1NSZA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGNVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 100
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nszA00
3DCDA 1JOVA 1OJPA 2WZSA 3T2OA 1F1SA 1JYVA 1NKGA 1NS8A 1NSRA 4BZFA 2CISA 3IMHA 2WW1A 3E1F1 1J0NA 2HTAA 3NJVA 2HTBA 1NSVA 1NS0A 1PX3A 2WVXA 1N7RA 4DUXA 3BGAA 3T2PA 2WW0A 1RWFA 1OJMA 4RNLA 2E24A 1NS7A 1CB8A 3VDBA 1MMUA 1OJNA 1N7PA 3CZJA 1EGUA 1L7JA 1L7KA 2WCOA 1JZ7A 1LF9A 1W3YA 3Q1NA 1OJOA 2JKPA 1JYNA 1N7OA 1RWCA 1X1JA 3I3DA 4DUWA 1JZ3A 4DUVA 1K1XA 2XSGA 3VD9A 3VD7A 2BRWA 1NSXA 1MMZA 3OS7A 1N7QA 2X03A 1YQ2A 1NSSA 1JZ2A 3ECQA 3J7HA 2CIQA 1SNZA 1NSMA 1RWGA 1JYWA 1F4AA 2WVYA 2XHNA 3VD4A 3NJXA 1LXKA 2WW2A 1HM3A 1NS2A 3VDAA 3T0BA 3MUY1 3VDCA 1RW9A 3DYPA 3T0AA 1JZ6A 1X1HA 2JKEA 3K25A 1MN0A 3WFAA 1PX4A 3VD5A 4BZGA 3DECA 1TXKA 1DP0A 3VD3A 3OB8A 1LXMA 3T0DA 1JYXA 1J0MA 1HN0A 1HN1A 2WDAA 1K1WA 1LF6A 2ZQ0A 1K1YA 3NREA 2BRVX 1HM2A 1YGAA 3IAQA 3T09A 1RWHA 1NS4A 3DYMA 1X1IA 3I3BA 2BRPA 2WVXB 4BZHA 3DYOA 1NSUA 2Q1FA 1UG9A 1HMUA 3IAPA 5E1QA 1MMXA 2WW3A 3SEPA 4AQ0A 4TTGA 1RWAA 3MWXA 3T2QA 1Z45A 1JZ8A 2D73A 5A1AA 1N7NA 2E22A 2CIRA 3MUZ1 4BZEA 1F9GA 1MMYA 1SO0A 3T08A 1NSZA 1F4HA 1LOHA 2WVZA 3OBAA 1JZ4A 1JZ5A 2JKAA 1LURA 3A24A 1HMWA 1I8QA 3I3EA 1C82A 3MV01 1ULVA 2ZXQA 3MV11
chains in the Genus database with same CATH superfamily
3DCDA 1JOVA 2WZSA 3T2OA 3S4BA 3S4DA 1IVVA 1NKGA 1JYVA 1HTYA 2CWVA 1NSRA 3IMHA 2HTBA 3W7WA 1NSVA 1PX3A 3BVTA 3TY1A 1R34A 1DYUA 1RWFA 2E24A 5JMDA 3AFLA 4FNRA 1NS7A 1MMUA 2F1BA 3CZJA 3EJRA 2E2TA 1JZ7A 1H54A 3EJUA 1OJOA 3WVFA 3HI7A 1TU5A 3K5TA 3X3YA 2Y74A 1MMZA 3D50A 3AMOA 2X03A 2D1WA 1SIIA 1JZ2A 3BVWA 3ECQA 3J7HA 1F4AA 2XHNA 2F7RA 4OK4A 1O7DD 1LXKA 2F18A 2WW2A 3NJXA 2E2UA 3WIQA 1RKYA 4KFEA 3VDCA 3DYPA 1V7XA 1X1HA 2YFNA 1HXKA 3N9HA 1R33A 1MN0A 3WFAA 3VD5A 3DECA 3X41A 1UI7A 1TQVA 