1NSZA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGNVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 100
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nszA00
4DUVA 1TXKA 3MUY1 1SO0A 1F4HA 1N7PA 5E1QA 2JKAA 2CISA 1MMZA 1RW9A 1JZ3A 4BZFA 3T0AA 1ULVA 2ZQ0A 1JYXA 1I8QA 1NSXA 1UG9A 1NKGA 2WW0A 3K25A 3T2PA 3VD7A 3A24A 3DYPA 1C82A 2WVZA 1JYNA 1RWAA 1L7KA 1HM2A 3ECQA 3VDBA 1N7RA 2BRPA 2XSGA 3CZJA 1JOVA 1LF9A 3T2OA 1JYWA 1JZ6A 1K1YA 3DYMA 3VD4A 3DYOA 1X1JA 2CIQA 3NJVA 3VD5A 1YQ2A 2JKEA 1PX4A 1CB8A 1LXMA 2WCOA 3VD9A 3DECA 1MN0A 1PX3A 1YGAA 2WZSA 1RWHA 1JZ2A 1EGUA 3MV01 3IAPA 4AQ0A 2WW1A 2X03A 1HM3A 3MWXA 1LF6A 3BGAA 3SEPA 2BRVX 2E22A 1LXKA 1MMUA 2ZXQA 1K1XA 3T0DA 2WW2A 2D73A 4BZGA 1SNZA 1HN0A 1NS4A 1OJNA 1NSZA 1F9GA 5A1AA 1F4AA 1LURA 3VD3A 3IMHA 3Q1NA 1OJOA 3MV11 1JZ7A 3T0BA 3WFAA 1F1SA 1LOHA 2WVYA 3OS7A 1DP0A 1NS2A 4RNLA 3OB8A 1JZ8A 4DUWA 3I3EA 2E24A 1K1WA 1MMXA 1NS0A 2WDAA 3DCDA 2JKPA 3T08A 3VDAA 1RWFA 3OBAA 2XHNA 1NSRA 2CIRA 1N7OA 1MMYA 1HMWA 1JZ5A 3T2QA 1NSMA 1HMUA 1Z45A 2BRWA 2Q1FA 1X1HA 3IAQA 1NSVA 2WW3A 1N7NA 1OJMA 1JZ4A 3T09A 2HTBA 1N7QA 4TTGA 1NSUA 1NS7A 3E1F1 1L7JA 1NSSA 1J0NA 2HTAA 2WVXA 4BZHA 1RWCA 3VDCA 3I3DA 1RWGA 4DUXA 1OJPA 3NJXA 1W3YA 4BZEA 2WVXB 3J7HA 1JYVA 3I3BA 1X1IA 3NREA 1HN1A 1NS8A 1J0MA 3MUZ1
chains in the Genus database with same CATH superfamily
3AMOA 2F1BA 4DUVA 1TXKA 1WMOA 3MUY1 1F4HA 3S4AA 3W7XA 1RW9A 1WMPA 3T0AA 1ULVA 1NSXA 2Y74A 4BTWA 3K25A 3A24A 3DYPA 4FNUA 4KTPA 3CV5A 1JRQA 2WGQA 3RRSA 2RDYA 1L7KA 1HM2A 3VDBA 2BRPA 3T2OA 3KIIA 1PU4A 2EABA 4K35A 1K1YA 3DX1A 2CQSA 2CIQA 3VD5A 4BTYA 2YFNA 2OOVA 2WCOA 1SIIA 3DX2A 1RWHA 3EJPA 1KSIA 3K5TA 3SEPA 1UI7A 3AFJA 1V7VA 1MMUA 3T0DA 4KFDA 4BZGA 1HN0A 1LURA 3EJUA 1F1SA 1DP0A 2FYVA 1NS2A 2OQEC 3I3EA 3DX3A 2F1AA 2WDAA 1R33A 3DCDA 3T08A 3PGBA 3OBAA 2OW6A 1HTYA 3QFZA 3WA2X 3BUPA 