4FNUA

Crystal structure of gh36 alpha-galactosidase agaa a355e d478a from geobacillus stearothermophilus in complex with stachyose
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
718
structure length
718
Chain Sequence
b'KQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRGARAFPRLDRAFSPNPDPSDRTFSLDTLLQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLPATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSARFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNADEHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKIVNIARTEAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWAMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSRFPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDSNQDYEIEGLGVYGGDELMYAGVALPYRSSDFISMMWRLKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-galactosidase AgaA
publication title The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 196
structure length 718
sequence length 718
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02065 Melibiase Melibiase
A PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain
A PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4fnuA03
2.70.98.60 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 alpha-galactosidase from lactobacil brevis 4fnuA01
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fnuA02
1CXIA 1JDCA 3NQAA 4Y8FA 3W7RA 1VFUA 3M07A 4M8UA 3GXMA 4GUIA 2HSAA 3ZWSA 4GI9A 3LCHA 5KZMA 3CZNA 1NFBA 1QCWA 4NXKA 3PR2A 4K7YA 3WN6A 5HXMA 1BWKA 1GT8A 4M19A 4NI3A 5L6UA 2GUUA 2Z1BA 4RK8A 1LCOA 1A5SA 1G7VA 4MLJA 2X1SA 3W1AA 3ZFHA 5LHFA 3D4YA 2ZZ7A 3G0XA 4JTGA 1CX9A 1Z41A 4DQWA 1ICSA 2ATSA 2OYKA 3WNLA 1Q45A 3KOFA 4RZ4A 3DH7A 1GVIA 2YW3A 4JTHA 3EJRA 2QCHA 5CXPA 4WXZA 1QI5A 1TMHA 3PBUA 1H1YA 3ELFA 2Y7FA 2F7RA 1I8JA 2R94A 2YFOA 1ICQA 2WV8A 3HIJA 3UWQA 3L4XA 4H3DA 3GDMA 1R34A 8CGTA 3W70A 1HWWA 1VIWA 3DI0A 4CGTA 2E5BA 3A5FA 4QIUA 3QW4B 4QJ1A 4YMZA 1WOAA 2YCEA 1KM4A 3WK0A 4O17A 1F2JA 3VMOA 2VOMA 1H3GA 3NO5A 3VGFA 1TMQA 1AW1A 1GWJA 3W2LA 1H7OA 1UD5A 3ABQA 4X3ZA 5G1TA 5AYYA 3TAKA 3MW7A 3ABRA 1KXQA 1KFKA 2NX9A 2VEMA 3S1VA 2QLYA 1Z44A 4UQEA 3EJTA 4HPXA 4H6KA 1VYSX 2FJKA 1ZJBA 3OVQA 5D38A 1UUOA 2BSLA 1PJ9A 5AOUA 1HVXA 3STFA 2QMKA 4K39A 3G1FA 5DLCA 3SECA 3N2XA 3NL2A 4HN4A 2Y7DA 3VSUA 3PULA 3O6CA 1UKQA 3SW6A 3NG3A 2QCGA 3L0KA 3DKLA 5DFAA 3L0GA 2OYMA 2WCSA 3Q37A 4UFJA 3LHZA 3L0NA 2OW7A 3KVLA 1RP9A 4AMXA 3M6YA 3WK3A 1VYPX 4A3UA 1PIIA 2C0AA 5I3JA 3K8KA 3EWXA 1B9BA 4G1KA 1UH4A 4MKNA 1X1ZA 4MVAA 3W1UA 2AGKA 4WSKA 3NYZA 4UNLA 2NWSA 4MB1A 1OX6A 1EP3A 4E0CA 4Y9AA 1HUVA 1JUKA 2NXIA 3RNDA 3EXSA 3W7CA 2EABA 2JK2A 4JTIA 4NQ1A 1QFEA 3VM5A 3C0JA 4A21A 3EX3A 2FYVA 3GBEA 4JTUA 1SZEA 5G1YA 2ZWZA 4MY9A 3B05A 3QMRA 3BAWA 3LV6A 3OLGA 9CGTA 3A24A 1D3CA 1PCKA 2DIJA 3N19B 4IMDA 4QM1A 3I68A 5AC7A 4CN6A 1VCVA 3F4WA 3A5VA 1M6JA 1GPWA 3S6DA 2ZZ3A 4JTEA 5I24A 2QUVA 1IXPA 2QKFA 1H7PA 5CLTA 2ZRWA 1BVNP 5D2YA 2FPVA 4O1CA 2PRHA 5TQLA 1WA3A 2ISVA 1XXXA 5KZEA 1TPB1 3E02A 2YW4A 3JRKA 4JIPA 3QYQA 3HG5A 3O8AA 3ECQA 2XN2A 5D2TA 3EDDA 5KZDA 2RHGA 3W3OA 3TNOA 3NQDA 3BVJA 4O54A 4LVFA 3DXIA 1VH7A 4XZ9A 2ZBTA 2YFNA 2F7FA 3E0IA 3CTTA 3IGXA 3R12A 2XFWA 5TBOA 3G1AA 1G4TA 2QCCA 3W7OA 2F2HA 4FNPA 2NWRA 3VE9A 3HB9A 1NSJA 3W07A 1OFPA 1RQBA 3GNNA 2VFGA 3KE0A 1PS9A 3W7EA 2ZRYA 1JGIA 3GVGA 4UTWA 4IX2A 2F7PA 1DHKA 4YCOA 1TCDA 2WPBA 3BO9A 4AEEA 1KA9F 1ZCOA 3NL3A 2QJHA 2GVYA 2Y61A 5EL1A 2XN1A 1QNVA 3EWYA 1SU5A 4ALDA 4K38A 4M56A 2ZUTA 1AK5A 3GDKA 4O11A 4YCPA 1DBTA 3N73A 3BAJA 2ZA1A 3QW3A 3DHDA 1XD0A 4ML9A 1LROA 3ZSTA 3DDGA 4FNTA 3NOEA 4XKYA 3RLUA 3ZR4A 2Y62A 2DJLA 2P1FA 4DBDA 4CNNA 4DO4A 1UD4A 2CLEA 4GC4A 1AMKA 3PF3A 5F2MA 2ZE0A 3C52A 1MSSA 4GXMA 4P61A 4XBKA 3GZ3A 3RF9A 4UZUA 1SO4A 2RFGA 4LVDA 3E49A 1D3GA 4S1FA 3ABSA 3IGSA 4X9YA 4NX5A 5DCEA 4GQQA 5DXYA 3LHYA 4QITA 1K02A 5AB3A 4RXFA 2WSYA 4TU1A 3QJAA 3GXDA 1W5NA 1TQSA 2BTMA 4GWEA 3EWBX 3CHVA 3UWUA 2NUYA 2EJ1A 5BRQA 1MXGA 3WY4A 5I3KA 3W7PA 5SWUA 2WKLA 3LCWA 2C16A 1IXOA 1F74A 1VZWA 3BW4A 6ALDA 1ZHAA 4O12A 3FJLA 1DTUA 2D0GA 4OKDA 4EOUA 3GBDA 1Y7VA 4PEEA 3EX6A 3PG8A 4OIFA 3LHVA 1EEPA 4LRSA 4DELA 5KEZA 3R2GA 5KITA 3HGSA 2Y24A 2B7OA 4JFWA 3WMSA 2E6DA 4NJKA 1VHNA 3UPWA 3TW7A 3WDHA 4GUFA 3QPYA 2A85A 4CVWA 1SFLA 5DELA 3KL3A 4PODA 1D9EA 3FAXA 2NXGA 1JUEA 1XI3A 3P80A 1GJWA 4N9BA 1UA3A 1J0JA 1DEDA 2E0PA 4FX6M 1TRDA 1EP2A 4UCFA 3TA6A 1OF8A 5A8GA 1FCQA 1W5MA 2Q3OA 2X2IA 3H54A 1IIHA 2DZVA 1I2QA 5I3GA 1IV8A 1FWRA 3DHFA 3BAXA 3VSVA 3DAQA 1XDMA 3BK0A 1Q4NX 3S9YA 4LWWA 3BMVA 1G4SA 4DF0A 1JDAA 3HF3A 4NJGA 1KLYA 1GOXA 4DF1A 2ZX9A 1H7NA 8TIMA 4AEFA 5CPOA 1MVYA 4AYGA 1CGUA 3UXAA 3MYOA 3LXBA 1LTDA 2Y2WA 3WJWA 4O15A 4LTSA 4Y96A 4N6EA 3VGHA 3VNDA 3CZGA 1HL8A 5LGXA 1WV2A 2W79A 1VGAA 5CG7A 3LXAA 1ZALA 4CKQA 3R8RA 6CGTA 2Y4SA 4AH7A 1JCNA 1GVOA 3LRKA 2YSWA 3EWZA 5HNRA 2XVKA 3WY3A 1WZMA 4JYEA 2CLLA 1NVMA 2H90A 4JY9A 1SZFA 3P61A 5E70A 3W1NA 1X6UA 1MW1A 2RDTA 1OYCA 1YYAA 2ZUUA 3PG9A 1U33A 3C6CA 5HUPA 4NVTA 2ZRVA 4O4VA 2OW6A 4O13A 4GO9A 2TRSA 1O4UA 1TTIA 3PUDA 1LZOA 2F18A 1IGSA 3GKAA 4TMBA 3W23A 4JTLA 1JQVA 4JIQA 4L4MA 5HQEA 4IUOA 3DFQA 4U3CA 3DDFA 4O18A 1R46A 4GUGA 4AF0A 