2XN0A 1LXMA 1HN0A 2Y73A 1EKMA 1K1WA 3E80A 5KBPA 1TQTA 2WO0A 1W2ZA 1YGAA 1NS4A 2WOHA 3I3BA 4BZHA 4KFFA 5JMFA 2Q1FA 3SEPA 2CFLA 1MMXA 5E1QA 1RWAA 3BVXA 2CQSA 3D3IA 3WA3A 2CIRA 4BZEA 1MMYA 2CFDA 2WVZA 2CG1A 3X42A 1JZ4A 1JZ5A 3VSNA 1HMWA 3D52A 3NBBA 1ULVA 3DX1A 1IVUA 2C10A 2XN1A 4KFDA 1V7WA 3BUPA 3E1F1 3BS6A 2WVXA 1D6ZA 4FNSA 2WW0A 1W6GA 4UFCA 2BT3A 3EJQA 3EJSA 3BUIA 1CB8A 2YX9A 3CZSA 1TQWA 1LF9A 1AVLA 3NBJA 1N7OA 4DUVA 2BRWA 3OS7A 4MMHA 1YQ2A 1NSSA 4BTWA 2EACA 2F1AA 2CIQA 3SX1A 2YFOA 2CG0A 3W7SA 1HM3A 3VDAA 4EV2A 3T0BA 1V7VA 3T0AA 1US1A 1PX4A 1WMPA 1JYXA 2ZQ0A 1K1YA 3S4AA 3IAQA 1IVWA 1D6YA 3DYMA 3DYOA 1HWWA 3IAPA 2WW3A 4TTGA 3BLBA 1JZ8A 1TQSA 1N7NA 2E22A 1W7CA 1N9EA 1SO0A 1F4HA 2XN2A 3OBAA 3W7UA 1OACA 3MPHA 4OJZA 3EJTA 4K3AA 1UI8A 2ALWA 4FNQA 1I8QA 1C82A 3BUDA 3MV01 3AMOB 3MV11 1AV4A 3X3XA 1JRQA 3BVUA 3QFZA 4BZFA 4K35A 1J0NA 2HTAA 3NJVA 2CFWA 1NS0A 1SPUA 3W7TA 3BUBA 1W5ZA 3BGAA 3T2PA 1WMOA 1OJMA 1PS3A 1QAFA 3HIGA 4KTPA 4RNLA 1N7PA 1OJNA 1A2VA 1EGUA 1L7JA 1L7KA 4FNUA 1W3YA 2E2VA 3Q1NA 2F7OA 3T0UA 1X1JA 3I3DA 2FUQA 1K1XA 1NSXA 1N7QA 4KTRA 1RWGA 3MI6A 1TQUA 1IVXA 3VD4A 1WMNA 1W4NA 1NS2A 3ACTA 3KN4A 3CZNA 3MUY1 1RW9A 1PU4A 1QX1A 2EAEA 1JZ6A 2JKEA 3WIRA 2RDYA 3K25A 4BZGA 1TXKA 3ALAA 1DP0A 3VD3A 3DX4A 2CQTA 2OW7A 3ACSA 2WDAA 1LF6A 2FYVA 3WA2X 3T09A 4J5TA 1RJOA 1RWHA 4OK2A 2WVXB 1UG9A 4EV5A 1HMUA 4BTXA 3D51A 2OQEA 1Z45A 2D73A 1QWNA 5A1AA 2WYIA 3MUZ1 3HIIA 1LOHA 3EJPA 5GW7A 3X3ZA 2JKAA 3BVVA 3A24A 2F7QA 3LVTA 4FNVA 2C11A 3DX0A 2ZXQA 3A0OA 2WGQA 1OJPA 1F1SA 3QG0A 2EADA 4MMIA 1NS8A 3DX3A 4FNPA 2CISA 2WW1A 1IQXA 2OQEC 1QWUA 3W7XA 1N7RA 3S4CA 3LOYA 4DUXA 1D6UA 3PGBA 3RRSA 3RSYA 4BTYA 3DX2A 1IQYA 2FUTA 1LVNA 4NEIA 3VDBA 2WCOA 3D4YA 3VSMA 3X40A 1SIHA 2JKPA 1JYNA 2WYHA 1RWCA 4DUWA 1JZ3A 3CV5A 3VD9A 2CFGA 2XSGA 3VD7A 3BLCA 4FNTA 1JYWA 1SNZA 1NSMA 2PNCA 2WOFA 1AVKA 2WVYA 2CFKA 5CA3A 3AFJA 2CWUA 3BUQA 2W0QA 3SXXA 1QAKA 2OOVA 3KIIA 2CWTA 3OB8A 3DDFA 2ZL8A 3E7JA 3T0DA 2EABA 1J0MA 1HN1A 3NREA 1KSIA 2BRVX 1IU7A 1HM2A 1QALA 3QDEA 1X1IA 2BRPA 1NSUA 3QFYA 4AQ0A 3MWXA 3T2QA 3DDGA 1W6CA 2F7PA 1F9GA 3D4ZA 3T08A 1NSZA 2OOVC 2OW6A 1LURA 3I3EA
