1NSZA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGNVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 100
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nszA00
3J7HA 3NJXA 3VD5A 2CIRA 1K1YA 1ULVA 1RWAA 3OS7A 1NSVA 1RWCA 4BZEA 1L7KA 4DUXA 1NKGA 1HM3A 3CZJA 2WCOA 4TTGA 3ECQA 3VDCA 2HTAA 1MN0A 2D73A 3IMHA 1PX3A 1Z45A 5A1AA 3VD7A 1PX4A 3K25A 1C82A 2ZQ0A 3IAQA 3WFAA 3VD4A 5E1QA 3DCDA 1JYVA 1UG9A 4RNLA 2WZSA 3NJVA 2WW0A 2CISA 1HM2A 1SNZA 2WW2A 3I3DA 1X1JA 2HTBA 2Q1FA 2WVYA 1JYNA 2XHNA 1DP0A 3MV01 3T2QA 1HN1A 1HMWA 1W3YA 1LXKA 1MMYA 4BZHA 1X1HA 2ZXQA 1F9GA 1N7QA 3T09A 3MV11 1OJMA 1JZ4A 3T2PA 3E1F1 3DYOA 1LOHA 2JKEA 1K1WA 1JZ5A 1F4HA 2X03A 1JZ7A 3MUY1 1N7RA 3DECA 1RWHA 1NSZA 1J0NA 1NS2A 2BRPA 1J0MA 2E22A 2E24A 4DUWA 3MUZ1 1LXMA 1NSMA 1RWFA 3T0AA 2CIQA 1OJNA 3NREA 1TXKA 1JZ8A 3A24A 3OBAA 2WVZA 1K1XA 4DUVA 1JZ3A 1NSXA 2BRWA 1NS8A 1HMUA 3T2OA 4BZGA 3I3BA 1JZ6A 1MMUA 1JYXA 1N7PA 1RWGA 3MWXA 1LURA 1NSUA 1OJOA 1CB8A 3BGAA 3SEPA 3T0BA 1JOVA 1LF9A 2BRVX 1I8QA 1MMXA 3DYMA 1NS7A 1JZ2A 3VDAA 2WW3A 1N7NA 1F4AA 1JYWA 2WW1A 1RW9A 1SO0A 3T08A 2JKPA 1OJPA 1HN0A 1EGUA 2WDAA 3VD9A 1NS4A 3VD3A 2XSGA 1X1IA 4BZFA 2WVXB 1NSRA 3T0DA 1L7JA 3IAPA 1NS0A 1YQ2A 3DYPA 3I3EA 1F1SA 1MMZA 2WVXA 4AQ0A 1N7OA 3OB8A 3Q1NA 3VDBA 1YGAA 1LF6A 2JKAA 1NSSA
chains in the Genus database with same CATH superfamily
1AVLA 3VD5A 3ALAA 1RWCA 1AVKA 1QAFA 3CZJA 4TTGA 4EV5A 3BVTA 3X3XA 3T0UA 1MN0A 2CFLA 2CFGA 1IVXA 3HIIA 1IVVA 3WFAA 2CWVA 2WZSA 3X3ZA 3TY1A 4FNTA 1HM2A 2WW2A 2WYIA 1QWNA 2WVYA 3EJTA 1WMPA 3MV01 4OJZA 2ZXQA 1F9GA 1OACA 1OJMA 4BTXA 4MMHA 3AMOB 3DX3A 3BUDA 3DYOA 2JKEA 3SXXA 2EACA 2X03A 4FNQA 1RWHA 2BRPA 3BUBA 4KFEA 4DUWA 3MUZ1 1V7VA 2XN0A 3NREA 3BUPA 1JZ8A 3OBAA 2WVZA 1NSXA 1NS8A 4KTRA 3T2OA 1H54A 1V7WA 3VSMA 3HI7A 1JYXA 1TQTA 1NSUA 1OJOA 3BUQA 3ACSA 4UFCA 3DYMA 1DYUA 3VDAA 2E2VA 1UI7A 1OJPA 1PU4A 3DDFA 3VD3A 2CQTA 3WIQA 3LOYA 4BZFA 3E7JA 3T0DA 1IQXA 2CG0A 1HTYA 1MMZA 