3X3YA 4IRZA 3D3IA 3KBFA 4D94A 5HVWA 5D96B 3GWQA 3CE1A 3M47A 5AUMA 3TO4C 4XXWA 3VH8A 4P23C 4LSSL 4DP5X 4LAUA 3MUAA 4P4KB 1EJWC 2UY6B 3F6IA 2G3XA 2I5YH 2DL9A 4FG2A 2G3IA 2CKBA 3L2NA 2QJHA 1KBLA 4LRNH 4MXWH 3UROR 4KDTC 4APQB 4Y19B 1KM0A 1FHNA 3L5WB 3RY5A 2YSTA 2ALDA 3VRIB 4PG2A 4MWAB 3S3BB 3SJ3A 3L5JA 3KR3L 5F3BB 1CD9B 2MNUA 5JR1H 3QC5X 1OAZL 7FABH 1BA9A 2R29A 3GS0A 4IMAA 4ICXA 3EDKA 4KT2A 4ZMGA 4ZFGH 1KCXA 3GUTB 4MTVA 1NPJA 4N5EC 1LL4A 4OGAD 3KYMA 4XBPB 2D03H 2J57A 4ZJ9A 4X5RA 1MN4A 3F84A 4E5XG 2FTAA 2H2PC 2Y6TE 4MMZC 2OMVB 5KYNA 5AYBA 4PJGF 1DBMH 4A2MA 3WMQA 4YEEA 3TW6A 2K78A 1IFHH 5H1WA 4UTBA 8XIMA 4GX8A 3RX4A 4GJ1A 1T5WB 5AKQA 4H8NA 1DEDA 1LDSA 1XINA 2H32A 3EGSB 3WBXA 1IEIA 1JGEB 3TAOA 1S8DB 5I8OL 3VQ2C 3U30C 4AUYA 4MD0B 2WTRA 3W1RA 3WNMA 1IIGA 5CD3B 2BIIA 1P1XA 3SDDC 2V2TB 4JLRA 5MHBA 1VFBA 2C9AA 2FT8A 5TH2A 2J21A 1ICQA 2ZXAA 5E8NA 3F03K 5T1LD 3E2VA 4Y9AA 5AZEL 1KG0A 3WK0A 3GRGA 4EIBA 3O8XA 1H2JA 4M8RA 2OO0A 4NFCA 4XPAH 4OCMC 5EUOA 1VF8A 3ISYA 3VOIA 5B7YA 5D1ZB 4B92A 4RFOL 3QZLA 2AQVA 3ZE0F 3TM6A 2PO6A 3W3OA 2MCAA 1ADOA 3SO7A 4C6PA 3JWNC 5BZZA 4JUTA 4XMUA 4Z0BH 1I1AC 3X2QB 5ABAA 3CPUA 5I7GA 1T04B 2E25A 3IPWA 1N7QA 4DZBB 1SF3A 4DBDA 3AREA 1BYCA 4GJIA 1XLBA 4Y1SA 2K6ZA 1UCTA 1JD7A 4QE4A 2GI7A 3KZSA 3UP8A 1U3JA 3S2JA 1QFOA 5T33L 4QRPD 5CM1A 5JOEA 4L1TA 2VWEE 4E8CA 1EC8A 1IJNA 2NSXA 2GSGA 4N9DA 2OMUA 1S3RA 3TO2B 3SQOH 1UURA 3FB5B 4A4AA 3N13A 1YEIL 4K3DL 2AJXL 2Q09A 4GP8B 1MLBA 4JFED 3QUMB 3ZQ9A 1UP3A 1PG7L 2YR1A 3C6LA 4MKVA 1E7UA 1DKWA 1OCNA 4K8GA 3L48A 4BZ1A 4EDWH 4ELMB 4PCNA 5FCSH 2NNAA 2W92A 4S1SL 5FV1L 4QF1A 3WDJA 5CSBA 2QYGA 1VD6A 