chains in the Genus database with same CATH topology
3DCDA 1JOVA 3A0OA 1OJPA 2WZSA 3T2OA 1F1SA 1JYVA 1NKGA 4MMIA 1NS8A 1NSRA 4BZFA 2CISA 3IMHA 2WW1A 3E1F1 1J0NA 2HTAA 3NJVA 3BS6A 2HTBA 1NSVA 1NS0A 1PX3A 2WVXA 1N7RA 4DUXA 3TY1A 3BGAA 3T2PA 2WW0A 1RWFA 1OJMA 4RNLA 2E24A 5JMDA 2FUTA 3AFLA 1NS7A 1CB8A 4NEIA 1MMUA 1OJNA 1N7PA 3CZJA 3VDBA 1EGUA 1L7JA 1L7KA 2WCOA 1JZ7A 1LF9A 1W3YA 3VSMA 3Q1NA 1OJOA 2JKPA 1JYNA 3WVFA 1N7OA 1RWCA 1X1JA 2FUQA 3I3DA 4DUWA 4DUVA 1K1XA 2XSGA 1JZ3A 3VD7A 2BRWA 1NSXA 3BLCA 1MMZA 3OS7A 4MMHA 1N7QA 2X03A 1YQ2A 1NSSA 1JZ2A 3ECQA 3J7HA 2CIQA 1SNZA 1NSMA 1RWGA 1JYWA 1F4AA 2WVYA 2XHNA 4OK4A 3VD4A 3NJXA 1LXKA 2WW2A 1HM3A 1NS2A 3VDAA 3T0BA 3MUY1 3VDCA 1RW9A 3DYPA 3T0AA 1JZ6A 1X1HA 2JKEA 3K25A 1MN0A 3WFAA 1PX4A 3VD5A 4BZGA 3DECA 1TXKA 1DP0A 3VD3A 3OB8A 1LXMA 3E7JA 3T0DA 1JYXA 1J0MA 1HN0A 1HN1A 2WDAA 1K1WA 3E80A 2ZQ0A 1LF6A 1K1YA 3NREA 2BRVX 1HM2A 1YGAA 3IAQA 3T09A 4J5TA 1RWHA 4OK2A 1NS4A 3DYMA 1X1IA 3I3BA 2BRPA 2WVXB 4BZHA 3DYOA 1NSUA 5JMFA 2Q1FA 1UG9A 1HMUA 3IAPA 5E1QA 1MMXA 2WW3A 3SEPA 4AQ0A 4TTGA 1RWAA 3MWXA 3T2QA 1Z45A 1JZ8A 2D73A 5A1AA 1N7NA 2E22A 2CIRA 3MUZ1 4BZEA 1F9GA 1MMYA 1SO0A 3T08A 1NSZA 1F4HA 1LOHA 2WVZA 3OBAA 1JZ4A 1JZ5A 2JKAA 4OJZA 1LURA 3A24A 3VSNA 1HMWA 1I8QA 3VD9A 3I3EA 4FNVA 1C82A 3MV01 1ULVA 2ZXQA 3MV11
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCD A;  1JOV A;  1OJP A;  2WZS A;  3T2O A;  1F1S A;  1JYV A;  1NKG A;  1NS8 A;  1NSR A;  4BZF A;  2CIS A;  3IMH A;  2WW1 A;  3E1F 1;  1J0N A;  2HTA A;  3NJV A;  2HTB A;  1NSV A;  1NS0 A;  1PX3 A;  2WVX A;  1N7R A;  