1N7OA 3LVTA 3VDBA 1YGAA 3BVXA 1NSSA 5CA3A 1K1YA 4DUXA 1NKGA 1HM3A 3BUIA 1N9EA 3AFJA 3ECQA 1A2VA 2HTAA 3MPHA 2D73A 1Z45A 3VSNA 3VD7A 1PX4A 3K25A 3VD4A 3EJPA 1JYVA 4RNLA 3NJVA 3EJQA 1UI8A 3DDGA 1X1JA 1LVNA 4FNUA 1IVUA 3NBJA 2RDYA 3D50A 2XHNA 2CG1A 3D4ZA 1MMYA 2FUQA 3E80A 1AV4A 3T2PA 4KFDA 2F7PA 1K1WA 1JZ7A 2WO0A 1NSZA 1J0MA 2E22A 1RJOA 2CIQA 3WIRA 4BTWA 1QWUA 1HWWA 4DUVA 1D6YA 1JZ3A 3D52A 2WOFA 3QFYA 3DX4A 3X40A 4OK2A 3N9HA 1RWGA 3BGAA 2F7OA 5GW7A 1I8QA 3A0OA 4FNVA 2CFDA 1RW9A 2CFKA 3T08A 2JKPA 3BLCA 2PNCA 3VD9A 1R33A 3BLBA 4J5TA 2WVXB 2BT3A 2F1BA 1YQ2A 3KN4A 4AQ0A 3Q1NA 3SX1A 1LF6A 2F1AA 1RWAA 1NSVA 4BZEA 3DX2A 3VDCA 3IMHA 1PX3A 2W0QA 2OW7A 5A1AA 3BVVA 3X3YA 3DCDA 1W7CA 4FNPA 2C11A 2CWUA 1KSIA 2OW6A 3D51A 2WW0A 3EJSA 2CISA 1IQYA 2HTBA 2Q1FA 1R34A 2WOHA 4FNRA 1DP0A 2XN1A 3T2QA 1HN1A 1LXKA 3W7XA 4KFFA 2CFWA 3D3IA 1X1HA 2WGQA 3MI6A 1N7QA 2CQSA 3T09A 1JZ4A 1QX1A 3DX1A 2ALWA 1JZ5A 1F4HA 3ACTA 1N7RA 4EV2A 2CWTA 3EJUA 4K3AA 3T0AA 1JRQA 3A24A 2BRWA 3DX0A 1QAKA 3QG0A 4BZGA 3I3BA 3CZSA 1JZ6A 1MMUA 3X41A 3RRSA 1EKMA 3SEPA 3CZNA 2YX9A 1MMXA 3WVFA 1NS7A 1JZ2A 3S4DA 1N7NA 1F4AA 1IVWA 1TU5A 2FYVA 1W6GA 2WDAA 1NS4A 2XSGA 1NSRA 3D4YA 1TQUA 3IAPA 3K5TA 1NS0A 4BTYA 3I3EA 2ZL8A 2F7QA 2C10A 4NEIA 3J7HA 1IU7A 3DYPA 3NJXA 2CIRA 5JMFA 2OQEA 1ULVA 3QFZA 3OS7A 2Y74A 1L7KA 3EJRA 3W7SA 2WCOA 1WMOA 2OOVA 2YFOA 4FNSA 1TQVA 1C82A 2ZQ0A 2FUTA 3IAQA 4OK4A 5E1QA 3X42A 3BVWA 1UG9A 1W5ZA 1RKYA 2WYHA 3S4BA 1TQSA 1SNZA 3QDEA 3I3DA 1W6CA 1W2ZA 1JYNA 3RSYA 1HMWA 1W3YA 4BZHA 1D6ZA 2EADA 3MV11 1TQWA 4KTPA 3E1F1 1V7XA 2YFNA 1LOHA 2E2UA 2XN2A 3MUY1 3DECA 1J0NA 1NS2A 2E24A 3W7TA 1LXMA 1NSMA 1RWFA 2F18A 1OJNA 2EABA 1TXKA 3NBBA 1O7DD 1K1XA 3W7WA 2Y73A 2D1WA 1HMUA 3S4AA 2EAEA 2F7RA 2E2TA 3S4CA 1N7PA 3MWXA 1LURA 1CB8A 3T0BA 1JOVA 1SPUA 3AMOA 1LF9A 1WMNA 2BRVX 3WA3A 3KIIA 2WW3A 1JYWA 2WW1A 3PGBA 1SO0A 5JMDA 5KBPA 3AFLA 2OQEC 3W7UA 1HN0A 1EGUA 3BS6A 3BVUA 4MMIA 3HIGA 1X1IA 1SIHA 1SIIA 4K35A 2OOVC 1L7JA 3WA2X 1D6UA 1PS3A 1F1SA 2WVXA 3CV5A 1US1A 3OB8A 1HXKA 1QALA 1W4NA 2JKAA