4AF0A 4IBUA 2X4NB 3DDGA 3TPKA 1XO8A 2OK0L 4XI5D 1II4E 4ODTH 5F7WC 2CBOA 1WBHA 1F11B 3R1GL 4EI6A 2GJLA 2Y7NA 5CJOL 4WFHD 1EZVX 5JH2A 1J5OH 3X11B 4MZ1A 4PSPA 4JM0A 4F48A 3US0A 2A4CA 1FG2B 1X44A 1W37A 4YHYB 1K4CA 3P02A 5FM5M 1FPTH 2CJ3A 2P9RA 2QGCA 4W9EC 3EOLA 3GMPB 3FFDB 4B5UA 5SWQA 4IDJH 1LG2A 4W9ZA 3UYRH 3ILPB 1KEGH 4AZ7A 3FO1A 5BUGA 1TJXA 4JG1H 3QV8A 5F88A 1IGSA 2FWUA 3CN4A 2VJXA 4NHVA 5I6MA 4S3AA 5IEKB 5L6YH 4QSHA 3TN3A 1DO6A 1DVYA 3NQBA 4OLVL 2ATKA 3CFDB 1O7DC 4WWID 3RR1A 5AW2B 4EWND 4MD4A 1KGCE 3QXAB 2E68A 3KM1A 4JG0H 2ZNXA 3RM8A 2IQ9L 2J72A 4IIQC 1NGWA 2WINB 3ABZA 1WAWA 4PJHA 1QNSA 3IDYB 4ADTA 4GBUA 4D7PA 1ML0A 5CKAA 5LNGA 2BNUA 4DZHA 2HJKB 5CZTA 3B5HA 1LD9A 3FVMA 1AZBA 1PNCA 4ES8A 4FX6M 4M6AA 3H4WA 1A6PA 3N9HA 3MLRL 5KSVB 1NY1A 4JKNA 5ID1A 3IDJB 4RW5A 1HT6A 2OQEA 1QYGL 3EJZD 4L3FA 2VGLM 3E6HA 2MCG1 3I75B 4P4RB 5K9CA 4R26L 1KFBA 2BP0A 4KHXH 3BJ91 5CJ8A 5DFAA 5GVJA 2BNQE 4NQCA 3SX1A 2ZOLA 1DWFM 2O5YL 3RL1B 1H3VA 3UTTD 3AXMA 5FAAA 3IS1X 1OK4A 1QSVA 5F9JA 2ISDA 4IIBA 1N26A 2DLHA 2OMTA 1S7WA 3GBLA 3HE6A 4MXVE 3RMJA 3SADA 4KETA 1AVAA 5SWZD 2R2CA 1SJEA 3EA1A 2D0HA 2X4RA 4FOKA 1GKPA 5LHFA 5J04A 2Q76A 2PFHA 3S4SA 4O1DA 3IU4H 3WGVB 3K5RA 2WUCL 3CMFA 4HWUA 3BRFA 2ETWA 4AY0A 2MTPA 3LGDA 4BFGA 4BZGA 4AIZA 1PZ2A 3GS6A 4RISH 3JTSB 4N2HA 3B6SB 4FOMA 4G6KH 5DVKA 4Z7OE 2ZUQC 5HYQB 1Q7MA 3I9IA 1MRCL 4NRYA 1IGML 3OZYA 5XIMA 1J93A 3QKEA 5C7ZA 1HP5A 4MJ5A 4DUXA 3BLDA 4O52A 5B1KA 1JNLH 1M1XB 1O7SA 2LW3A 4LGSB 4JTCA 3QI9A 3VXSD 1IKFH 2XGBA 3GJFK 4C6IA 5E6UB 3PAUA 5AOJA 2JJUA 4MGGA 3QQ3B 2Y73A 1TZGH 4LARH 1S9YA 4IOFD 2G60L 3N2CA 3HKFA 1TTBA 2V0AA 4JTGA 