1KW1A 3HPSA 1TQUA 5EMUA 3BPWA 1Q6QA 3W1LA 1JAEA 4U28A 4KKXA 4FNQA 2G5WA 4Q4KA 1BKSA 3FFSA 1T8XA 1W0MA 1CW2A 3IIXA 4ZQMA 3U2OA 3TU9A 5AHIA 4MUZA 3TAOA 3NL6A 3P82A 3PBVA 5FEZA 3VCRA 3GXIA 2PWHA 2FDSA 3W76A 2DORA 4O1DA 1GG1A 2CU0A 1MW0A 4CQ8A 3UG3A 1CGXA 1PHWA 4O28A 3W1XA 1M53A 1UKSA 2JKEA 2E8ZA 4WX2A 1O7DC 3UWYA 4X2RA 1JFHA 3D52A 5C55A 3A6OA 3CPRA 3TXVA 4HNTA 1JRCA 3VMNA 3DX2A 1OGSA 3TK7A 4MIMA 4LXFA 3L68A 4UNKA 3TSMA 2I1OA 3UXDA 1K8YA 5CPMA 5FF3A 3T55A 3BMWA 1DOSA 1OHLA 4AHOA 1L6SA 2YPIA 3HOJA 3WENA 1XBZA 3QMTA 1NEYA 1YTDA 4MZ8A 2VEIA 1EA9C 1F7BA 1ONRA 2TAAA 4FO4A 4J3WA 4CCCA 2B4GA 3B03A 3GDTA 4JD4A 5AHLA 3KLLA 3ZOAA 1CXLA 1ICPA 2E8YA 4GI6A 4J3SA 1OFDA 1E40A 4LRTA 4BWLA 1CXKA 2ZICA 3WNMA 1GTHA 1G69A 5D02A 2Z1KA 1K3UA 2J24A 2RKXA 2E5DA 3EWUA 2V3EA 3USBA 1TQWA 4TIMA 4UC5A 1J0KA 1A50A 3LI0A 2CHNA 1IXNA 3NZRA 2XIBA 3B0PA 1TSIA 1OF6A 4M6QA 2R14A 1BAGA 4YLWA 3BVTA 3N14A 1EUAA 3LB0A 1K7FA 3S2CA 4KFPA 2GQ8A 3SGUA 2WNZA 1JJKA 1IZJA 1DVJA 3WNKA 3OIXA 3DX3A 4HOWA 4UOZA 2CFFA 4A2SA 2ZQ0A 4MY8A 5HR7A 3W88A 1RPKA 3G1SA 2H8ZA 3C2VA 3C2OA 3PAJA 2B7NA 3UD6A 1VHCA 3BGJA 4N9EA 2V2DA 1XGZA 3M47A 3BAYA 1TQTA 4HOXA 2ZZ5A 1JRBA 1CGWA 1T96A 3L4TA 1OB0A 3T7VA 1KV8A 2B7PA 2FLIA 3W6YA 4FHAA 3DFNA 2ZTJA 5IBXA 1B3OA 3UY7A 5CZJA 1DHPA 4OWGA 1AW5A 5G4EA 1H63A 3HJEA 4K8HA 1SMAA 4RCXA 3CIWA 3QH2A 4JTJA 2FH6A 2HMCA 3BG3A 4JFSA 3ABOA 4I7WA 5F1UA 4JGDA 2W0UA 3TDFA 3TX9A 2YIHA 3AXHA 1H7WA 5FF2A 4UZSA 1WE5A 4MFEA 1TJRA 2QCDB 2OCZA 3S5ZA 1AVAA 5LHEA 4WY0F 4JYFA 3VFLA 1KBKA 4FLSA 3PC0A 1LBMA 3GR8A 4GFSA 3BLBA 2W6RA 1FWTA 4I7UA 1I75A 4N9DA 3W74A 5A2AA 1EP1A 5FEXA 3NVTA 3TMQA 3W7GA 2FTPA 2BLEA 1OJXA 3NAVA 1VFOA 1X7FA 4CN4A 3NDOA 2YOCA 4M7TA 1N7KA 3D50A 1RD5A 1WBJA 1PV8A 1TQXA 2YA0A 4Y90A 3W38A 5F7UA 3LRLA 3F03K 2Z6JA 3OLDA 3EDJA 1GYLA 3EKLA 1V3KA 2PWFA 1DORA 3P62A 3M5XA 4BR1A 1LRQA 2TYSA 4RLIA 3STGA 1QWNA 4JFTA 1W5PA 2C8NA 3WNNA 3BVXA 3EJSA 1WZKA 2A1YA 4LNYA 1LOSA 4HNNA 1S5WA 3LBCA 2NXHA 2V3DA 1EWEA 1TPEA 1GQNA 4B5NA 3D51A 1XUUA 1XSJA 1CYGA 4JFVA 4QQ3A 4GBUA 3L4VA 1JD9A 2C1HA 3CZSA 2ZYFA 5FF4A 1H7RA 2A0NA 2QAFA 5T26A 3SR7A 3NM1A 2WCGA 2Y7EA 2A21A 4NZFA 2ZDRA 2XIIA 3NPUA 2FPTA 2UV8G 4DXVA 2P0OA 4H2CA 3W1TA 2D3LA 3N2MA 5HINA 3LCXA 3BCFA 4WSJA 1T99A 4IXXA 4MY1A 3NPXA 2ZZ2A 1GYNA 2EF9A 2FPYA 3QSRA 4J7RA 1QO5A 3W2KA 1VFMA 1XCXA 2XWEA 1R47A 3D0CA 1FDYA 5CGQA 4OJYA 2X2HA 2PURA 3LLFA 4IMGA 4WY0B 1BWLA 5H2ZA 1W3TA 3G22A 2VKZG 4JTKA 1YPFA 3FEMA 3WJXA 1Z48A 5D32A 4FLQA 1J2WA 5D33A 1P5BA 1FX6A 5G4WA 4A29A 4GKLA 4FLRA 3CT7A 2QCDA 1VPXA 1PHQA 3W7DA 3AJXA 4H8VA 1P4CA 5HMSA 1TQVA 5BMWA 5G5IA 4ADUA 3KRSA 2VFHA 4IPIA 1OFBA 5AYXA 4H8UA 1KXVA 3L4ZA 1PAMA 3HQ1A 4UMCA 3ZO9A 1I4NA 5AN7A 3GXPA 3RU6A 3LTSA 4IGHA 3TONA 4JX6A 3A23A 1MWOA 2E6AA 3W86A 3BH4A 3ZR5A 3BG5A 3GYEA 4MPQA 3I6RA 4U4MA 4FEZA 1U5JA 3DENA 1ME9A 3WELA 2OJPA 4Z1BA 3HMJG 3LTYA 1PS3A 2VELA 3I7SA 1WQ5A 3OLEA 3BCDA 3S8HA 1XH0A 1SSDA 1QDSA 3IIVA 2X1RA 3W7MA 5CLWA 2RH9A 3OEXA 1I2NA 3UG4A 1S3HA 2ZWYA 1DL3A 2D3NA 2PC4A 3EDEA 1JD7A 2QCFA 1VB9A 1G6CA 4HOZA 2GVGA 1G7UA 1KM1A 1OABA 1VRDA 1W37A 3W71A 2WSQA 2BX7A 3IIPA 2EGZA 1KM2A 3IVTA 5I0DA 3PUEA 4H8HA 1LRTA 1ZNNA 5AFDA 1TPUA 4MJMA 1JL8A 1W3NA 2VUYA 4FIQA 5BRPA 4IOTA 3L21A 3ZR6A 2XWDA 1A5BA 2E77A 2Y6ZA 5D2VA 4IX0A 5LNRA 3B8DA 3GIYA 3WJSA 1UCWA 5GVJA 1PPIA 2AMGA 4AHQA 3MUXA 1N55A 3G8RA 3VO0A 3ZT6A 4NJJA 4NJIA 3QQ1A 4JDYA 2QR6A 3LERA 1JCJA 4UQAA 1QR7A 1XKYA 2A7RA 2V9DA 2BY2A 3MP5A 1NAL1 1AG1O 4FIRA 3FLUA 4X9SA 2EACA 4PL1A 5K2ZA 1BPLB 4XBSA 5LNSA 3DC0A 3FKKA 4O0ZA 1YADA 3VGEA 1UB3A 4GQRA 4KWUA 1ALDA 4LV9A 3WJYA 5AC8A 1VAHA 2BWGA 1KGWA 1LP6A 4FNRA 3BLFA 4JICA 1L6WA 3M44A 3BAKA 4C1KA 5C2XA 4O53A 1UBSA 3PM6A 5IM51 5A5WA 3G3DA 1EO7A 1ZAJA 4UUIA 4RKAA 4OQVA 1VJSA 3L5LA 4PCTA 4TMCA 2FHBA 2NX1A 3WK2A 1MW3A 1JCMP 4R53A 4WXYA 1FXPA 2WVTA 1PVNA 2A7NA 3G3MA 1S5VA 1ADOA 4HSOA 7CGTA 1KWGA 3LCFA 1ZENA 3N9RA 4FLOA 1W1ZA 3CTLA 3LHWA 4JCLA 3L2MA 4UTLA 1VJIA 2Y70A 4Z1CA 3VNZA 3MHFA 1SW3A 3LCLA 1LM1A 2ISWA 3UNDA 4H7VA 3HPXA 1AQMA 3B0UX 1OX5A 1YXDA 3MO7A 1BF2A 4LPCA 5K9CA 5D05A 2QEZA 1SPQA 1HX0A 4DPQA 3BC9A 3O06A 4N4PA 1U30A 4UTWC 3TJXA 3A22A 2G3NA 1JG9A 1AL7A 3LPPA 3DFPA 4HT3A 3SSJA 1EB3A 1KM6A 4U31A 1QI4A 1THFD 4UMBA 4UTKA 4B9ZA 4QAWA 4CCDA 3WNPA 3U8GA 2NV2A 1K7EA 3MJYA 4O14A 3M43A 2OYLA 5K9XA 4J3TA 3ZWTA 3WY2A 3AMKA 2JGYA 2NT0A 5LNVA 2QAPA 1SO3A 3IVUA 4JY8A 2DH2A 2BY0A 3KVJA 1K7XA 1ZAIA 4NT0A 1OSEA 1MZHA 3IVSA 4DBEA 2ZUWA 1LORA 5CSSA 2B0MA 2TPSA 2OSWA 2VT0A 3K8MA 1WP6A 3W73A 3OHIA 3KAOA 4KFOA 1T0OA 1R33A 2GJNA 2QJIA 2WKJA 3NPVA 5FI8A 2WVSA 2Q8LA 3VX0A 4JN6A 2FGZA 3NZ1A 2RDUA 4WLCA 3W83A 1PEZA 1FDZA 2WC7A 2V81A 3NNTA 3V75A 1H61A 2R8WA 1E51A 3UCQA 3BW2A 4O16A 3PSWA 4AAJA 1GVSA 1CGTA 2VEPA 4IMCA 3WFAA 3C2RA 4LS1A 4BZYA 3IJ8A 5BOOA 1OYBA 3KEHA 2CZEA 1WZLA 4JCMA 1JCLA 1F6PA 3N9SA 3P8IA 3SIZA 3VSTA 3O07A 3DFTA 4ZVJA 2E6FA 1LRNA 1KTBA 1SUXA 2J9ZA 3C61A 2F61A 4UFKA 3CLMA 2BXVA 1BEUA 4JTFA 3ZT7A 5EY5A 2ISSA 3TQVA 2OSXA 1KFJA 2DJXA 3L2IA 1MO0A 3NA8A 4JYDA 3A9IA 4NUWA 1YDNA 4J3VA 2YA1A 1MFUA 2QUTA 4MYAA 3A47A 4D2JA 1G67A 4HSNA 3L66A 3WNOA 3S1UA 1O94A 4K37A 4JNMA 4ZL1A 1BVZA 1R2SA 3QC3A 3B4UA 1I2PA 3WFZA 4DEFA 3CGTA 