2WYIA 1NSMA 1HMUA 2BRWA 2F7PA 2YFOA 1NSVA 3D4ZA 3LVTA 1NS7A 2F18A 1NSSA 4BZHA 2WVXA 3BVUA 4OK2A 3I3DA 1RWGA 3SX1A 2F7QA 3BUBA 3W7TA 3S4BA 3J7HA 1X1IA 2ZL8A 3MUZ1 1SO0A 2CWTA 4FNPA 1V7WA 3E80A 1AV4A 3AMOB 1JYXA 2WW0A 3S4DA 2YX9A 3ACTA 2CFGA 3BS6A 3VD7A 1LVNA 2EACA 1JYNA 3CZSA 1RKYA 1RWAA 1SIHA 3ACSA 3D3IA 1TU5A 1IU7A 1W4NA 3VSNA 1QAFA 3BUDA 3BVTA 2CFWA 3DYMA 3VD4A 3BLCA 3VD9A 1D6YA 3DECA 1MN0A 1PX3A 3HI7A 2WO0A 1JZ2A 2CG0A 3D50A 1V7XA 4FNTA 4AQ0A 2WW1A 3MWXA 3WIQA 2CQTA 4FNQA 2D73A 1SNZA 1NS4A 1NSZA 5A1AA 1TQWA 3EJQA 3IMHA 3T0BA 1IVUA 3NBJA 1QALA 2WOFA 2EAEA 4OK4A 3D51A 2W0QA 1EKMA 3NBBA 4FNSA 3BUQA 2C11A 3HIGA 3VSMA 2D1WA 1N7OA 1MMYA 3T2QA 3BVXA 2Q1FA 1X1HA 4NEIA 1W7CA 5JMDA 3X42A 1A2VA 1JZ4A 2BT3A 1N7QA 4TTGA 5GW7A 1RWCA 3D52A 4MMHA 2CFLA 1W3YA 1R34A 2WVXB 3CZNA 4EV2A 2OOVC 1JYVA 1W5ZA 1TQSA 3ALAA 1TQVA 3DDFA 5E1QA 1N7PA 2CWUA 2JKAA 2CISA 2XN0A 1MMZA 4MMIA 1JZ3A 2ZQ0A 1I8QA 1UG9A 1NKGA 3WIRA 2WVZA 1W6CA 2CWVA 2CFKA 1TQUA 2XSGA 4J5TA 1JZ6A 4KTRA 3DYOA 1IVXA 1X1JA 3NJVA 2JKEA 2Y73A 1IVVA 1LXMA 1HWWA 1W6GA 4KFEA 3EJTA 3BVWA 1YGAA 1W2ZA 1EGUA 2CFDA 3IAPA 2X03A 1HM3A 1LF6A 1O7DD 3DX4A 1D6ZA 2BRVX 2OW7A 3EJSA 3QG0A 2FUTA 3T0UA 1OJNA 1F9GA 1DYUA 3VD3A 1JZ7A 3Q1NA 3MV11 1IQXA 3E7JA 3RSYA 3WFAA 1LOHA 3X3YA 4RNLA 1JZ8A 2E24A 3BLBA 3DDGA 1MMXA 2JKPA 1RWFA 3S4CA 2XHNA 2CIRA 4OJZA 3KN4A 1SPUA 1AVKA 2XN2A 3X40A 2WW3A 1N7NA 1OJMA 1IQYA 3E1F1 1TQTA 4DUXA 1WMNA 3A0OA 3WA3A 2OQEA 1HXKA 4BZEA 2XN1A 1IVWA 1J0MA 2F7OA 1AVLA 2CG1A 3BVVA 3DX0A 1OACA 2E2UA 5JMFA 3N9HA 2EADA 2WYHA 4BZFA 3EJRA 4BTXA 3T2PA 3X3XA 3QDEA 1C82A 3ECQA 1N7RA 1QWUA 3CZJA 1JOVA 1LF9A 1JYWA 1YQ2A 1PX4A 1RJOA 1CB8A 1US1A 4K3AA 2WZSA 3TY1A 3MV01 1UI8A 3BGAA 2PNCA 2E22A 1LXKA 2ZXQA 3MPHA 1K1XA 4KFFA 2WW2A 2F7RA 1F4AA 1OJOA 2WOHA 1QAKA 3OS7A 2WVYA 3HIIA 3AFLA 2C10A 3X3ZA 3OB8A 3W7UA 4DUWA 1QWNA 4FNVA 5CA3A 1K1WA 1NS0A 1PS3A 3VDAA 1NSRA 4FNRA 4EV5A 1HMWA 1JZ5A 3MI6A 1Z45A 3LOYA 3IAQA 2FUQA 3SXXA 3X41A 3WVFA 3QFYA 3T09A 2HTBA 2E2VA 1QX1A 1NSUA 2E2TA 5KBPA 3BUIA 1L7JA 1J0NA 1D6UA 2HTAA 1H54A 3W7WA 4UFCA 3VDCA 1OJPA 1N9EA 3NJXA 3W7SA 3I3BA 3NREA 1HN1A 1NS8A 2ALWA 3D4YA