2OKOA 3K8KA 1VPXA 4CNUA 4QT5B 1W3HA 1V0NA 4HPOH 3QUKB 4RNIA 3MGAA 2FQGA 2EE2A 3UIZA 3DNKA 4KJQD 4H4NA 1HHJB 4GKSB 1JEZA 1OFRA 1XH2A 3DTXA 4RGMB 5FYKL 4LSPH 3ULVE 2QR0A 3RVWC 5BMFH 2R1WB 4APXA 5I23A 3UXAA 4P7NA 1S46A 2EO1A 4PV9B 2ZA2A 1UZ1A 4YE4L 4HTBA 3O9WD 4CILA 1NOWA 2J79A 1E90A 3MRDB 1EHXA 5CXPA 4GBDA 1HEJC 5B1CA 5CJXC 5L0QB 3IARA 2BWQA 3GI9H 4DVBB 4A7QA 2RGSA 4H20H 1REQB 2JF6A 3HS0A 2XFRA 1F3EA 3UG4A 4PB5A 3ZLHA 1TQTA 4JQIA 3QR0A 5KUKA 4KRZA 1BVKB 1OCWL 4G8FB 2VEIA 3R79A 1RIHL 2A79A 3BOVA 2VC7A 3GBDA 3QIWB 1P5VB 1WBZA 3RNQA 2OL3A 4ZSUA 5A2LH 2PXYD 1AD9A 1G4RA 5HDWA 3ANUA 1MFDH 6CGTA 4O02B 3FB7B 2HRHA 1MJ7H 1PYFA 5HHMB 1R2SA 1JRHL 2PETA 2H9AA 1MRDL 2R1MA 1SMOA 3GHEH 4Y4FD 4BCXA 1XBDA 4R4BA 4P2OC 3UC0H 4XP6H 2H6RA 2TYSA 3N25A 3A3HA 4XCYA 4I48B 3GE7A 5IQ9A 3AMKA 3TPUB 5B21A 3ZE2F 3WFEL 4N2GA 5BJTB 1IFGA 1U8QA 3M7OA 5DLMH 5B1JA 3GSUB 1GQLA 5J7CC 4P5TA 5EZLA 3CO8A 4NKCA 2V33A 4JFYA 2N7AA 1U8JA 4NNXB 2NY4B 3D30A 5J9PA 5C0GA 3ILQD 3EH1A 1TZIB 3CDFA 2DQGH 3OS7A 3NT0A 4Q8BA 3JV4A 1GJPA 1NUDA 1LNUA 3PL6B 3NDYE 4FDWA 5DWPA 3CZSA 2WUBH 2X70A 1GZQA 3H6AA 4HZ7A 3QNXA 3HPAA 4V1DB 3ZVHA 2B9AA 3WSQL 4TNVK 5DT1L 4CJ0A 3I2CL 4PUJA 4HS6B 3KL3A 4AJ0A 4BQ9A 1OIOA 3U36B 4HK5A 4PUBL 3ZKMC 2YCJA 1HE7A 3O0LA 1TPUA 3W2KA 1RK6A 4OIAA 5F70A 1OC7A 2B77A 3F6LA 3CVHL 3AU1A 2K4AA 4MMHA 4CNTA 1WZLA 2B14A 4XK2A 1V3JA 4HZLA 4CC0A 1IR1A 1QRNE 3ISWA 1L0XA 1ECYA 4IFKA 3FTGA 4E9WA 1PKLA 5REQA 4UM8A 5A8GA 1B4RA 4HJSA 4XD6A 3Q2CA 4J1OA 1MCQA 3WE6B 4BQ4A 1YDNA 3NIFF 2OMXB 5G1YA 1L3NA 4JGUA 1N6VA 3BZGA 2QVFB 4ATWA 4TR9A 1J1OH 2CA4A 2V9DA 3IUIA 3IETB 4DXVA 2D2HA 5E8EA 4ORGB 