chains in the Genus database with same CATH topology
3J7HA 3NJXA 3VD5A 2CIRA 1K1YA 5JMFA 1ULVA 1RWAA 3OS7A 1NSVA 1RWCA 4BZEA 1L7KA 4DUXA 1NKGA 1HM3A 3CZJA 2WCOA 4TTGA 3ECQA 3VDCA 2HTAA 1MN0A 2D73A 3IMHA 1PX3A 1Z45A 3VSNA 5A1AA 3VD7A 1PX4A 3K25A 1C82A 2ZQ0A 2FUTA 3IAQA 4OK4A 5E1QA 3DCDA 3WFAA 3VD4A 1JYVA 1UG9A 4RNLA 2WZSA 3NJVA 3TY1A 2WW0A 2CISA 1HM2A 1SNZA 2WW2A 3I3DA 1X1JA 2HTBA 2Q1FA 2WVYA 1JYNA 2XHNA 1DP0A 3MV01 3T2QA 1HN1A 1HMWA 1W3YA 4OJZA 1LXKA 1MMYA 4BZHA 2FUQA 1X1HA 3E80A 2ZXQA 1F9GA 1N7QA 3T09A 3MV11 1OJMA 1JZ4A 4MMHA 3T2PA 3E1F1 3DYOA 1LOHA 2JKEA 1K1WA 1JZ5A 1F4HA 2X03A 1JZ7A 3MUY1 1N7RA 3DECA 1RWHA 1NSZA 1J0NA 1NS2A 2BRPA 1J0MA 2E22A 2E24A 4DUWA 3MUZ1 1LXMA 1NSMA 1RWFA 3T0AA 2CIQA 1OJNA 3NREA 1TXKA 1JZ8A 3A24A 3OBAA 2WVZA 1K1XA 4DUVA 1JZ3A 1NSXA 2BRWA 1NS8A 1HMUA 3T2OA 4BZGA 3I3BA 3VSMA 1JZ6A 1MMUA 1JYXA 4OK2A 1N7PA 1RWGA 3MWXA 1LURA 1NSUA 1OJOA 1CB8A 3BGAA 3SEPA 3T0BA 1JOVA 1LF9A 2BRVX 1I8QA 1MMXA 3DYMA 3WVFA 1NS7A 3A0OA 1JZ2A 3VDAA 2WW3A 1N7NA 1F4AA 4FNVA 1JYWA 2WW1A 1RW9A 1SO0A 5JMDA 3T08A 2JKPA 1OJPA 3AFLA 3BLCA 1HN0A 1EGUA 2WDAA 3VD9A 1NS4A 3VD3A 2XSGA 3BS6A 4MMIA 4J5TA 1X1IA 4BZFA 2WVXB 3E7JA 1NSRA 3T0DA 1L7JA 3IAPA 1NS0A 1YQ2A 3DYPA 3I3EA 1F1SA 1MMZA 2WVXA 4AQ0A 1N7OA 3OB8A 3Q1NA 4NEIA 3VDBA 1YGAA 1LF6A 2JKAA 1NSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7H A;  3NJX A;  3VD5 A;  2CIR A;  1K1Y A;  1ULV A;  1RWA A;  3OS7 A;  1NSV A;  1RWC A;  4BZE A;  1L7K A;  4DUX A;  1NKG A;  1HM3 A;  3CZJ A;  2WCO A;  4TTG A;  3ECQ A;  3VDC A;  2HTA A;  1MN0 A;  2D73 A;  3IMH A;  1PX3 A;  1Z45 A;  5A1A A;  3VD7 A;  1PX4 A;  3K25 A;  1C82 A;  2ZQ0 A;  3IAQ A;  3WFA A;  3VD4 A;  5E1Q A;  3DCD A;  1JYV A;  1UG9 A;  4RNL A;  2WZS A;  3NJV A;  2WW0 A;  2CIS A;  1HM2 A;  1SNZ A;  2WW2 A;  3I3D A;  1X1J A;  2HTB A;  2Q1F A;  2WVY A;  1JYN A;  2XHN A;  1DP0 A;  