4DUX A;  3BGA A;  3T2P A;  2WW0 A;  1RWF A;  1OJM A;  4RNL A;  2E24 A;  1NS7 A;  1CB8 A;  3VDB A;  1MMU A;  1OJN A;  1N7P A;  3CZJ A;  1EGU A;  1L7J A;  1L7K A;  2WCO A;  1JZ7 A;  1LF9 A;  1W3Y A;  3Q1N A;  1OJO A;  2JKP A;  1JYN A;  1N7O A;  1RWC A;  1X1J A;  3I3D A;  4DUW A;  1JZ3 A;  4DUV A;  1K1X A;  2XSG A;  3VD9 A;  3VD7 A;  2BRW A;  1NSX A;  1MMZ A;  3OS7 A;  1N7Q A;  2X03 A;  1YQ2 A;  1NSS A;  1JZ2 A;  3ECQ A;  3J7H A;  2CIQ A;  1SNZ A;  1NSM A;  1RWG A;  1JYW A;  1F4A A;  2WVY A;  2XHN A;  3VD4 A;  3NJX A;  1LXK A;  2WW2 A;  1HM3 A;  1NS2 A;  3VDA A;  3T0B A;  3MUY 1;  3VDC A;  1RW9 A;  3DYP A;  3T0A A;  1JZ6 A;  1X1H A;  2JKE A;  3K25 A;  1MN0 A;  3WFA A;  1PX4 A;  3VD5 A;  4BZG A;  3DEC A;  1TXK A;  1DP0 A;  3VD3 A;  3OB8 A;  1LXM A;  3T0D A;  1JYX A;  1J0M A;  1HN0 A;  1HN1 A;  2WDA A;  1K1W A;  1LF6 A;  2ZQ0 A;  1K1Y A;  3NRE A;  2BRV X;  1HM2 A;  1YGA A;  3IAQ A;  3T09 A;  1RWH A;  1NS4 A;  3DYM A;  1X1I A;  3I3B A;  2BRP A;  2WVX B;  4BZH A;  3DYO A;  1NSU A;  2Q1F A;  1UG9 A;  1HMU A;  3IAP A;  5E1Q A;  1MMX A;  2WW3 A;  3SEP A;  4AQ0 A;  4TTG A;  1RWA A;  3MWX A;  3T2Q A;  1Z45 A;  1JZ8 A;  2D73 A;  5A1A A;  1N7N A;  2E22 A;  2CIR A;  3MUZ 1;  4BZE A;  1F9G A;  1MMY A;  1SO0 A;  3T08 A;  1NSZ A;  1F4H A;  1LOH A;  2WVZ A;  3OBA A;  1JZ4 A;  1JZ5 A;  2JKA A;  1LUR A;  3A24 A;  1HMW A;  1I8Q A;  3I3E A;  1C82 A;  3MV0 1;  1ULV A;  2ZXQ A;  3MV1 1; 
#chains in the Genus database with same CATH topology
 3DCD A;  1JOV A;  2WZS A;  3T2O A;  3S4B A;  3S4D A;  1IVV A;  1NKG A;  1JYV A;  1HTY A;  2CWV A;  1NSR A;  3IMH A;  2HTB A;  3W7W A;  1NSV A;  1PX3 A;  3BVT A;  3TY1 A;  1R34 A;  1DYU A;  1RWF A;  2E24 A;  5JMD A;  3AFL A;  4FNR A;  1NS7 A;  1MMU A;  2F1B A;  3CZJ A;  3EJR A;  2E2T A;  1JZ7 A;  1H54 A;  3EJU A;  1OJO A;  3WVF A;  3HI7 A;  1TU5 