chains in the Genus database with same CATH topology
4DUVA 1TXKA 3MUY1 1SO0A 1F4HA 1N7PA 5E1QA 2JKAA 2CISA 1MMZA 1RW9A 5JMFA 4MMIA 3E80A 1JZ3A 4BZFA 3T0AA 1ULVA 2ZQ0A 1JYXA 1I8QA 1NSXA 1UG9A 1NKGA 2WW0A 3K25A 3T2PA 3BS6A 3VD7A 3A24A 3DYPA 1C82A 2WVZA 1JYNA 1RWAA 1L7KA 1HM2A 3ECQA 3VDBA 1N7RA 3VSNA 2BRPA 2XSGA 3CZJA 1JOVA 1LF9A 4J5TA 3T2OA 1JYWA 1JZ6A 1K1YA 3DYMA 3VD4A 3DYOA 3BLCA 1X1JA 2CIQA 3NJVA 3VD5A 1YQ2A 2JKEA 1PX4A 1CB8A 1LXMA 2WCOA 3VD9A 3DECA 1MN0A 1PX3A 1YGAA 2WZSA 1RWHA 1JZ2A 3TY1A 1EGUA 3MV01 3IAPA 4AQ0A 2WW1A 2X03A 1HM3A 3MWXA 1LF6A 3BGAA 3SEPA 2BRVX 2E22A 1LXKA 1MMUA 2ZXQA 1K1XA 3T0DA 2WW2A 2D73A 4BZGA 1SNZA 1HN0A 2FUTA 1NS4A 1OJNA 1NSZA 1F9GA 5A1AA 1F4AA 1LURA 3VD3A 3IMHA 3Q1NA 1OJOA 3MV11 1JZ7A 3T0BA 3E7JA 3WFAA 1F1SA 1LOHA 2WVYA 3OS7A 1DP0A 3AFLA 1NS2A 4RNLA 4OK4A 3OB8A 1JZ8A 4DUWA 4FNVA 3I3EA 2E24A 1K1WA 1MMXA 1NS0A 2WDAA 3DCDA 2JKPA 3T08A 3VDAA 1RWFA 3OBAA 2XHNA 1NSRA 3VSMA 2CIRA 4OJZA 1N7OA 1MMYA 1HMWA 1JZ5A 3T2QA 1NSMA 1HMUA 1Z45A 2BRWA 4NEIA 2Q1FA 1X1HA 3IAQA 2FUQA 1NSVA 2WW3A 3WVFA 5JMDA 1N7NA 1OJMA 1JZ4A 3T09A 2HTBA 1N7QA 4TTGA 1NSUA 1NS7A 3E1F1 1L7JA 1NSSA 1J0NA 2HTAA 2WVXA 4BZHA 1RWCA 4OK2A 3VDCA 3I3DA 1RWGA 4DUXA 1OJPA 4MMHA 3A0OA 3NJXA 1W3YA 4BZEA 2WVXB 3J7HA 1JYVA 3I3BA 1X1IA 3NREA 1HN1A 1NS8A 1J0MA 3MUZ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUV A;  1TXK A;  3MUY 1;  1SO0 A;  1F4H A;  1N7P A;  5E1Q A;  2JKA A;  2CIS A;  1MMZ A;  1RW9 A;  1JZ3 A;  4BZF A;  3T0A A;  1ULV A;  2ZQ0 A;  1JYX A;  1I8Q A;  1NSX A;  1UG9 A;  1NKG A;  2WW0 A;  3K25 A;  3T2P A;  3VD7 