3BUQA 5CZSA 2P10A 1X8FA 4UOQA 4O1AA 2C6QA 1PE1A 2CPUA 3BG9A 3BVUA 4JX4A 1VC4A 1QOQA 4AIOA 1QHPA 1FY6A 5AHFA 3VM7A 4WUIA 3BSGA 2JBMA 1HL9A 2EPHA 1HT6A 3KRZA 3DU0A 3RFAA 1M5WA 4UQ9A 3G0SA 4DO5A 5A2BA 4IMFA 2LLEA 1HNYA 2IGTA 2TMDA 4GO8A 3LPOA 3UWVA 3ANYA 4TR9A 1KWKA 1W8SA 3C3NA 1GG0A 1RZMA 4J28A 5FEPA 3W84A 3O15A 3BVWA 1E3XA 1OT2A 3SFKA 3EX2A 3P74A 1GVQA 2D0HA 4WD0A 4QNWA 4RZ6A 2FE0A 4BA0A 4AXKA 2QMJA 2QCLA 5G2WA 1KGUA 3STCA 3GXFA 4BI5A 5E93A 2DZXA 3WY1A 1OFOA 3FIGA 4JFUA 4CLMA 2ALWA 3F4NA 1UD2A 3I7RA 3UY8A 4S2CA 1ODUA 2CW6A 2Y5EA 4IMEA 1H51A 3W1MA 4UTTA 1PIFA 5CPNA 4ORIA 1RVGA 2CLKA 1OFQA 1G94A 2Y63A 2X16A 1GCYA 2QCNA 4ONVA 3INPA 4UTJA 2FHCA 1OYAA 1KFLA 3NQ6A 5HR6A 1WPCA 1OVDA 1CXHA 4UQCA 1GVFA 5E1QA 3DX1A 4BI7A 4Q32A 3AXIA 5E6ZA 1W3IA 4C1LA 4YWIA 4IQLA 5F2LA 2CLOA 3W7HA 5G2HA 1C8QA 3EX4A 1M7OA 1JF5A 3FYPA 1C9DA 2ZX5A 3H55A 1RPXA 1TPWA 3W72A 4RXGA 1EPXA 4A2RA 3AO0A 2Y7GA 1D7FA 4B9YA 1UKTA 2BZNA 3IIOA 1KTCA 2HTMA 5LKYA 1H5YA 4UTMA 1W9XA 2ZA2A 2TSYA 4GNJA 1WXJA 3LV5A 3NPWA 4EIVA 2WQPA 4ZMGA 1QOPA 5G2IA 1UD8A 3HG4A 1XH2A 3IEBA 3W85A 4WJEA 2QDHA 3FA5A 4BK9A 3ZS4A 2QPUA 1B57A 1YLVA 2CZ5A 2PRMA 2DZTA 4UTHA 3WDIA 1KCLA 3KVKA 2O7SA 1EO5A 1YXCA 4JR5A 3IJ9A 3LRMA 5CZ0A 4RX0A 2R91A 1G5AA 2C15A 1QO2A 2CWNA 5AYZA 1CLVA 1LDCA 5D37A 1WOBA 2H8XA 5K9DA 4U2YA 5LNWA 2QDGA 4UIOA 1F6KA 1IZKA 1OFEA 4FMVA 2BXYA 1A5CA 2QF7A 1G9HA 3HO8A 1JCYA 4ICNA 3DZ1A 4UR8A 3T40A 3DX4A 4JS3A 4QAIA 1TIMA 2J9YA 3TV8A 5DBTA 5LNUA 4HIBA 5EPDA 2PWEA 4BWLC 3P5YA 4HP5A 3LDVA 5DCDA 4LUJA 1G4EA 1JXKA 1U83A 5DCBA 1F76A 1RQHA 2NUWA 2QV4A 3VMPA 3BW3A 3TKFA 3VGBA 3RILA 3IRDA 3GXNA 3M5ZA 1A5AA 3WEOA 1MXDA 3IV3A 2EKCA 3NQGA 3L4UA 1IIGA 3VKJA 2CZFA 5DO8A 2BXZA 3KL5A 2H3DA 1QPRA 4JDBA 2EAEA 4MFDA 5K4ZA 3QPZA 3CLWA 1SFJA 3GTNA 1FDJA 3KXQA 5KSWA 1KM3A 4KWWA 1OFRA 1KM0A 4AB4A 2J6XA 2J27A 3OBKA 1SSGA 3M5VA 1UA7A 5AHNA 5A6MA 1NOFA 4Q33A 1N8FA 3UEQA 1P0NA 2JKAA 2ZA3A 1Y0EA 4JL2A 4N6FA 1CGVA 2A6LA 3OA3A 2GJRA 5IBXC 1R30A 5FEWA 1UASA 3HZ3A 3G1DA 4ZQPA 4Z08A 2EO7A 2A5HA 1VR6A 3KL0A 5I3IA 4LS2A 3I7QA 2G3MA 2WOQA 4J9JA 1TV5A 1HO4A 1QAPA 3NQ8A 3TSDA 1KXHA 2DH3A 5FF7A 3RK8A 3C2EA 4DF2A 2YX0A 4AVFA 3NEVA 1ZJIA 2ZTKA 2YGYA 5EKYA 3CEUA 1O5KA 4JTSA 3VU2A 3IGUA 4DO6A 1JIBA 1X1OA 1E43A 1UUMA 2ZXDA 2VRKA 2HS6A 1TPH1 2GVLA 4P2VA 3G1HA 1WDWA 7TAAA 1WYIA 5EA9A 3CEPA 1W31A 1SW7A 4N4QA 3EXTA 1UD6A 3W9ZA 2X30A 1KFEA 4I7VA 5HWMA 1UD3A 1CDGA 3TQKA 3S5YA 4RV8A 1NF7A 5D30A 2OT0A 5BW6A 4OE7A 1TQJA 2V2HA 4LVGA 3GXTA 1UJPA 4ZQCA 4Z0SA 1TB3A 3FJ6A 1G4PA 2H6RA 3FKRA 4O10A 1SW0A 3MP4A 2CLFA 5F4WA 2ZRUA 3SI9A 4X22A 3THQA 3MHGA 4CQ9A 1OG0A 4OV9A 3BLEA 2JKPA 2C18A 4NNBA 2JGQA 4YXGA 4O4WA 4PCSA 2QCEA 2YKKA 1FCVA 2FB3A 3L9CA 4AHPA 3TR2A 2Z2UA 1TO3A 4XUGA 1K8ZA 3DX0A 4DPPA 3QZEA 1V3MA 5EBUA 4CQAA 3L67A 4MZYA 4E2DA 5KMYA 2X1TA 2C14A 1TPFA 4OHQA 1QW9A 3OVPA 2EAWA 5U4NA 3BARA 1XDLA 2YXGA 3E12A 1MW2A 4ORMA 3HGOA 1GVRA 3YPIA 3NL5A 2NT1A 3P5ZA 3UWZA 1BTMA 3CZEA 2NUXA 3W2UA 2WVUA 4UTUA 2DP3A 3P7YA 3B0VC 4O57A 4ZZ9A 4OT7A 1EHAA 3GB6A 4LS0A 2Y88A 3TXZA 4N2YA 4PH6A 3UYCA 1CI1A 1KCKA 5LGZA 4LQ1A 2C19A 1NM9A 2V5BA 4KFNA 1KM5A 1VYRA 2PWGA 2ZIDA 1VLWA 1I2RA 1BLIA 2D73A 3B06A 3KWXA 1YPIA 3S1XA 1NF0A 1GEQA 2VR5A 1HL2A 3E9AA 3UZ5A 2YZRA 4FB7A 3TMLA 4OGZA 1WZAA 2YYTA 3QSTA 3VNYA 2ZZ4A 2G95A 2KZHA 1A47A 1FXQA 5BMXA 6TAAA 1TREA 4PC8A 2WNQA 1XBYA 2ZFAA 2WNNA 1HXKA 3MP3A 4IJBA 1Q6OA 4UFMA 4FXRA 2I9EA 1SQ7A 1BG9A 3BUIA 3UQNA 1LBLA 1XH1A 5AC6A 3WDJA 2NV1A 2GUYA 5A6LA 1W5QA 3PWAA 1V7YA 3M16A 2CLMA 3GDLA 3W7LA 3GX9A 3STEA 3GAKA 1W5OA 4MYXA 4PL2A 2D0FA 2Z0IA 3EXRA 2DZSA 1HO1A 1LWHA 1EUNA 5DY3A 5D2XA 3T78A 3TH6A 3TTSA 2QUUA 1FUYA 1L6YA 2RDWA 4GINA 4E38A 3VGGA 4HNVA 5CSRA 2YJQA 2ZX7A 2OZ0A 1KXTA 4RR4A 1TPVA 4HNUA 1FCBA 3BLPX 3GNDA 3QRHA 3CQ0A 1VCFA 3TIMA 5K7JA 4LOCA 1JDDA 3S5NA 5E0KA 3PSVA 2V30A 1U2YA 2ATMA 3TSBA 3R13A 3NXFA 1F73A 1Z42A 1K03A 2WKGA 3O1NA 3QMSA 3PB0A 2ZX6A 1H7XA 3PBWA 4O19A 1OK6A 1V3LA 3VX1A 1ZS2A 3W1QA 3TW6A 4WY0A 4XKYB 3C4UA 5HULA 3UZJA 3HJZA 1VLIA 4LC6A 1O95A 3P8JA 1YTEA 1B0IA 3FS2A 3G18A 3IJ7A 4K8EA 4IPJA 2XVGA 2Q3RA 3HGRA 1C29A 4LU0A 1CPUA 4FXSA 1FWSA 1I2OA 1J0HA 2Z6IA 4W93A 1CIUA 2ALDA 2EHHA 4BI6A 1Q3NA 5F4XA 2YR1A 1XBXA 4POCA 4UFLA 1QHOA 3DGRA 4IXHA 2ZXAA 4O52A 3EJUA 2ABBA 3LHTA 4PCFA 2EQDA 1LYXA 4WOZA 3U6WA 4Z1AA 4A22A 2WO5A 1CGYA 5HUOA 3W7NA 3S1WA 1QPQA 2F7OA 4AWUA 3JR2A 2ZUVA 3C56A 3LBMA 3THAA 5ABTA 5C6MA 2VFFA 1DJNA 3TJLA 4OBTA 1BSIA 4E2OA 1MEIA 2PE4A 1QW8A 4CNPA 1D3HA 1F05A 1OFAA 2IQTA 3NGJA 3SJ3A 3ZT5A 4GUHA 1EA0A 2VRQA 2E4TA 1SZGA 3PUOA 5KTLA 4ZQRA 3KVMA 3EDKA 4Y6GA 3BUDA 1XM3A 5L9FA 2E9BA 2AAMA 4HPHA 3LGEA 4AMAA 1KLZA 3K8LA 1JVNA 3AJ7A 4X0NA 4HPJA 5D04C 3QEZA 5E6YA 4K7VA 2GJLA 2X2GA 1QPNA 1DKWA 3NQVA 1V5XA 4NX0A 5LSMA 2PRLA 1XSKA 1H50A 1W54A 3PBYA 4O1BA 2ZXBA 3TOPA 5J5RA 1R75A 3W75A 3TTYA 4RZ5A 5HJLA 3VGDA 1CXFA 3W2NA 2ZXQA 3TQ0A 3EB2A 5CGMA 3W1RA 1C8VA 2VENA 1SO5A 3MBFA 4KWVA 1WX0A 3W87A 3GDRA 3EDFA 2A2IA 2OT1A 3G1VA 1J4EA 4HHPA 3I65A 1K8XA 1KGXA 4QISA 3GR7A 2BHZA 1AW2A 5A2CA 1TTQA 1XL9A 2FFCA 4LV4A 3LX9A 1DQXA 1B4KA 4O50A 3WK1A 2Y89A 5F2GA 5MHBA 5FESA 5D03A 1XC4A 4PTNA 3OVRA 5C54A 4PFMA 4TVUA 3NQEA 1KFCA 5U7SA 1AMYA 