A;  3K5T A;  3X3Y A;  2Y74 A;  1MMZ A;  3D50 A;  3AMO A;  2X03 A;  2D1W A;  1SII A;  1JZ2 A;  3BVW A;  3ECQ A;  3J7H A;  1F4A A;  2XHN A;  2F7R A;  4OK4 A;  1O7D D;  1LXK A;  2F18 A;  2WW2 A;  3NJX A;  2E2U A;  3WIQ A;  1RKY A;  4KFE A;  3VDC A;  3DYP A;  1V7X A;  1X1H A;  2YFN A;  1HXK A;  3N9H A;  1R33 A;  1MN0 A;  3WFA A;  3VD5 A;  3DEC A;  3X41 A;  1UI7 A;  1TQV A;  2XN0 A;  1LXM A;  1HN0 A;  2Y73 A;  1EKM A;  1K1W A;  3E80 A;  5KBP A;  1TQT A;  2WO0 A;  1W2Z A;  1YGA A;  1NS4 A;  2WOH A;  3I3B A;  4BZH A;  4KFF A;  5JMF A;  2Q1F A;  3SEP A;  2CFL A;  1MMX A;  5E1Q A;  1RWA A;  3BVX A;  2CQS A;  3D3I A;  3WA3 A;  2CIR A;  4BZE A;  1MMY A;  2CFD A;  2WVZ A;  2CG1 A;  3X42 A;  1JZ4 A;  1JZ5 A;  3VSN A;  1HMW A;  3D52 A;  3NBB A;  1ULV A;  3DX1 A;  1IVU A;  2C10 A;  2XN1 A;  4KFD A;  1V7W A;  3BUP A;  3E1F 1;  3BS6 A;  2WVX A;  1D6Z A;  4FNS A;  2WW0 A;  1W6G A;  4UFC A;  2BT3 A;  3EJQ A;  3EJS A;  3BUI A;  1CB8 A;  2YX9 A;  3CZS A;  1TQW A;  1LF9 A;  1AVL A;  3NBJ A;  1N7O A;  4DUV A;  2BRW A;  3OS7 A;  4MMH A;  1YQ2 A;  1NSS A;  4BTW A;  2EAC A;  2F1A A;  2CIQ A;  3SX1 A;  2YFO A;  2CG0 A;  3W7S A;  1HM3 A;  3VDA A;  4EV2 A;  3T0B A;  1V7V A;  3T0A A;  1US1 A;  1PX4 A;  1WMP A;  1JYX A;  2ZQ0 A;  1K1Y A;  3S4A A;  3IAQ A;  1IVW A;  1D6Y A;  3DYM A;  3DYO A;  1HWW A;  3IAP A;  2WW3 A;  4TTG A;  3BLB A;  1JZ8 A;  1TQS A;  1N7N A;  2E22 A;  1W7C A;  1N9E A;  1SO0 A;  1F4H A;  2XN2 A;  3OBA A;  3W7U A;  1OAC A;  3MPH A;  4OJZ A;  3EJT A;  4K3A A;  1UI8 A;  2ALW A;  4FNQ A;  1I8Q A;  1C82 A;  3BUD A;  3MV0 1;  3AMO B;  3MV1 1;  1AV4 A;  3X3X A;  1JRQ A;  3BVU A;  3QFZ A;  4BZF A;  4K35 A;  1J0N A;  2HTA A;  3NJV A;  2CFW A;  1NS0 A;  1SPU A;  3W7T A;  3BUB A;  1W5Z A;  3BGA A;  3T2P A;  1WMO A;  1OJM A;  1PS3 A;  1QAF A;  3HIG A;  4KTP A;  4RNL A;  1N7P A;  1OJN A;  1A2V A;  1EGU A;  1L7J A;  1L7K A;  4FNU A;  1W3Y A;  2E2V A;  3Q1N A;  2F7O A;  3T0U A;  1X1J A;  3I3D A;  2FUQ A;  1K1X A;  1NSX A;  1N7Q A;  4KTR A;  1RWG A;  3MI6 A;  1TQU A;  1IVX A;  3VD4 A;  1WMN A;  1W4N A;  1NS2 A;  3ACT A;  3KN4 A;  3CZN A;  3MUY 1;  1RW9 A;  1PU4 A;  1QX1 A;  2EAE A;  1JZ6 A;  2JKE A;  3WIR A;  2RDY A;  3K25 A;  4BZG A;  1TXK A;  3ALA A;  1DP0 A;  3VD3 A;  3DX4 A;  2CQT A;  2OW7 A;  3ACS A;  2WDA A;  1LF6 A;  2FYV A;  3WA2 X;  3T09 A;  4J5T A;  1RJO A;  1RWH A;  4OK2 A;  2WVX B;  1UG9 A;  4EV5 A;  1HMU A;  4BTX A;  3D51 A;  2OQE A;  1Z45 A;  2D73 A;  1QWN A;  5A1A A;  2WYI A;  3MUZ 1;  3HII A;  1LOH A;  3EJP A;  5GW7 A;  3X3Z A;  2JKA A;  3BVV A;  3A24 A;  2F7Q A;  3LVT A;  4FNV A;  2C11 A;  3DX0 A;  2ZXQ A;  3A0O A;  2WGQ A;  1OJP A;  1F1S A;  3QG0 A;  2EAD A;  4MMI A;  1NS8 A;  3DX3 A;  4FNP A;  2CIS A;  2WW1 A;  1IQX A;  2OQE C;  1QWU A;  3W7X A;  1N7R A;  3S4C A;  3LOY A;  4DUX A;  1D6U A;  3PGB A;  3RRS A;  3RSY A;  4BTY A;  3DX2 A;  1IQY A;  2FUT A;  1LVN A;  4NEI A;  3VDB A;  2WCO A;  3D4Y A;  3VSM A;  3X40 A;  1SIH A;  2JKP A;  1JYN A;  2WYH A;  1RWC A;  4DUW A;  1JZ3 A;  3CV5 A;  3VD9 A;  2CFG A;  2XSG A;  3VD7 A;  3BLC A;  4FNT A;  1JYW A;  1SNZ A;  1NSM A;  2PNC A;  2WOF A;  1AVK A;  2WVY A;  2CFK A;  5CA3 A;  3AFJ A;  2CWU A;  3BUQ A;  2W0Q A;  3SXX A;  1QAK A;  2OOV A;  3KII A;  2CWT A;  3OB8 A;  3DDF A;  2ZL8 A;  3E7J A;  3T0D A;  2EAB A;  1J0M A;  1HN1 A;  3NRE A;  1KSI A;  2BRV X;  1IU7 A;  1HM2 A;  1QAL A;  3QDE A;  1X1I A;  2BRP A;  1NSU A;  3QFY A;  4AQ0 A;  3MWX A;  3T2Q A;  3DDG A;  1W6C A;  2F7P A;  1F9G A;  3D4Z A;  3T08 A;  1NSZ A;  2OOV C;  2OW6 A;  1LUR A;  3I3E A; 
#chains in the Genus database with same CATH homology