A;  3A24 A;  3DYP A;  1C82 A;  2WVZ A;  1JYN A;  1RWA A;  1L7K A;  1HM2 A;  3ECQ A;  3VDB A;  1N7R A;  2BRP A;  2XSG A;  3CZJ A;  1JOV A;  1LF9 A;  3T2O A;  1JYW A;  1JZ6 A;  1K1Y A;  3DYM A;  3VD4 A;  3DYO A;  1X1J A;  2CIQ A;  3NJV A;  3VD5 A;  1YQ2 A;  2JKE A;  1PX4 A;  1CB8 A;  1LXM A;  2WCO A;  3VD9 A;  3DEC A;  1MN0 A;  1PX3 A;  1YGA A;  2WZS A;  1RWH A;  1JZ2 A;  1EGU A;  3MV0 1;  3IAP A;  4AQ0 A;  2WW1 A;  2X03 A;  1HM3 A;  3MWX A;  1LF6 A;  3BGA A;  3SEP A;  2BRV X;  2E22 A;  1LXK A;  1MMU A;  2ZXQ A;  1K1X A;  3T0D A;  2WW2 A;  2D73 A;  4BZG A;  1SNZ A;  1HN0 A;  1NS4 A;  1OJN A;  1NSZ A;  1F9G A;  5A1A A;  1F4A A;  1LUR A;  3VD3 A;  3IMH A;  3Q1N A;  1OJO A;  3MV1 1;  1JZ7 A;  3T0B A;  3WFA A;  1F1S A;  1LOH A;  2WVY A;  3OS7 A;  1DP0 A;  1NS2 A;  4RNL A;  3OB8 A;  1JZ8 A;  4DUW A;  3I3E A;  2E24 A;  1K1W A;  1MMX A;  1NS0 A;  2WDA A;  3DCD A;  2JKP A;  3T08 A;  3VDA A;  1RWF A;  3OBA A;  2XHN A;  1NSR A;  2CIR A;  1N7O A;  1MMY A;  1HMW A;  1JZ5 A;  3T2Q A;  1NSM A;  1HMU A;  1Z45 A;  2BRW A;  2Q1F A;  1X1H A;  3IAQ A;  1NSV A;  2WW3 A;  1N7N A;  1OJM A;  1JZ4 A;  3T09 A;  2HTB A;  1N7Q A;  4TTG A;  1NSU A;  1NS7 A;  3E1F 1;  1L7J A;  1NSS A;  1J0N A;  2HTA A;  2WVX A;  4BZH A;  1RWC A;  3VDC A;  3I3D A;  1RWG A;  4DUX A;  1OJP A;  3NJX A;  1W3Y A;  4BZE A;  2WVX B;  3J7H A;  1JYV A;  3I3B A;  1X1I A;  3NRE A;  1HN1 A;  1NS8 A;  1J0M A;  3MUZ 1; 
#chains in the Genus database with same CATH topology
 3AMO A;  2F1B A;  4DUV A;  1TXK A;  1WMO A;  3MUY 1;  1F4H A;  3S4A A;  3W7X A;  1RW9 A;  1WMP A;  3T0A A;  1ULV A;  1NSX A;  2Y74 A;  4BTW A;  3K25 A;  3A24 A;  3DYP A;  4FNU A;  4KTP A;  3CV5 A;  1JRQ A;  2WGQ A;  3RRS A;  2RDY A;  1L7K A;  1HM2 A;  3VDB A;  2BRP A;  3T2O A;  3KII A;  1PU4 A;  2EAB A;  4K35 A;  1K1Y A;  3DX1 A;  2CQS A;  2CIQ A;  3VD5 A;  4BTY A;  2YFN A;  2OOV A;  2WCO A;  1SII A;  3DX2 A;  1RWH A;  3EJP A;  1KSI A;  3K5T A;  3SEP A;  1UI7 A;  3AFJ A;  1V7V A;  1MMU A;  3T0D A;  4KFD A;  4BZG A;  1HN0 A;  1LUR A;  3EJU A;  1F1S A;  1DP0 A;  2FYV A;  1NS2 A;  2OQE C;  3I3E A;  3DX3 A;  2F1A A;  2WDA A;  1R33 A;  3DCD A;  3T08 A;  3PGB A;  3OBA A;  2OW6 A;  1HTY A;  3QFZ A;  3WA2 X;  3BUP A;  2WYI A;  1NSM A;  1HMU A;  2BRW A;  2F7P A;  2YFO A;  1NSV A;  3D4Z A;  3LVT A;  1NS7 A;  2F18 A;  1NSS A;  4BZH A;  2WVX A;  3BVU A;  4OK2 A;  3I3D A;  1RWG A;  3SX1 A;  2F7Q A;  3BUB A;  3W7T A;  3S4B A;  3J7H A;  1X1I A;  2ZL8 A;  3MUZ 1;  1SO0 A;  2CWT A;  4FNP A;  1V7W A;  3E80 A;  1AV4 A;  3AMO B;  1JYX A;  2WW0 A;  3S4D A;  2YX9 A;  3ACT A;  2CFG A;  3BS6 A;  3VD7 A;  1LVN A;  2EAC A;  1JYN A;  3CZS A;  1RKY A;  1RWA A;  1SIH A;  3ACS A;  3D3I A;  1TU5 A;  1IU7 A;  1W4N A;  3VSN A;  1QAF A;  3BUD A;  3BVT A;  2CFW A;  3DYM A;  3VD4 A;  3BLC A;  3VD9 A;  1D6Y A;  3DEC A;  1MN0 A;  1PX3 A;  3HI7 A;  2WO0 A;  1JZ2 A;  2CG0 A;  3D50 A;  1V7X A;  4FNT A;  4AQ0 A;  2WW1 A;  3MWX A;  3WIQ A;  2CQT A;  4FNQ A;  2D73 A;  1SNZ A;  1NS4 A;  1NSZ A;  5A1A A;  1TQW A;  3EJQ A;  3IMH A;  3T0B A;  1IVU A;  3NBJ A;  1QAL A;  2WOF A;  2EAE A;  4OK4 A;  3D51 A;  2W0Q A;  1EKM A;  3NBB A;  4FNS A;  3BUQ A;  2C11 A;  3HIG A;  3VSM A;  2D1W A;  1N7O A;  1MMY A;  3T2Q A;  3BVX A;  2Q1F A;  1X1H A;  4NEI A;  1W7C A;  5JMD A;  3X42 A;  1A2V A;  1JZ4 A;  2BT3 A;  1N7Q A;  4TTG A;  5GW7 A;  1RWC A;  3D52 A;  4MMH A;  2CFL A;  1W3Y A;  1R34 A;  2WVX B;  3CZN A;  4EV2 A;  2OOV C;  1JYV A;  1W5Z A;  1TQS A;  3ALA A;  1TQV A;  3DDF A;  5E1Q A;  1N7P A;  2CWU A;  2JKA A;  2CIS A;  2XN0 A;  1MMZ A;  4MMI A;  1JZ3 A;  2ZQ0 A;  1I8Q A;  1UG9 A;  1NKG A;  3WIR A;  2WVZ A;  1W6C A;  2CWV A;  2CFK A;  1TQU A;  2XSG