3DFSA 3Q58A 1PCWA 1UOKA 3FOKA 3FAWA 2CZDA 4BF9A 3MWAA 4AEOA 1P1XA 1XSIA 4OV4A 1L2UA 5AHMA 3M41A 3L4WA 3UERA 2NLIA 3EKZA 1QMLA 3H53A 1ME8A 3BAIA 2BY3A 4LVAA 3VI2A 3CZLA 3GKFA 4UXDA 5HDRA 1SR9A 1TJPA 4AW7A 2GQAA 3G0UA 2J25A 2WVVB 2E1DA 4JL1A 1FBAA 4UR7A 5CKSA 2A6NA 1A53A 4WF7A 1RR2A 2GQ9A 2VFIA 1VCGA 2F84A 5HWJA 3KLKA 4FNUA 2XN0A 3P60A 4GRSA 3EWWA 3MYPA 4NU7A 3SZ8A 1EH9A 1KFBA 4JTTA 5DN1A 1QPOA 3N34A 1PIGA 1P0KA 2GJPA 4AMWA 1GZGA 1MEHA 4O8RA 3MHUA 3RMJA 3T4CA 5HWNA 3MI3A 4QNEA 3DFOA 1TPC1 1HFBA 4LT9A 1I45A 4AF0B 1SMDA 3QGVA 3BLIA 2Y85A 4IWWA 2HS8A 4AYSA 1H1ZA 4UCGA 1PL9A 4UFIA 3ZSSA 2F7QA 4EWND 3O05A 4M6VA 3MMTA 1SZNA 3BUBA 1KBJA 3IIZA 4GIAA 4W9TA 4E2BA 4Z0JA 3UWWA 2VNCA 1SO6A 3QM3A 2J9XA 5J5DA 4UQBA 3PB2A 2E5CA 3LM7A 4XQ6A 1LOLA 2BHUA 1OK4A 4UMAA 1R2TA 3DI1A 2PWDA 1OT1A 3O16A 3FW6A 3LCGA 2ZRZA 4N9CA 2DZWA 2C3ZA 4O0KA 3R89A 4WOQA 2V3FA 2C7FA 5BRBA 1TV8A 3M7WA 4KMQA 1AL8A 3LXCA 3NQ2A 1J0IA 3HG2A 3DBPA 3CPUA 3G24A 1F5ZA 3QQ0A 1ML1A 3NQCA 6TIMA 1GJPA 1HG3A 4QSHA 5D09A 4NZJA 1ZFJA 2DIEA 3UG5A 2BHYA 1R2RA 2FQIA 3Q2DA 3CU2A 1EIXA 2DZUA 4NNAA 3II1A 4ATWA 2A4AA 1G1YA 5TD4A 2VFEA 1OX4B 1GTEA 1KV5A 4LY8A 4LUIA 1TTPA 2WJZA 2CLIA 3TE9A 1XBVA 3ATZA 5KINA 3S42A 3WEMA 1ME7A 3ATYA 4PEKA 4JXCA 1YDOA 2VXNA 2WVVA 4R34A 4UTTC 1ZJAA 4CNOA 3L5MA 4K36A 4EVZA 3L2LA 3EJQA 3NR0A 1GJUA 2QCMA 5BNKA 2WSKA 3LI1A 3P81A 3SY5A 3O6DA 1ZY9A 4GI8A 3GK0A 4ADSA 1WAUA 4GJ1A 4HKPA 3W7QA 1FWNA 2OSYA 2GOUA 3CIXA 1YTKA 4MZ1A 3W7JA 4UTIA 5F2IA 3CB8A 4PA8A 3HG3A 3SGZA 2CLHA 3TUUA 3LTPA 4M7SA 1QWGA 3EJPA 3L5AA 2NSXA 4M5PA 3VE7A 3W22A 4PSPA 2FB2A 4BFAA 1TPDA 2WSPA 4TO8A 2E09A 3LLDA 4WQ6A 1J5TA 4XTIA 4TX9A 2E68A 4JEQA 4UQDA 3HPZA 3CWOX 4MJZA 3W7IA 4L4LA 2FHFA 3HGJA 1B4EA 1JI1A 3NM3A 2GVJA 5CPLA 1FWWA 2C13A 2OMAA 3L4YA 1H60A 4NXSA 1LOQA 1RP8A 4NNCA 1RV8A 1XUZA 4S2BA 3O63A 1P6WA 5I5RA 3ZQ9A 3F1QA 1XFBA 1S46A 1TRIA 4MAZA 5E0FA 1XD1A 3EEGA 2V0TA 4YL2A 3QF0A 3CV5A 2O7QA 1ZAHA 4GUJA 3IK2A 1W56A 2YDAA 1VS1A 1HTYA 2D2OA 1PZ2A 3JS3A 3N3MA 4LVBA 2F1AA 1JR1A 4LC8A 1EWDA 1Q6LA 1VQTA 1CXEA 5TIMA 1YXYA 1Z32X 3OLIA 4AWTA 1PZ3A 3T44A 1LLWA 3DKJA 3K30A 5AHEA 1OX4A 3R5EA 3G1XA 3PY2A 5EYWA 4MOZA 4CN1A 2AAAA 4WZHA 3FYOA 4EF8A 3WJZA 4AWSA 2FIQA 5FF0A 3CZKA 1V3JA 1XCWA 4HA1A 3KRUA 3UPBA 4AIEA 3TROA 5DY2A 3HBLA 3PS7A 1EX5A 4N02A 5F4SA 4XB3A 3O6YX 3TC6A 3C8FA 3K1DA 3W1PA 2NZLA 3E96A 4RJEA 2QPSA 3M1ZA 1WBHA 1FCUA 5DBUA 3EX1A 4XWUA 3TFCA 1S5TA 1KB3A 3AMLA 2ABAA 2ZCGA 1QI3A 2ZX8A 3OG3A 1MFVA 1DV7A 3KHJA 5K4XA 1MXSA 1TV7A 4NJHA 3CWNA 5E9AA 3M9YA 1O5XA 3MBDA 3LCIA 4GE8A 3NQ7A 4U2ZA 2X1UA 3TCEA 1L9WA 3BVVA 3W2JA 1FQ0A 4ZQNA 3M0ZA 1KBBA 4J3UA 1DQWA 2EEXA 5I3HA 1TYGA 2A7PA 2QJGA 4JX5A 2Q8ZA 3S5OA 4K6AA 2YYUA 2GPTA 5HPOA 5C5YA 4M6PA 3W2MA 1LBFA 1LWJA 3RIKA 4FX8A 2ZUSA 3P67A 3TC7A 2E6YA 3A4AA 4XTDA 4FF7A 2XVLA 2WSRA 1JULA 1QX1A 2EADA 2WPGA 4CCEA 2ZRXA 1IF2A 3B04A 4ZQOA 5I3FA 3BSHA 4LW7A 1JF6A 3PVFA 1UH3A 7TIMA 1E3ZA 1O60A 2VFDA 3BV4A 1JI2A 4FX7A 3S0CA 2G97A 1UH2A 2J88A 4R33A 1XCFA 1JQXA 3M5YA 3MI6A 1L0PA 3TFXA 1M7PA 1JXJA 1LLZA 1H62A 2B7QA 3D4ZA 3G8EA 5D2WA 2ZZ1A 4H4IA 5K3VA 3A21A 1YDVA 3BUPA 2OX1A 2V2CA 4FNSA 1JUBA 1DJQA 4J27A 3CM4A 1KBIA 2X2JA 2VEKA 3KX6A 5H91A 3DHUA 3GAYA 1TTJA 3NQFA 2H3BA 4I9AA 2V8ZA 1TCMA 2PCQA 3QFEA 2I14A 5DXXA 2CXGA 5LZLA 2V5LA 1WO2A 5F1VA 3BLKA 1KTNA 2VC6A 2WANA 4UFHA 4EF9A 2WNWA 1QWUA 1IXQA 4PSRA 4MLRA 5I23A 1JCXA 4R7JA 3L65A 1XV8A 4UNIA 4Z1DA 3KFTA 1Q6RA 1QPKA 1HTIA 2V82A 3C2FA 1B2YA 3P84A 4ADTA 1AQHA 2FH8A 3W7KA 3GLCA 2F1BA 3DHPA 5CGTA 3V1PA 3Q94A 4J3XA 3NQMA 3MI2A 3CC1A 1RQEA 3G1YA 3W37A 4U33A 2G96A 4OU1A 2DZPA 5CZTA 2DU2A 2AQWA 5EMYA 1M7XA 3RLVA 2ZZ6A 3BGGA 2YA2A 2BY1A 2NX3A 3LOTA 1MEWA 3LHUA
chains in the Genus database with same CATH superfamily
4Y8FA 4YR6A 3W7RA 4M8UA 4M9OA 3SQMA 3CMJA 2PDKA 1DWIM 4NI3A 2X1SA 5KVGH 3UAJD 1UPMB 5PAZA 4BH7B 4AQEB 1IQXA 1H5BA 4L4TA 1XBDA 1HM2A 1E3FA 2WV8A 1RHFA 5D5ME 2E5BA 3R18A 3CH1B 1KM4A 3TYGH 1JCKA 1AW1A 1GWJA 2FL5A 1GIGL 4BTYA 2NCEA 2OV0A 3OVQA 3KCPB 1BQCA 4JRYB 5DLMH 4PLKC 4PMQA 3VSUA 1CR9H 2H2SD 2FQEA 5IMKA 3BKCH 3GTVA 4APQB 5DUML 2WBJD 4JFEB 1CLXA 4P7RA 4W81A 3QORB 3S8GB 1B9BA 1F11B 3MXVL 3T8XA 4GQ9H 3RWFA 3ZDYF 1Q9WB 5TNVA 4E0CA 2NXIA 2Z9TA 1Z3GL 3D05A 5GSVA 5I0XA 4G1MA 5G1YA 4KJQC 4A2DA 1QAFA 5IZ7A 3MSRA 3D39D 4FNLH 1A4JB 4PGCA 3GJFK 4I8DA 4NP4L 4DO7A 7ODCA 3OKMB 5TQLA 2CJTA 1XXXA 4XIMA 1R85A 4OLZH 1FIEA 4QRPE 1TJIL 5D1ZD 1X9RA 2F7FA 5EU6D 1RWCA 4XO8A 4DJFD 2XKNB 3E8UL 1I7RA 2BSRA 4OM1L 1TCDA 2DRUA 4PBEA 2A9ML 4BQ6A 5C09D 3RWCB 4KKZA 1E0WA 4HZ7A 3WLBB 3RY6A 1F6AA 1DBTA 4O11A 2XG9A 2Q9OA 1LROA 2FCBA 2WWNA 3IJSB 4XVSH 1KBPA 1OW0C 3X12B 4GT0A 2EVHA 4HH9B 5HHVL 2J8UA 4J1OA 1GYUA 3ZGIA 3ABSA 1AZNA 1K02A 2JB5L 3VC5A 3Q9PA 3KD4A 3W7PA 3V0SA 5SWUA 2VR6A 4UBDC 1E4WH 4G8GD 3C6SA 3FJLA 1DTUA 2IGFH 5BZZA 3QHZL 1EJTC 1PZDA 1TVHA 3WUFA 1GZPB 2B5IB 3QBTB 3HGSA 5TQ0L 1PTDA 2FNBA 3WDHA 2VXVL 5CIPA 3P4NA 4DJDD 3BPLC 1IAOA 2UZ9A 4POYA 3P80A 3WSUA 2WC4A 5IM7A 2NW3B 1T1ZB 3TA6A 4G11A 5A8GA 4HSAC 1ISZA 1G01A 2AQTA 2HWZH 1BOGB 3L3HA 4S1QH 1HW6A 3DHFA 3SY1A 5JIPA 3RB5A 4MADA 3INOA 2X03A 8TIMA 5HHMB 2P4AB 3FSZA 2QPEB 1PSKL 2YAPA 1DIDA 3SE8H 5TE6H 2DQEH 3VGHA 