4FQLL 5AG8A 3QAZC 2EAEA 4O57A 2ERJC 2DLTA 4NZRH 3CSYA 3PWUB 4OAWB 5GHWL 3GJEA 3DO4A 4E9RA 1MI3A 3HC3H 4L3EE 4IUOA 4OBSA 4G6JH 1CIDA 1NJJA 3FN9A 3PF3A 1I7RB 1BKSA 1ALDA 2ALWA 4H26A 1MCWM 1NGQL 1QNIA 4IYKA 4OY9A 2UBPC 2IH3B 3RGVB 3UGVA 3NDZE 4GJJA 1ZLVH 1MMZA 3EYUH 3LMJH 4QISA 2QKIB 5HBFA 2JJSC 4RA0C 3MCLL 4PJ5E 4PCSA 3HR5A 1Q72H 2VL4A 1OW0A 5CIPB 4QHLB 5DSCA 3DFNA 5EWIH 2I9LB 2Q8ZA 5IB3B 2X4OA 4PMJA 3M0KA 1BIIA 4NBXB 1VFHA 4MZ3A 2IPTL 3TA3D 4N20A 5KYYB 4DKEL 3G5ZB 2XC8A 2XX0A 5FIPA 4KTRA 2JNZA 2VD8A 3U4EA 4OGZA 1UG6A 1NSXA 5HNRA 3OWRA 2WYSA 4Y4KC 4GUJA 2ZUNA 3P0WA 1GZHA 4G8AC 4JY4B 5AQ0A 2A0LC 1GOIA 4H1ZA 3MLZL 1KBIA 5AAMA 2W88A 3DERA 3TBSB 4JX6A 2HXUA 3PN8A 5I1AA 5BXFB 3PNWA 3UTSB 3JVGA 5GGSA 4UYPA 4N28A 1M7PA 3RWJB 3SPVB 1Z9AA 1HH6B 3QIUB 3DVGA 3I6SA 4FL4B 1NFDA 5CEZE 4NUJA 1WV7T 2CLZB 4DEWA 4UFIA 2ESVA 3MOAL 4K23H 3VFGL 2GQ3A 1F1GA 4KFPA 2BIQA 2UV8G 2JJTC 2Z6FA 1K2DA 3RUGA 3C0SA 2A3TA 2EUXA 3ARFB 3LJ3A 4XVSH 3G6AB 5DRXB 3OLDA 3B0YA 3CPLA 3W1NA 4GPVA 3RIFF 2AQTA 3QA3A 4ZSOA 1LOQA 1XT5A 5KZCB 1R0AH 4Y5YA 4ZTPL 1QO3B 1OPOA 5I8KL 2KMWA 3CC1A 2XXGA 2A9ML 4XC1H 5ACZB 3FHEA 4L1BA 4HSHA 1A4BA 5E5MB 1B2WL 4FFZH 2VQTA 1W80A 4S1DD 1UYQA 2FZMA 1D6UA 3DRQA 4OI9A 1K3IA 4PTWA 4Z7VA 2YAHA 3G5EA 1D6VL 2HPMA 1XIMA 4J3OF 3QIBD 3W70A 5EUOE 2XWTA 5IBXA 2Q7YA 3OKOA 1IGFL 1GOHA 1SO6A 5HATA 3U0PA 4ZQRA 1JUFA 3BISA 3WJMA 2A73B 1D5XB 4F0LA 3ZVVA 4X83A 1G7QB 3REVB 2YYUA 4KWUA 5J12B 1JNNH 1RL1A 3ARSA 4DGYH 3EMCA 3AWFA 1OD7A 3KPSA 2MPAL 5FUCC 4OH2A 3OJ2C 2ZCLH 3TQKA 1LURA 2ZZUT 3LCLA 2IS7A 3QXDB 1N67A 4D3CL 1AIZA 4OD2B 1JCKA 4PVBA 3F2BA 2FT6A 4NOBA 5FSEC 3BARA