A;  4J5T A;  1JZ6 A;  4KTR A;  3DYO A;  1IVX A;  1X1J A;  3NJV A;  2JKE A;  2Y73 A;  1IVV A;  1LXM A;  1HWW A;  1W6G A;  4KFE A;  3EJT A;  3BVW A;  1YGA A;  1W2Z A;  1EGU A;  2CFD A;  3IAP A;  2X03 A;  1HM3 A;  1LF6 A;  1O7D D;  3DX4 A;  1D6Z A;  2BRV X;  2OW7 A;  3EJS A;  3QG0 A;  2FUT A;  3T0U A;  1OJN A;  1F9G A;  1DYU A;  3VD3 A;  1JZ7 A;  3Q1N A;  3MV1 1;  1IQX A;  3E7J A;  3RSY A;  3WFA A;  1LOH A;  3X3Y A;  4RNL A;  1JZ8 A;  2E24 A;  3BLB A;  3DDG A;  1MMX A;  2JKP A;  1RWF A;  3S4C A;  2XHN A;  2CIR A;  4OJZ A;  3KN4 A;  1SPU A;  1AVK A;  2XN2 A;  3X40 A;  2WW3 A;  1N7N A;  1OJM A;  1IQY A;  3E1F 1;  1TQT A;  4DUX A;  1WMN A;  3A0O A;  3WA3 A;  2OQE A;  1HXK A;  4BZE A;  2XN1 A;  1IVW A;  1J0M A;  2F7O A;  1AVL A;  2CG1 A;  3BVV A;  3DX0 A;  1OAC A;  2E2U A;  5JMF A;  3N9H A;  2EAD A;  2WYH A;  4BZF A;  3EJR A;  4BTX A;  3T2P A;  3X3X A;  3QDE A;  1C82 A;  3ECQ A;  1N7R A;  1QWU A;  3CZJ A;  1JOV A;  1LF9 A;  1JYW A;  1YQ2 A;  1PX4 A;  1RJO A;  1CB8 A;  1US1 A;  4K3A A;  2WZS A;  3TY1 A;  3MV0 1;  1UI8 A;  3BGA A;  2PNC A;  2E22 A;  1LXK A;  2ZXQ A;  3MPH A;  1K1X A;  4KFF A;  2WW2 A;  2F7R A;  1F4A A;  1OJO A;  2WOH A;  1QAK A;  3OS7 A;  2WVY A;  3HII A;  3AFL A;  2C10 A;  3X3Z A;  3OB8 A;  3W7U A;  4DUW A;  1QWN A;  4FNV A;  5CA3 A;  1K1W A;  1NS0 A;  1PS3 A;  3VDA A;  1NSR A;  4FNR A;  4EV5 A;  1HMW A;  1JZ5 A;  3MI6 A;  1Z45 A;  3LOY A;  3IAQ A;  2FUQ A;  3SXX A;  3X41 A;  3WVF A;  3QFY A;  3T09 A;  2HTB A;  2E2V A;  1QX1 A;  1NSU A;  2E2T A;  5KBP A;  3BUI A;  1L7J A;  1J0N A;  1D6U A;  2HTA A;  1H54 A;  3W7W A;  4UFC A;  3VDC A;  1OJP A;  1N9E A;  3NJX A;  3W7S A;  3I3B A;  3NRE A;  1HN1 A;  1NS8 A;  2ALW A;  3D4Y A; 
#chains in the Genus database with same CATH homology