2PDGA 4A8IA 3HE7B 1WV2A 2ZF8A 4HWUA 3D69B 1JCNA 1GVOA 2XBZA 4WDTA 1HCYA 2NQZA 3WJLC 1QSEE 2V69A 2J4GA 3GZAA 4HZLB 2ZUXA 1AKJA 2FZBA 4AVNA 1W9VA 4PJBE 1KZYA 1LE5A 4O13A 3OC5A 5AD0B 1LZOA 1XGRB 5HDQL 1R3IL 1V6XA 4RNHA 4JTLA 2WZPD 4CADB 4IUOA 1ZV9A 4FQXC 1R46A 4AF0A 3GMPA 1K9TA 5EIIB 5MHSE 5IROC 2XG5B 2AOSA 1D6UA 1XCTA 5DD5H 5GQBA 3C0QA 2N1TE 2X4QB 2VO5A 4BFNA 3FUKA 4KK6C 3MVSA 5D96B 3OR7A 3CL6A 4F8LA 2DIAA 4UUJB 5LXGH 1HDMB 1X5XA 3BMWA 4GYPA 1J5OH 1DXIA 1MKFA 1KPUB 1YTDA 2G4JA 2WBXA 4Y4FA 4XAGA 3B37A 3I3DA 3X11A 2IAMC 2FSEA 3WNMA 2FJFA 3QNYA 1K3UA 9XIMA 2HPOA 1LO3L 4HHAA 2PGEA 3P2DA 4KU1A 3KWVA 3I75A 1R3LB 5JPNC 5C9JB 4IBQA 3UR7A 3T4YA 1RIVL 3OIXA 3DX3A 1MUWA 5HR7A 3MV9D 2QQ6A 4BYHA 5L88H 3BPNC 4PJEE 4KKCC 4HAFA 2ZZ5A 3L4TA 1KV8A 1EX1A 5F88B 5EIIG 2N56A 3WLPA 2HMCA 4IG2A 1PYWA 3TX9A 4J6RH 3GZOA 3HNVH 5LHEA 1U3JA 4R7OA 2D7NA 1INQB 4DFIA 1NGQL 1DVUA 2BSED 2J2ZA 2QEJA 3OMAB 3R11A 4QAMB 5FEXA 2AZUA 2FTPA 4YTQA 1IC7H 2P76A 3AFJA 3UTZB 1W2VA 3VB8A 4BQ5A 3HB3B 2AVFA 1IEBB 1LRQA 2RGMA 5KVEE 5TQ2H 1NZRA 4KDTA 2WLIA 3VCLB 1CECA 1Y6KR 1TO5A 3D51A 3MLVL 3UX9B 4KRUA 1DJIA 2ZYFA 5JPMB 4LMQE 1DBML 2QAFA 1BD2D 4TUUA 4NZFA 4PJXE 3GD6A 1JGDA 4K7FB 2RBLA 2OR9L 2UV8G 3PWGA 1AD9A 4QF1B 5D7EA 5C09E 2OTUA 3HE6C 2FD6L 2PETA 1DEEB 2FR4A 2REQA 1BWLA 1BQSA 1KELH 4Z42C 4LOUC 5G4WA 4JY5H 2BGQA 1BYNA 4DCQB 2NY2B 2H9GA 1R9ZA 1L9SA 4YDNA 1KRMA 4IPIA 4JPVH 1NU5A 5L2KB 4I5XA 5FAAA 2EUZA 4G8GE 4JX6A 2XINA 3GMRB 3CN4A 1NDGB 3LUTA 3GJFB 4HWZB 1MI5A 2WXHA 1J9YA 3LTYA 1PS3A 3OX8A 2W0PA 1W2ZA 3BCDA 2D1WA 3BJLA 2Z1XA 3OB0H 3UG4A 2ZWYA 3EDEA 1VB9A 4GW4A 1B3ZA 2EXYD 4JDEB 4NKOA 1RVKA 1IMHC 3PUEA 4B9IA 2BS8A 4XB7A 4ZQKA 4GLEA 1I53A 1Q38A 2QVTA 4K3EH 2Q09A 1X4YA 5J3HC 2PTWA 4WJKB 4C6LA 1KYFA 2ENJA 4R2GC 3ZT6A 3P77A 3UBHA 4WK2B 3VXRA 4I89A 1U2CA 2I7SA 2A74A 1N4XH 4O0ZA 1WMNA 2OXNA 2GSMB 3S4CA 4DXXA 4TVCA 3SO5A 5I8CB 3IRCA 2V9UA 4P5MB 5A3IC 3GTFA 2EEDA 3KVPA 4WW2A 5JOEA 3TL5A 3N9RA 3LHWA 1L0QA 3KPPA 5JLZA 4W6XB 4AQZA 1VJIA 5I6MA 3FDGA 2ISWA 4MNHB 4A68A 3UNDA 4H7VA 2BOCB 4WUUD 2C9AA 5HMFA 4OV6F 1ONQA 1GKRA 3WMPA 4N4PA 1B3XA 5EC1A 3ECWA 4PG9A 3QHMA 4FTVA 1RPUA 2G3NA 1KM6A 1THFD 1I1YB 2FO4B 2V5JA 1LDSA 1YGAA 5LGYA 3AWOA 5CJOH 1P9MC 5JDSA 1HHKB 1S2CA 5DJ2A 1XKJA 2XACC 4DBEA 3RAJL 2WM0A 4IF2A 3KXFA 4WDUA 2GJNA 2WKJA 3TU6A 4EAEA 4IMAA 1S9VB 3WLMA 3ZZQA 1EFXD 3UCQA 3MCNA 3AGWA 1HXYA 1VPOH 1P7BA 2P80D 1C5CH 2QELA 4Y9NA 1CGTA 3O6FD 1D9KA 3VXTB 2PP1A 5AVRB 1DBBH 1UWFA 2KI6A 3SGKC 5HJBA 1K1XA 3CLMA 2E7DA 3H12A 2X4NB 4YHOL 4WIWA 2VDPH 3LD5A 1J01A 2XX1A 5D1XB 4Z18A 3V0DA 1O5RA 3TO2B 3BUQA 3BUTA 2E75C 3FT2B 1SJDA 4O1AA 4GKSB 1NBVH 4AIOA 4WUIA 1A9BB 4F57H 4GO8A 1KWKA 2WYTA 1FL6A 1ITXA 2BDQA 2UUDH 4EE2A 2Y5QA 4M6OH 3MANA 1HXMB 1KFGA 4QRRB 4S0HA 3ZYIA 1ODUA 1UG9A 5GRWA 1W6LA 5J13B 4FFVD 4FERA 3A3YB 4G6FD 1ENUA 3WQ8A 3ZL2A 5JMOC 4I77L 2Y63A 1RWFA 5E5CA 3QO1B 4N9GB 2DWEA 5BROA 5GS0D 3BVNB 3FTSA 1B6UA 3TIEA 5I30H 4UQCA 4FE9A 4MZ3A 5KJRL 1PKQB 3K25A 1I1AC 2OX4A 1E6OL 1S3KH 3DHMA 1FN4A 1XYAA 4X6CE 4A2RA 2XSAA 2BZNA 1KTCA 2Y1ZA 4DP5X 1W9XA 2FBOJ 5J9PA 1Z9MA 4OLVL 3W57A 3BWAA 4BCEA 1MHCA 1IVWA 5C08A 5T1LA 2OGYA 5HMEA 1Q94A 1B88A 4EI0A 3KOYA 3E74A 2O7SA 3ARDA 3C60A 3H9ZA 5B22A 1YEJL 2FKPA 4JG0L 4PJGF 3GU2A 3VZZA 1X9UA 3O4OC 4YWSA 2J7HA 4FADA 4AGOA 3IDYC 1ZVNA 2FGLA 2QDGA 3JWNE 1A5CA 2RR3A 2R27A 4AM0Q 4OCWL 3HS0C 4FFYL 2YBTA 4G6MH 2FBJH 4GQPH 3LDVA 5DCDA 2A99A 3QEQB 2IDSA 1H8LA 3GSWA 5CCJA 4B5UA 4G1NA 4U1MA 3N4FA 1KTDA 4N85A 1T5WA 4YXLH 3T05A 3AG1B 3C08H 3O0RL 2J27A 3JYBA 4LF3A 1NOFA 1G1CA 1VDGA 1TITA 4JNYA 4H9XA 1A1NA 1KACB 1BZ9A 3ZLFA 2V37A 5MEND 5IBXC 3MJ9A 1UASA 3ITTA 1VR6A 3PQYD 1G6VK 3EJZC 4E4PA 5DSCA 5E2UL 1A6TB 3ULVH 4OJFL 5DJ8B 1N5YL 3KR3H 4A2GA 2XFXB 3IGUA 4TNWF 4ZO6A 1N6VA 5L4FA 3QYSA 3OAUH 5I6XB 2CDEB 1UUMA 1HQRB 3VIOA 3PP3H 4AC2A 2XXMB 1DJYA 2CAKA 4P8XA 6XIMA 1HH6A 4PV9B 4F0RA 3CVHL 5BW6A 3RPDA 1R4XA 1S5IH 4CQ9A 3IJHB 1ZE3H 2JGQA 4XC3L 1YMMB 4IIBA 5C0FB 2FB3A 1C8PA 4KVCH 2X6VA 1US2A 4MF4A 4WUUE 5HHNB 3IDUA 2D9QB 5FM5M 1SDYA 1MW2A 4CMHB 3GG8A 1FBIH 3AADB 4H40A 2WVUA 1UWYA 2WBKA 2WIMA 2VISB 3Q13A 2NNAA 5EORL 1Y5VA 2Q86B 3FO2A 3PTKA 4GRMB 2C19A 1NM9A 4QLKA 3AXMA 3OG4B 3BS6A 4NBXB 1DIOA 4ZPTB 3SY0A 2RH0A 1HU8A 3B9KC 1TNNA 3QSTA 4C59B 1FXQA 5E2VH 2UY5A 1EHXA 1CFTA 1NSMA 4MKMA 4QJ4B 3WL9B 5DJXA 5F96H 3GDLA 1W5OA 1AHWC 4PL2A 3SSZA 1A7QL 1SHMA 3Q48A 4ZFFA 3V4BA 2HAZA 1MDTA 2YJQA 1HHGB 4NI6A 4EUPA 1FCBA 3BLPX 3GNDA 3QRHA 3R1GL 1KCRL 1NFIB 4BUGA 3PSVA 4CBZA 1QZNA 2WKGA 3O1NA 5DHMC 3DOHA 1ZS8B 4E0RA 3APFA 5HULA 3GSOA 1FNSL 2G4FA 4X2PA 1JJUA 1TZ7A 1WA2X 3GHBH 4PTVA 3HV8A 4N0FA 1TTGA 3OKEB 3VH8B 3GTTA 4YMPA 4POCA 2CERA 3SPCA 4QEEA 4R7NB 4URIA 4WOZA 2J71A 4Z1AA 3V5KA 2Z91B 1L0XA 5BOEA 1H9DA 5HVHC 2ZUVA 2CWUA 2J47A 3MJ9H 4MB3A 3Q43A 3VJ6A 4HULB 1F05A 1EA0A 2VW4A 3N9GL 1L6ZA 4Y6GA 1Z7AA 3DSFL 4OUOA 2AAMA 4FYRA 3OS7A 3N6QA 5CJ5A 2ASHA 1Q90A 3H0TA 2WAGA 2TSBA 5J5RA 5IUCA 2CIIA 5FA3A 3W75A 3NXLA 5SWZB 2OBGA 4IIZA 3WXVL 4ELMF 4KEVA 5MF5A 1LEGA 1AIFB 3EDFA 2NY0C 1J4EA 3QQ3B 4EIUA 1KGXA 4NQEA 4I3SH 1RHHB 3V6OE 4UOW0 5KYUA 2QV5A 4O2CA 5ELIA 1GQLA 5D03A 1NUNB 3H2EA 1UOKA 4NUPA 3OGOE 3G6JB 1CFVL 4GX8A 