 3DCD A;  1JOV A;  3A0O A;  1OJP A;  2WZS A;  3T2O A;  1F1S A;  1JYV A;  1NKG A;  4MMI A;  1NS8 A;  1NSR A;  4BZF A;  2CIS A;  3IMH A;  2WW1 A;  3E1F 1;  1J0N A;  2HTA A;  3NJV A;  3BS6 A;  2HTB A;  1NSV A;  1NS0 A;  1PX3 A;  2WVX A;  1N7R A;  4DUX A;  3TY1 A;  3BGA A;  3T2P A;  2WW0 A;  1RWF A;  1OJM A;  4RNL A;  2E24 A;  5JMD A;  2FUT A;  3AFL A;  1NS7 A;  1CB8 A;  4NEI A;  1MMU A;  1OJN A;  1N7P A;  3CZJ A;  3VDB A;  1EGU A;  1L7J A;  1L7K A;  2WCO A;  1JZ7 A;  1LF9 A;  1W3Y A;  3VSM A;  3Q1N A;  1OJO A;  2JKP A;  1JYN A;  3WVF A;  1N7O A;  1RWC A;  1X1J A;  2FUQ A;  3I3D A;  4DUW A;  4DUV A;  1K1X A;  2XSG A;  1JZ3 A;  3VD7 A;  2BRW A;  1NSX A;  3BLC A;  1MMZ A;  3OS7 A;  4MMH A;  1N7Q A;  2X03 A;  1YQ2 A;  1NSS A;  1JZ2 A;  3ECQ A;  3J7H A;  2CIQ A;  1SNZ A;  1NSM A;  1RWG A;  1JYW A;  1F4A A;  2WVY A;  2XHN A;  4OK4 A;  3VD4 A;  3NJX A;  1LXK A;  2WW2 A;  1HM3 A;  1NS2 A;  3VDA A;  3T0B A;  3MUY 1;  3VDC A;  1RW9 A;  3DYP A;  3T0A A;  1JZ6 A;  1X1H A;  2JKE A;  3K25 A;  1MN0 A;  3WFA A;  1PX4 A;  3VD5 A;  4BZG A;  3DEC A;  1TXK A;  1DP0 A;  3VD3 A;  3OB8 A;  1LXM A;  3E7J A;  3T0D A;  1JYX A;  1J0M A;  1HN0 A;  1HN1 A;  2WDA A;  1K1W A;  3E80 A;  2ZQ0 A;  1LF6 A;  1K1Y A;  3NRE A;  2BRV X;  1HM2 A;  1YGA A;  3IAQ A;  3T09 A;  4J5T A;  1RWH A;  4OK2 A;  1NS4 A;  3DYM A;  1X1I A;  3I3B A;  2BRP A;  2WVX B;  4BZH A;  3DYO A;  1NSU A;  5JMF A;  2Q1F A;  1UG9 A;  1HMU A;  3IAP A;  5E1Q A;  1MMX A;  2WW3 A;  3SEP A;  4AQ0 A;  4TTG A;  1RWA A;  3MWX A;  3T2Q A;  1Z45 A;  1JZ8 A;  2D73 A;  5A1A A;  1N7N A;  2E22 A;  2CIR A;  3MUZ 1;  4BZE A;  1F9G A;  1MMY A;  1SO0 A;  3T08 A;  1NSZ A;  1F4H A;  1LOH A;  2WVZ A;  3OBA A;  1JZ4 A;  1JZ5 A;  2JKA A;  4OJZ A;  1LUR A;  3A24 A;  3VSN A;  1HMW A;  1I8Q A;  3VD9 A;  3I3E A;  4FNV A;  1C82 A;  3MV0 1;  1ULV A;  2ZXQ A;  3MV1 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...