3MV0 1;  3T2Q A;  1HN1 A;  1HMW A;  1W3Y A;  1LXK A;  1MMY A;  4BZH A;  1X1H A;  2ZXQ A;  1F9G A;  1N7Q A;  3T09 A;  3MV1 1;  1OJM A;  1JZ4 A;  3T2P A;  3E1F 1;  3DYO A;  1LOH A;  2JKE A;  1K1W A;  1JZ5 A;  1F4H A;  2X03 A;  1JZ7 A;  3MUY 1;  1N7R A;  3DEC A;  1RWH A;  1NSZ A;  1J0N A;  1NS2 A;  2BRP A;  1J0M A;  2E22 A;  2E24 A;  4DUW A;  3MUZ 1;  1LXM A;  1NSM A;  1RWF A;  3T0A A;  2CIQ A;  1OJN A;  3NRE A;  1TXK A;  1JZ8 A;  3A24 A;  3OBA A;  2WVZ A;  1K1X A;  4DUV A;  1JZ3 A;  1NSX A;  2BRW A;  1NS8 A;  1HMU A;  3T2O A;  4BZG A;  3I3B A;  1JZ6 A;  1MMU A;  1JYX A;  1N7P A;  1RWG A;  3MWX A;  1LUR A;  1NSU A;  1OJO A;  1CB8 A;  3BGA A;  3SEP A;  3T0B A;  1JOV A;  1LF9 A;  2BRV X;  1I8Q A;  1MMX A;  3DYM A;  1NS7 A;  1JZ2 A;  3VDA A;  2WW3 A;  1N7N A;  1F4A A;  1JYW A;  2WW1 A;  1RW9 A;  1SO0 A;  3T08 A;  2JKP A;  1OJP A;  1HN0 A;  1EGU A;  2WDA A;  3VD9 A;  1NS4 A;  3VD3 A;  2XSG A;  1X1I A;  4BZF A;  2WVX B;  1NSR A;  3T0D A;  1L7J A;  3IAP A;  1NS0 A;  1YQ2 A;  3DYP A;  3I3E A;  1F1S A;  1MMZ A;  2WVX A;  4AQ0 A;  1N7O A;  3OB8 A;  3Q1N A;  3VDB A;  1YGA A;  1LF6 A;  2JKA A;  1NSS A; 
#chains in the Genus database with same CATH topology
 1AVL A;  3VD5 A;  3ALA A;  1RWC A;  1AVK A;  1QAF A;  3CZJ A;  4TTG A;  4EV5 A;  3BVT A;  3X3X A;  3T0U A;  1MN0 A;  2CFL A;  2CFG A;  1IVX A;  3HII A;  1IVV A;  3WFA A;  2CWV A;  2WZS A;  3X3Z A;  3TY1 A;  4FNT A;  1HM2 A;  2WW2 A;  2WYI A;  1QWN A;  2WVY A;  3EJT A;  1WMP A;  3MV0 1;  4OJZ A;  2ZXQ A;  1F9G A;  1OAC A;  1OJM A;  4BTX A;  4MMH A;  3AMO B;  3DX3 A;  3BUD A;  3DYO A;  2JKE A;  3SXX A;  2EAC A;  2X03 A;  4FNQ A;  1RWH A;  2BRP A;  3BUB A;  4KFE A;  4DUW A;  3MUZ 1;  1V7V A;  2XN0 A;  3NRE A;  3BUP A;  1JZ8 A;  3OBA A;  2WVZ A;  1NSX A;  1NS8 A;  4KTR A;  3T2O A;  1H54 A;  1V7W A;  3VSM A;  3HI7 A;  1JYX A;  1TQT A;  1NSU A;  1OJO A;  3BUQ A;  3ACS A;  4UFC A;  3DYM A;  1DYU A;  3VDA A;  