5DQDH 4XNZC 3VXUE 4OV4A 1GKOA 5E95B 3GKFA 1VFBA 3KW8A 5HDRA 3GMOB 3FUEA 3TPUA 2E1DA 4BHYA 4BM7A 2R9RA 2JB6B 3N6HA 5GRUH 4JG5A 3L17A 2DQUH 1K5NB 3DFOA 4H9VA 4PRHB 4FOUA 1E6RA 1HKMA 3HZKB 4K94L 2G4GA 1PTGA 4EWND 4KCWA 2EO9A 3BUBA 3RVUD 3V4UH 4RW5A 2X2UA 3WO4B 4UMAA 4DWDA 1JZHA 4Q8OA 4APXA 1QI0A 2ZAGA 1YEEH 1GQKA 3PQYE 4KMQA 1GJPA 3QPXH 4EUPH 1RZ8A 1OADA 3FU6A 2C9VA 2GGJA 2R29H 2DKMA 2BFVH 4IQDA 3S6TA 4MWAD 1J1OL 3DV4A 1XYBA 2I9TA 2VXNA 1FDLH 4W7VA 2VE6B 5CEYB 4N0UB 2QCMA 3WE6B 3O81A 1F86A 1O7AA 3O6DA 1IHIA 3OJDB 3DERA 3THUA 1F1GA 1ZXKA 1YTKA 4N25A 3V6BR 35C8H 1KGCE 3F7JA 5C07E 3L3IA 4ICXA 4TO8A 1MY7A 4WQ6A 3QK0A 1SFDA 1WGOA 1NDMA 1GAFH 3K46A 3BEVB 2WYIA 1V6WA 1SNRA 4Z78A 1JGVH 1QSFD 2C13A 4NCC1 3IKCB 3Q01A 3RIFF 2OXHB 1A4KB 1SJAA 4HIEB 2O7QA 3QQWA 2YDAA 5GSRB 1VS1A 3N3MA 3RNQA 3H9SB 1N2RA 1QPXA 3D4GA 1NFKA 4LUSA 4FQ1L 1TJHH 4RBPK 4LIQE 3DIFA 2GYSA 2JQMA 1RUAL 3PS7A 3SN6N 4PMZA 4LCRA 2Y5TB 2QPSA 1GGUA 4E5TA 3PWIA 4NAFB 1E5BA 5LGJB 2ARJB 5HYJB 4GE8A 3TCEA 1UWUA 3GSRB 3M0ZA 5A6KA 5AOKA 1NCHA 4J3UA 4I88A 4X63A 4Y2OB 1TKWB 3GUGA 1LP9F 4XBEH 3BICA 1D5XA 3P67A 3GUTA 1W6GA 2RUSA 4UNUA 1X5ZA 4LESA 4NKDA 3VVWA 1JULA 1QX1A 2WPGA 5C0IB 1GA2A 5SWSB 1G7LA 3ZO0A 1RKYA 3APYA 3G6AA 2G97A 4K5LA 3C6LA 1M7PA 2YGVA 3IPEA 4I48B 1H62A 5D2WA 1FJ1B 3D12B 4P46D 5K3VA 2IV9A 2X4SB 5LNEA 5H91A 3DHUA 4QDGA 1TTJA 4I9AA 1DQML 2GFBB 2PCQA 4AL8H 4DN3L 1MRFH 1QWUA 2H1XA 4OLEA 1S8DA 1P5VB 4BINA 2XWRA 1BVLA 5DRCA 5DUPL 4OLWH 3NQMA 3G6LA 4Y5VB 5I8KL 5IB1A 2UY7B 3KPRD 2XSBA 3SE3A 2FIRT 4ADIA 3VTAA 3BH8B 3QI9C 1QEWB 3N85H 4KCVA 4L64A 3LOTA 2VERN 3ZHDA 4F0MA 1JDCA 4KUZH 3RRAA 1VFUA 1OJOA 2J1XA 2QHAA 3ZE2B 2APFA 3C9NB 4YIQA 5L6UA 1NCAH 4GACA 2GUUA 3BDYH 3TLRA 4BCXA 4DB7A 4F2MB 3VXSE 4XPHH 5EUOE 4JO2H 5BXTA 3MU3A 1UENA 3PL6D 5F1OB 4PB4A 4XNQB 4BZFA 2AEIT 2WAHA 3W02A 1ZHNA 2OVLA 1EANA 3W39B 4G7EA 1DVFC 5AZ1A 2A9AA 3EKGA 4P2OA 3LN9A 4YNGA 2Y72A 2WVXA 4EOWL 5IVXE 1V93A 4KQ3H 1Z44A 1GSKA 4MMXA 1IGCL 2FJKA 1EXGA 1YE6A 4C56E 3CV7A 2HRLA 4C6IA 3DKLA 1A14H 2Y73A 3ERPA 3Q37A 2OW7A 2YDQA 5AOLA 3QRBA 4JBRA 1L6GA 1X1ZA 2R24A 4JHAL 2NWSA 1NOAA 3MGOA 1ED3B 3ET9F 2QZ5A 1GY2A 4JTUA 4WTZG 4LY4A 1NINA 5IQLA 2WHLA 3QV7A 1ZOXA 3I68A 1WV7T 3U2ZA 3AQZA 2LQRA 3C5ZB 4MWAE 2PFHA 1QNOA 4FALA 1TIUA 4O1CA 4C91A 1BM3L 1HZHL 1WA3A 4A6GA 5IEHB 3UTPE 3QC6X 2QUNA 2IANA 3HMXL 3TN4A 4G43A 4LVFA 4LSTL 4L3AA 5LAXA 4OCYL 1RUQH 1EF2A 2HG0A 3MBEA 1PUDA 3JZ7A 3VE9A 1YEDB 3VWKC 4F7CB 1AGBA 3KE0A 1WXZA 1F3RB 2QJHA 1XISA 1I1RA 1BEYH 2WYZA 3ZDYB 2NR6D 1WFNA 4J3OD 1SQMA 1I1WA 1C12B 1E9PA 2NQCA 4UWQB 4DBDA 1PB0A 1FVDA 2CMRL 1XAUA 4JMXA 1QSFE 2G2NA 4YGVA 3GZ3A 1VHPA 3FT9A 4UZUA 5IQ7L 1SO4A 3M88A 2DT3A 2Y06L 4X6DE 2IXQA 1CMOA 4W89A 4NCC2 3MV7B 4U49A 3FC8A 5GNYA 2DLHA 4LLAA 3MREA 5AVXB 1FKWA 4MQ7B 2NNXA 4I18A 2F6UA 1CLOL 4B9JA 3NYKA 4XNMB 3QRGL 3TBSA 4QIRA 1B0GA 4LARH 3BCJA 2DLTA 1JDAA 4Y9OA 3A67H 1Q7QA 4DF1A 1SJEB 5D2NE 2EG8A 3LS4H 5C92A 3IWUA 2C26A 2CBJA 3ES6A 3VOJA 1A66A 4AH7A 1IQDA 4LGSB 1LO4H 3O3EB 2C1PA 3WY3A 5I76A 1GMEA 4L1BA 4XV0A 1X5YA 1MW1A 2OJEA 5E9DD 3L9YA 2XWBA 5F7YC 4AQOA 1K1YA 1H0DA 4UTCA 2GIYA 3GMMA 2CCRA 4IRJB 3D0LA 1AMXA 3UFIA 4QOKB 4P5TC 3LKSB 5HHQA 1W6WA 1KW1A 1KO0A 3N5AA 1L7IL 2WZAA 1XIHA 5AOMA 3D48R 3U2OA 4OGYH 3KPRE 3HIGA 3CX2A 5KBMA 2E28A 1F9CA 1T2JA 1N67A 4O28A 4JFDB 4WX2A 5JXED 1JFHA 3L3JA 5DWPA 3EW3B 3LKRA 4Y1TA 2DDXA 4AGPA 4JZJC 1U3HD 4MJID 1F5WA 2VEIA 4Y19B 1KRAC 1UC6A 1YMHB 4MWFA 3WKZA 3F5KA 2HPMA 4HW6A 3B03A 1WFJA 3GGWB 3BZ5A 4RPPA 3F7VB 3EJJX 2V3EA 1AHKA 2PCPA 4OD2A 3SURA 4ZMVA 3MDUA 3CFTA 3SDYH 2WNXA 1FIGL 4M62L 3B0PA 1T0PB 2QL1A 2FX8L 1K7FA 2CESA 3VIKA 1HI6A 4FQQA 5ICYA 2H1PL 2BZCA 3QUMA 4X5WB 2JFEX 1OM3H 3QQ4B 3STPA 1BZEA 1RV6X 3ZBMA 3BPOC 1RAMA 2FLIA 2VLJB 5G4EA 2MANA 3KLAB 1QJWA 3S3PA 3KHQA 3FQ2A 4WHCA 3MLPA 5JIHA 2IQ9H 2I32A 2OCZA 2EDRA 3ULUE 4RH4A 3VFLA 3DV6B 3PAYA 4FLSA 3QUZA 4FQCH 1RSFA 1ZSXA 5CM1A 3L54A 3QPKA 3N13A 3H3PH 4M7TA 4XPTH 4XK2A 1WBJA 1PV8A 5DC2A 4X7TA 2PABA 4Y90A 3CUJA 4LSQL 2PWFA 3AYTA 4J5NA 3G5VB 3ACSA 4F8PA 2Q87A 1S5WA 1RALA 2VR7A 4W4QA 4GBUA 1CIDA 2YPVA 2BSCA 1KRCC 2O5XL 5G4NA 3K5RA 4JZNB 4AX6A 1MDLA 4YHKH 2D3LA 3TXAA 3BCFA 2YPLB 2OR7A 3WQEA 4R96A 1UJ3A 4JHVA 3AACA 4PP2B 1WVZA 1Z48A 4A3YA 1YNLH 2HN7A 3V6FA 3TC9A 1YPZE 2YD7A 4JRXA 3W7DA 5IIEA 7FABH 4J8QA 5LBVA 5D8JH 3RDTB 3T2NH 1H5BC 3EG9A 2WUCH 3B56A 1HH9A 1XGTA 1EHLL 2HLEB 5I26A 1U5JA 5D7IE 5K9OA 4DKFL 2ZG1A 4NFCA 2X0SA 1WF5A 4GY4A 3VRJA 4X7CC 2AMUA 1QDSA 3CNYA 2EC9T 3VKBA 3MUHL 1S3HA 5GJTH 3CFDA 5JMRA 1NSSA 2WSQA 1GHSA 4HZ1A 1GS6X 6ENLA 5EOQL 3N1FC 3T3PE 3MUXA 2F8IA 3IJYB 2BY2A 4XNYL 1WDPA 5KG9A 5K33A 1C93A 3QUMH 3HZVA 3WJYA 1VBUA 5I79A 3DG7A 4JICA 5I5MA 4HFWB 1IT0A 5AECA 1EO7A 3JVFC 4DWSD 4TMCA 1HJVA 1I60A 4G9FA 4KF1A 1ZENA 4WWKA 3N2BA 3CH8A 3VNZA 1IT8A 4GPNA 3MRMB 4BFEA 1EV2E 1FFPB 1HE8A 4DWHA 5HGBB 1OP9A 1HX0A 1G9ML 3PAOA 3MV11 3VWKA 1NEUA 4G5ZH 3NCBB 4F7PA 1UWEL 4JTRA 4IBUA 3SSJA 2OWWA 2ZNXA 1FCCA 4L3FA 4K8GA 5IQMA 3GS4A 1V7ML 4WKAA 2J79A 4DVBA 1AI1H 2YPVH 3VXGA 4MJIE 4F9LA 4P5KB 4GCAA 3G5ZB 4FRWA 2RDUA 2BCKA 2RMNA 4PLJD 5IOBA 3B3DA 3V8CA 3JSSA 1A65A 2VABA 4KH2A 2K3HA 5T5FL 3PSWA 1JFXA 1HNFA 3F4VA 3RO8A 