 4DUV A;  1TXK A;  3MUY 1;  1SO0 A;  1F4H A;  1N7P A;  5E1Q A;  2JKA A;  2CIS A;  1MMZ A;  1RW9 A;  5JMF A;  4MMI A;  3E80 A;  1JZ3 A;  4BZF A;  3T0A A;  1ULV A;  2ZQ0 A;  1JYX A;  1I8Q A;  1NSX A;  1UG9 A;  1NKG A;  2WW0 A;  3K25 A;  3T2P A;  3BS6 A;  3VD7 A;  3A24 A;  3DYP A;  1C82 A;  2WVZ A;  1JYN A;  1RWA A;  1L7K A;  1HM2 A;  3ECQ A;  3VDB A;  1N7R A;  3VSN A;  2BRP A;  2XSG A;  3CZJ A;  1JOV A;  1LF9 A;  4J5T A;  3T2O A;  1JYW A;  1JZ6 A;  1K1Y A;  3DYM A;  3VD4 A;  3DYO A;  3BLC A;  1X1J A;  2CIQ A;  3NJV A;  3VD5 A;  1YQ2 A;  2JKE A;  1PX4 A;  1CB8 A;  1LXM A;  2WCO A;  3VD9 A;  3DEC A;  1MN0 A;  1PX3 A;  1YGA A;  2WZS A;  1RWH A;  1JZ2 A;  3TY1 A;  1EGU A;  3MV0 1;  3IAP A;  4AQ0 A;  2WW1 A;  2X03 A;  1HM3 A;  3MWX A;  1LF6 A;  3BGA A;  3SEP A;  2BRV X;  2E22 A;  1LXK A;  1MMU A;  2ZXQ A;  1K1X A;  3T0D A;  2WW2 A;  2D73 A;  4BZG A;  1SNZ A;  1HN0 A;  2FUT A;  1NS4 A;  1OJN A;  1NSZ A;  1F9G A;  5A1A A;  1F4A A;  1LUR A;  3VD3 A;  3IMH A;  3Q1N A;  1OJO A;  3MV1 1;  1JZ7 A;  3T0B A;  3E7J A;  3WFA A;  1F1S A;  1LOH A;  2WVY A;  3OS7 A;  1DP0 A;  3AFL A;  1NS2 A;  4RNL A;  4OK4 A;  3OB8 A;  1JZ8 A;  4DUW A;  4FNV A;  3I3E A;  2E24 A;  1K1W A;  1MMX A;  1NS0 A;  2WDA A;  3DCD A;  2JKP A;  3T08 A;  3VDA A;  1RWF A;  3OBA A;  2XHN A;  1NSR A;  3VSM A;  2CIR A;  4OJZ A;  1N7O A;  1MMY A;  1HMW A;  1JZ5 A;  3T2Q A;  1NSM A;  1HMU A;  1Z45 A;  2BRW A;  4NEI A;  2Q1F A;  1X1H A;  3IAQ A;  2FUQ A;  1NSV A;  2WW3 A;  3WVF A;  5JMD A;  1N7N A;  1OJM A;  1JZ4 A;  3T09 A;  2HTB A;  1N7Q A;  4TTG A;  1NSU A;  1NS7 A;  3E1F 1;  1L7J A;  1NSS A;  1J0N A;  2HTA A;  2WVX A;  4BZH A;  1RWC A;  4OK2 A;  3VDC A;  3I3D A;  1RWG A;  4DUX A;  1OJP A;  4MMH A;  3A0O A;  3NJX A;  1W3Y A;  4BZE A;  2WVX B;  3J7H A;  1JYV A;  3I3B A;  1X1I A;  3NRE A;  1HN1 A;  1NS8 A;  1J0M A;  3MUZ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...