4BZYA 4FQLL 4MASA 3MRJA 4HALA 4Q4OA 5FLVA 1MQPA 1N5AA 2NXZB 1KG0B 2LT9A 4HBCH 4LHUA 4LSBA 4B60A 2DWTA 2PUZA 2VSDA 1CG9B 2ISSA 2OTWB 2XYBA 4J3VA 3A47A 4D2JA 2QLVB 4YX2L 1UVQA 5GJMA 2H5UA 3UCRA 5CZSA 1C16A 2ACQA 3S36X 3EGSA 1F0LA 2COQA 2X4UB 3O2DL 1P1VA 3LEYL 3MCLH 1E56A 5K9KB 4WD0A 4RZ6A 2FE0A 1HWGB 2FX7L 4JPKL 1NCWL 1KZQA 3VFPA 4NLAA 4XIAA 3IMUA 2ZNWA 1BJ1H 3VI4F 1TU2B 1XP3A 2RIKA 2IWKA 1EWHA 3OZ9H 2CLKA 1OFQA 3GRGA 1GCYA 5FHBL 1BMZA 3AOFA 2FHCA 1KFLA 4JLRB 4V1DA 3HU7A 3NESA 3TYDA 4P5TA 1XF0A 2IQAA 2EH8L 2R23B 4E5XG 4KRLB 4HS3B 3MNWA 5DCCA 5EF0A 3V4LA 2IPUG 4B9YA 3CT2A 1ZPUA 1S7VA 4FQPA 3LV5A 2AQSA 3RA7H 3UL4A 3FB8A 5KSAA 1T6VN 4FG2A 4YSRA 2QDHA 2FWLB 4H25A 4BZ1A 1YXCA 1U58A 1DDHB 3TNNB 1IVUA 4BCYA 3UXLA 4GYPC 2HSIA 5D37A 1RAKA 5DMKA 4B16A 1MVUB 4Y4FC 2PDXA 1E15A 2JXMB 1NCJA 4DFHA 5LNUA 3MC0A 1SBSH 3U9WA 3QO0A 3F4CA 2AVGA 4P5UA 3EYFA 1QA9A 2X0WA 1FSKC 5DK0A 3M1BA 3VKJA 2XQBH 3DN5A 5FGRA 2QZRA 1MJUL 3T6QC 1EDGA 4NWUH 3N43F 1R0MA 3ZYOA 3JWDH 3BKYH 5GIRB 3UAAA 2H6PA 3RWEB 2WQWA 2DBLL 4TLSA 5DUBA 4PJGB 2B3IA 4UV4H 3ZMRA 3LMYA 2WOQA 4J9JA 1HO4A 2R83A 3PJUA 1Q66A 2Y22A 4NASA 4XO3A 4B3VA 5EKYA 3HZMA 4Z7QE 3G5WA 4AK1A 3LMZA 2BDNH 3FFDA 5AVYB 1RFDL 1O5DT 5GGQH 2Z31D 3GMNB 3KCOA 3DUUB 4LEFA 1CDGA 4KHXH 4KFFA 1CJYA 1G7IB 4OZFH 5BU9A 2BFGA 4KY1L 3WEXA 3EYOB 4XP6H 5E6IA 4PJ7A 3KBEA 2VQ1A 1NBCA 5FOOA 3QB7C 1ZHBA 3DVNA 5DK2A 4KDTC 3ITLA 3W11C 4ZUUB 4TTGA 2VZSA 1V3MA 5I8EB 4CQAA 3L7EA 3BN9D 1QW9A 3I2CL 4G80B 4OIIH 2QXWA 1OE3A 3EO0B 3G7TA 1WIPA 5K59F 2NUXA 3F58L 4OT7A 3A9BA 4LS0A 3TXZA 3PXHA 3UYCA 3L5WB 4JKPL 1KM5A 1VLWA 3B06A 4MDJB 4M7JH 1GEQA 5JU6A 3U46B 4OGZA 3ZTCC 3LQAL 4EXQA 4HVXA 3ATAA 3VNYA 3QXDA 5I18L 5C0AD 2HKHL 4WIQA 1V55B 4LVHC 3NCXA 5DMGC 3RUGF 2I9EA 1SQ7A 4FR1A 1EGZA 4JFQA 4RGMB 1LBLA 1QRND 1EEYA 4BV1A 1ROCA 1DXFA 1C9WA 2D0FA 2P24A 1OC6A 4HS8L 1XGPB 1L6YA 4JFFA 4LANA 2EYTA 3WEBA 1KJMA 2APBA 1JPGA 5KYYA 1NKOA 1KXTA 1QFHA 3K72B 4LOCA 3P4MB 2WMIA 2ATMA 3O9WD 5E4OA 2OLAA 3BURA 1RPQA 4GG6A 1NSNL 4UV7L 4R4NC 5HYQA 1TJGL 5ABEA 3HJZA 3FS2A 1CK0L 2CHOA 2VLKB 3QNFA 3BX7C 4LU0A 1MFCH 1E8YA 5FAJA 2Y0FA 2A74C 3P73B 3I9GH 3TEXA 1H41A 3DGRA 5BOFA 2X38A 1KYOJ 1X5LA 4NKMA 2WNKA 4NAEA 1CGYA 3S1WA 4XC1L 1E9QA 1NQBA 3BQUD 5I1HL 5C6MA 1EL3A 4U6XB 4MNQA 4EE9A 3FQXA 2QULA 1QW8A 5EU7E 4CNPA 4AZCB 2E4TA 3W7SA 4U1JA 3KVMA 3EDKA 1MFMA 5IV2B 3BUDA 4WW2C 1YVLA 2K4AA 2E9BA 3QUKA 5C0DB 4HPJA 4JFXB 3RWDA 4ETQA 1QPNA 3O6AA 1KJ2A 5A16A 1H50A 2XH2A 1N26A 4E9TA 2V33A 4NEIA 1A6ZB 1EZUA 1I8KB 3VGDA 4Z5RB 3BW9A 1KD0A 2NW2B 3B4YA 1A5FH 1G0YR 4L4JA 4LLUA 2CKRA 2AEQL 3RLSA 4BF7A 4J2PA 1NPJA 2Y89A 1JFQH 4KEMA 3QXAB 5LIXX 2DIBA 4H41A 4FZ8L 5KZCD 1GK8A 1G4RA 2AGJL 4LCWB 1SFHA 4O02L 5FKAA 1U8PA 1IAMA 1R87A 2GQ9A 3OPSA 4JQ1A 1BLNA 2B9AA 3L8QA 4B5XA 2F84A 3SZ8A 4XNUL 2R7EB 5D55A 1D9KC 1QPOA 3N34A 4C6PA 5LN4A 1GOQA 4OB5H 2I26N 1UKPA 1KN2H 3MI3A 3QEGL 5ID1A 3ULVC 4ELMB 3L3DA 3LOWA 4PJ8B 5EOCJ 4DVRH 3FT3A 3LSBA 1M1XA 1N9EA 2LLNA 5C2BL 4NUQA 3O05A 1EHKB 4E41B 4J40A 5CZVH 2AQ2A 2DUXA 1NMAL 5HHXL 1FYTD 3MNMA 4LALA 2AJXH 2ZRZA 4O0KA 2ADAA 4DKDC 1ZE3C 3HG2A 3V0TA 1UR0A 2Z1SA 3HFYA 1LMKA 3DXAB 1R24A 3NQKA 3T3ME 5EGRA 2N3JA 2OSLA 1TTPA 2CLIA 3FQ1A 1NAMA 3KS0J 2IXUA 2BOFX 3UTSB 3KH3A 2A3HA 3SY5A 4GUQA 5F3HB 1AA1B 1I3VA 1AH1A 4PJIA 4N2CA 1KGJA 1H15B 5BWFA 2ACUA 3S3SA 2FB2A 4AQAA 5DZLA 5J57B 5IR1A 2FZ9A 4HCFA 2UY3A 3CLEL 5H8DA 3NM3A 5EBAA 3SBPA 2GVJA 3CX5K 5ALBL 1JTPA 2K4WA 3VK5A 5E6UB 3LHPH 1I31A 2AAVA 1OEPA 3FH7A 3ARDC 4KOCA 2W95A 1KCUH 5B1KA 3C60C 1BYPA 2QGYA 3EH1A 3FV9A 1KJ2H 1URLA 1KKOA 4ATTA 3B8SA 1L9MA 4HAGA 3B2UC 3STZB 4ZNCD 5TIMA 1WFTA 1XF2B 1VQTA 5C0AE 2FGWH 2IH3A 1JTOA 4HS6B 3G1XA 4N3TA 2CWVA 5T3ZL 3V0WL 3CWHA 1QRNE 4BBWA 3MCYA 3OYXA 2IPFA 5EMLA 4HT1L 2AL1A 3DVFA 4GBXB 1MCFA 4PIRF 1D6VL 3WLRA 5KVMC 2D7PA 4D72A 3R7RA 1D6ZA 1FQ0A 2VIRA 1ZLDA 5FW6A 1E6JH 5TF1H 4DM2A 3WLKX 2AABL 1XIWC 4GIYA 3QDGB 5FYJD 2EDKA 5CIPH 3K5XA 2Q71A 2AP2A 1NQKA 1A8JH 4P3WA 2QDDA 1Z9OA 5E94A 2XFGB 1RWHA 3D39E 1GW0A 2ITDB 3AVEA 1NSRA 3WOVA 4UINL 3UXIA 3QFEA 2YD3A 2DJ4A 3PF2A 3BLKA 5BXFA 1ZHLB 7XIMA 4PSRA 1YY9C 4XCFH 4NERA 4UIMA 3QPQD 1RZQA 4HJSA 4LLYA 1HJBC 5J06A 1QPKA 3C2FA 4JEGB 1QLFB 1RZFL 4UAOB 3W7KA 3IFLH 5FF6A 1U8CB 5EU6E 1WC7B 4AD5A 4YBQD 1LP9B 1NAMH 2MWCA 3RFZA 4RX4D 3PTQA 4HKXB 4ZSOA 3L7FB 2BVQB 2HK1A 1MEWA 2Y8UA 3L1FA 4IDJH 4Y9MA 2NDFA 4FABL 4QG6A 1E30A 3UGVA 1FP9A 5FEWA 1I9RL 3QJFA 1W1A1 4N68A 1G7VA 3OAYK 4E2VA 3ETTA 2Y07H 2A6KB 2R1LA 1A9EA 4DQWA 2OYKA 1SOKA 1Q45A 3M0IA 2XG4A 1CU4H 3SDAD 3P3TA 3EJRA 3OU8A 4TF4A 3IJDA 3U79A 3CFEA 5MEQA 1AP2A 1VIWA 3DI0A 4QIUA 3MUY1 2YCEA 5BPPA 5CO1A 4P23B 2C1OB 1TMQA 5C7ZA 2EDMA 4U7KA 4LAKA 3KPMB 3G2GA 2E7LA 4K9EH 4K7PX 2SFPA 1KTLB 4JIHA 1YUHB 3QJSB 1KYAA 1P7KB 1VYPX 5GGRB 5L7XH 3T0BA 2EG6A 4O5LL 4MKNA 4WSKA 5HP5A 5I0YA 5C0NC 5CBAB 1XTLA 4DKTA 1HUVA 4GP5B 2BJML 4JTAA 3GTHA 1LVEA 1EC8A 3VYPA 1D3CA 2D22A 4NO0D 4YDKL 2FQGA 1UB5A 1YPXA 1GPWA 3DCPA 1ITCA 1WRFA 1GW1A 1F41A 3WDPP 1ML0A 2ISVA 4ETYA 3HPJA 3R8BB 5FA5A 1CBVH 4HD5A 2UWEE 1A80A 1MCHA 1T21A 2PPFA 4M82A 4O54A 1EXBA 1IM3D 3IGXA 4G2DA 3LA4A 5TK2A 1G4TA 1T5KA 1DWAM 1FL5A 2PTTB 2IAAC 3SJVD 2OULB 1NSJA 1RQBA 4I3RH 1JGIA 3E0WA 4YCOA 2A6DA 1AZUA 5GISL 4YCPA 3RJXA 3BAJA 4MMWA 2NYYD 4HJUA 4RNLA 3V0VA 2VZUA 4QHKI 4F2EA 3CUIA 5H1WA 5F1SA 4PJHE 3O4LD 4G8IB 1OT4A 4M6NH 3QJAA 2N59A 1W5NA 5D2LA 3FN0H 2CUAA 3WY4A 2YD0A 4O02B 3H8AA 4CQDA 4AIUA 3QOMA 4WNQB 1INEL 4OQ1A 4WO4D 4GCXA 3ML8A 4I2XA 1OY3B 1NP2A 3TW7A 1ORQB 2D03L 2UVEA 1IRAY 5IB3B 3STLA 3FUJA 2G2RB 3FAXA 2IG2L 2GK0B 3FOLA 4Y4HA 3ZE0E 4BKSC 3CXHJ 1S9XB 1HN1A 1E2ZA 3VNKA 2HKFL 2X2IA 3GC3A 1GZ1A 2XHYA 4ENZA 4D9LL 3MV9E 4N1HB 2ZKHL 4L3CB 4DF0A 3HF3A 3HPLA 3SHSA 4AEFA 1NDWA 5CPOA 3RVWC 1EO8H 5HTSA 5EBWB 4AL8C 4CRPA 1V7NH 4LDLB 3L1GA 5LGXA 3B2XA 5HBFA 1ZALA 3OKLA 3MJMA 5ICZA 3AZTA 5BVPL 3WTYA 1QQDA 2YK1L 2PYEB 2ZUYA 1HAUA 2E22A 4O4YH 4PRIA 3DPBA 3MLZH 2PU0A 3BKJL 5HQEA 1XLEA 2CNCA 3IDJB 4C6MA 4YLCA 1BQLL 1E27B 3DKHA 5ID0A 1UWTA 3OXRA 4KFMA 1BD2E 4H1LB 4XZNX 3CIQA 4R83A 4UM9A 1ZPLA 1KLFB 4HNTA 3EHBB 5IDZA 3QUXA 2A6JA 5C0EB 1OHLA 3ARBD 5KSUA 4BK5C 4AKOA 3BP5A 1WFUA 3WENA 3ZN6A 2VITB 3MACL 3CDZA 2J72A 4I87A 5IVZB 4HSCX 4LSRL 3SY8A 2P44B 2B4GA 4ECLA 1U8OA 2VUKA 4JD4A 5E51A 2E8YA 4JM2A 2P8MA 1OTUC 1LILA 5HVWA 1G69A 4W85A 4NSBA 5JHMA 1BZQK 3USBA 3T65A 5EV7A 1EJXC 4IOSA 3ELAT 3QDAA 2X05A 1YQVH 3BVTA 2ATKB 5KJ7E 1MEXL 1PG7H 2WXLA 3KPNA 1KRBC 1SJCA 3ETBJ 1V27A 3QQ9C 4KKRA 5EO1A 3X3YA 3IUIA 4WV1A 1EAPB 1VGKA 5CZJA 4OWGA 3VI3E 2Y23A 3HJEA 1ASPA 3IDMB 1FGVL 3GI9L 3BZEA 4I0PA 1WNOA 2Z4QB 3P3BA 3CBJB 1XAKA 1XIWA 3CO8A 2CHXA 3S5ZA 3MRBA 4CKVX 4WY0F 4H1LG 1E4XI 1H0IA 2VSCA 3V10A 2GABA 3NT0A 3O2WL 3C6LC 3Q45A 3T2PA 3V6ZA 3VFNB 3ALWA 4XOBA 4S3GA 4ACZB 2MNRA 4XRCB 4BUQA 1X7FA 3D50A 4K0OA 1J8HB 4NJAL 5HI3C 1ZLVH 4L8DB 1RI8A 5AEAA 3OKNB 2DQHH 4PN6A 3HI7A 3V35A 1XZWA 2JCWA 4PBVC 1LT7A 1XSJA 1KBWA 5K39B 4X7SH 3IAPA 4R9XA 5LIKX 1E8WA 4JTQA 3N1PC 3SE3C 3LCXA 1MQRA 4KH9A 1S5HB 3TWYA 2OFQA 3KOXA 1I7ZB 5B39B 4OJYA 2I07A 1HKLL 1FQ9C 3CHXA 3WJXA 3P11H 2A0LD 1G7QA 3TJHC 3LNDA 3NZ8A 2OEMA 2UYLA 4JKNA 4GKLA 3DURB 1WQVT 3VFMB 3WIHA 5XIMA 4S3JA 2JI3A 1OFBA 4F1ZA 1BYDA 1G84A 3RU6A 3K13A 4J3BA 2MCMA 3P9MA 4FFZA 3BH4A 4GW1A 4PJDE 1DLHB 1KC5H 1ES0A 4UBPC 4AD4A 3OGCB 3HN8A 2GSGA 4P2OC 3MLSL 4KKBC 2N0KA 1DJZA 3WXWH 2X1RA 4NZUL 3TR9A 1U91A 4MMXC 1DBAL 5EA0H 5EBMB 1JD7A 1IM9B 1AVKA 3WQCA 4EJ1C 1VRDA 3FONB 3UGUA 2BX7A 4MLIA 2GJ6D 5AFDA 4MJMA 2Z8WC 4PPTA 1FL3A 2PXYA 3WJSA 2GJZA 3F2LA 3MRLA 5DRIA 2GW5A 3QUGA 4XD3A 3VO0A 4WU7A 1D5IH 5I66B 1EHNA 2V9DA 2NXYD 1LUCB 3QQDB 1XMEB 1UB3A 3LKOB 1WAAF 5IW3A 3CCHB 3PGCB 4R7DA 3QCVL 1J6OA 1L6WA 2P0IA 4KVNH 4UU9A 2XIMA 2O6DA 5FYKH 4Q9RL 4MPKA 4F7TA 1MW3A 4TQIA 1PVNA 3E2QA 1ADOA 3CMOL 4BS0A 2AS5M 4Z7VE 1SW3A 4KJQD 1FI8C 1CWYA 4FG6D 3OB8A 5I1KL 3MBEC 3LH2L 2BVWA 4TSBH 5CUSL 4XZWA 4QTHB 4JO5A 3QP3A 1ACZA 3H7BB 5C7VA 1HQ4B 3CDCA 5J6SA 1J79A 2QAPA 1W1VA 2X88A 15C8H 1DE4B 5GGSA 5CLYA 3S4BA 4ZTXA 4KFOA 2WVSA 1G7MB 3NZ1A 2XV3A 4FZEL 4Y9BA 4TXVB 1T22A 2R0KH 2GQHA 2X4TB 1XIIA 3EIFA 3P8IA 3VH8G 2WWMC 4M7KH 1LRNA 4I18C 4UFKA 4HDIB 5AZEH 5C9XA 3ZT7A 1EMTL 1G0XA 4LCCA 4MNMA 4NP7A 4UBDD 3WIHH 4E42B 4K71B 4AYFB 4XH2A 1CVSC 4XVJL 3G9AB 1R2SA 4ODWB 1ESWA 5F0MB 2SEBA 1A6WL 5E8EB 3GC4A 4FFZH 3USZA 3RFAA 2QNEA 4ZS7L 1QNZH 5MENE 1A2YB 1S7RB 3D87B 5F9JA 4J28A 1BQHA 2DLEA 5FEPA 5K1JA 4AEHL 4PREA 4X4ME 4DETA 4QNWA 1SXBA 3EBVA 3OAWA 2QKSA 2TRYA 3AQUA 3UY8A 1LO2L 2CLRA 4H7ZA 4F5CE 3P3UA 3FTGA 1G94A 2ZWKA 2XY1A 2DQDL 2NX5B 1OCBA 3D5OF 4LQFL 4HK7A 3U48A 1KFAL 4Y16B 4G42A 1OVDA 4MCZA 2P5WA 3QG0A 3AXIA 1W3IA 5G2HA 1EPXA 4B15A 4MJ5A 3FQNA 3GIZL 5LKYA 4Q8VA 3EGDA 4K3AA 4B41A 3INUH 3IPFA 3HG4A 4GRLB 3W85A 3WLWC 5F1NB 1CE6B 2PRMA 1JNNH 3KVKA 4JR5A 2YPKA 4FQXD 2PF8A 3RRQA 3PNWB 2C15A 1JWUB 2V9QA 3I50H 5IROD 3VI4B 4DGYL 4BK5A 4HA3A 5G5DA 4IBSA 4PJEF 5HOSA 1ZDQA 2J9YA 4KK6D 5EPDA 3LEVH 1AXIB 1I0BA 4I5BB 1I9IL 3GXNA 2L4OA 5J6GB 1A7OL 1CZ8L 1R3TA 5KVDL 1O6TA 1R3HA 1KJVA 3NQIA 4YE4L 3BHBB 2BXZA 4MSSA 3CDGB 4PRDB 1J8SA 1EGJL 1LT8A 3BEWA 25C8L 1KM3A 1OFRA 2VLRA 3K6OA 3M5VA 1RJLA 3HW7A 2B9BA 3BZ4A 4O2EB 1P0NA 5IY5B 4N6FA 2GJ6E 1N7ML 1H6EA 1K9FA 1JRQA 5JORB 4H9ZA 1BBDH 1W15A 4JFOA 1BXBA 3TSDA 5FF7A 1AD0B 5K1VA 4F48A 3ECBA 3NEVA 4XAYA 4K8RD 3ORWA 4GUCA 1XQLA 2CLVA 4KKCD 3P6LA 3O41B 3B0XA 2GVLA 3CFMA 4BZGA 3QUZC 1BJMA 4JE0A 2IOOA 4L4VA 4W9FC 4FHKA 3BZFB 3OKDA 4FAMA 1LEKA 3VG9C 3FZUC 4W70A 1ND0A 3CVHB 3N43B 4PCSA 5JTWA 3QZEA 2VAJA 3DYPA 5DYFA 5EBUA 3L67A 5AYIA 4YHLH 1XG4A 4QUOA 3CH0A 4RE4A 1DYZA 3P7YA 1HHJB 4DPRA 4P2QA 4DEUA 1AGCB 2Y88A 5E8NA 3IACA 5F9DC 1UJ3C 5AB1A 4PE8A 4PJFE 4S1RL 4X99B 4GD0A 2A73A 1HL2A 4U0RC 3H7RA 1RUPL 3IGAB 4GSUA 2J57A 3X1GA 1KB9K 4NT6B 3DJ9A 5AVSB 3UJJL 2VR2A 4L9DA 3MP3A 4IJBA 4H26A 3F12B 5DDHB 1XH1A 2XFRA 1HHHA 4ZXBB 3C5XA 1MCEA 4LOUD 4X0VA 1C8YA 5HAOA 3BGMA 3GZQA 4RLDA 3V7AE 1EUNA 5E8OB 3UYRL 1A0QH 4DK3A 3VGGA 3UZXA 3Q8CA 2D7OA 3DFHA 3TASA 3RNKA 2XWTB 3D3VB 4KY2A 3OKKA 3NTYA 3NXFA 1L7TH 3VA8A 3MNVB 3FY1A 3S37H 2Q20A 3PBWA 2W81C 1AO7B 1V54B 5J12C 1R3JA 1CPUA 3RUGB 4OF6A 4DTGL 1YYMH 4PBGA 4NUMA 1IVXA 2FEEI 4JZOB 4WSGA 4HGKC 2Q8AL 3UO1L 3NN8A 3QDMA 4CAGA 3DTXB 5J3HD 3LBMA 4MCYA 4R2GD 4AMKL 4KTYA 4KTDL 3ZT5A 1RY7B 2PDYA 1CE1H 3CLFL 1Q7ZA 1OQFA 1XM3A 2OCJA 3MPHA 4WWKC 3NJKA 2GJLA 1H2JA 4BSJA 2M8XA 4GYBA 5EZIL 2Q8BH 2J62A 4U3AA