2E2V A;  1UI7 A;  1OJP A;  1PU4 A;  3DDF A;  3VD3 A;  2CQT A;  3WIQ A;  3LOY A;  4BZF A;  3E7J A;  3T0D A;  1IQX A;  2CG0 A;  1HTY A;  1MMZ A;  1N7O A;  3LVT A;  3VDB A;  1YGA A;  3BVX A;  1NSS A;  5CA3 A;  1K1Y A;  4DUX A;  1NKG A;  1HM3 A;  3BUI A;  1N9E A;  3AFJ A;  3ECQ A;  1A2V A;  2HTA A;  3MPH A;  2D73 A;  1Z45 A;  3VSN A;  3VD7 A;  1PX4 A;  3K25 A;  3VD4 A;  3EJP A;  1JYV A;  4RNL A;  3NJV A;  3EJQ A;  1UI8 A;  3DDG A;  1X1J A;  1LVN A;  4FNU A;  1IVU A;  3NBJ A;  2RDY A;  3D50 A;  2XHN A;  2CG1 A;  3D4Z A;  1MMY A;  2FUQ A;  3E80 A;  1AV4 A;  3T2P A;  4KFD A;  2F7P A;  1K1W A;  1JZ7 A;  2WO0 A;  1NSZ A;  1J0M A;  2E22 A;  1RJO A;  2CIQ A;  3WIR A;  4BTW A;  1QWU A;  1HWW A;  4DUV A;  1D6Y A;  1JZ3 A;  3D52 A;  2WOF A;  3QFY A;  3DX4 A;  3X40 A;  4OK2 A;  3N9H A;  1RWG A;  3BGA A;  2F7O A;  5GW7 A;  1I8Q A;  3A0O A;  4FNV A;  2CFD A;  1RW9 A;  2CFK A;  3T08 A;  2JKP A;  3BLC A;  2PNC A;  3VD9 A;  1R33 A;  3BLB A;  4J5T A;  2WVX B;  2BT3 A;  2F1B A;  1YQ2 A;  3KN4 A;  4AQ0 A;  3Q1N A;  3SX1 A;  1LF6 A;  2F1A A;  1RWA A;  1NSV A;  4BZE A;  3DX2 A;  3VDC A;  3IMH A;  1PX3 A;  2W0Q A;  2OW7 A;  5A1A A;  3BVV A;  3X3Y A;  3DCD A;  1W7C A;  4FNP A;  2C11 A;  2CWU A;  1KSI A;  2OW6 A;  3D51 A;  2WW0 A;  3EJS A;  2CIS A;  1IQY A;  2HTB A;  2Q1F A;  1R34 A;  2WOH A;  4FNR A;  1DP0 A;  2XN1 A;  3T2Q A;  1HN1 A;  1LXK A;  3W7X A;  4KFF A;  2CFW A;  3D3I A;  1X1H A;  2WGQ A;  3MI6 A;  1N7Q A;  2CQS A;  3T09 A;  1JZ4 A;  1QX1 A;  3DX1 A;  2ALW A;  1JZ5 A;  1F4H A;  3ACT A;  1N7R A;  4EV2 A;  2CWT A;  3EJU A;  4K3A A;  3T0A A;  1JRQ A;  3A24 A;  2BRW A;  3DX0 A;  1QAK A;  3QG0 A;  4BZG A;  3I3B A;  3CZS A;  1JZ6 A;  1MMU A;  3X41 A;  3RRS A;  1EKM A;  3SEP A;  3CZN A;  2YX9 A;  1MMX A;  3WVF A;  1NS7 A;  1JZ2 A;  3S4D A;  1N7N A;  1F4A A;  1IVW A;  1TU5 A;  2FYV A;  1W6G A;  2WDA A;  1NS4 A;  2XSG A;  1NSR A;  3D4Y A;  1TQU A;  3IAP A;  3K5T A;  1NS0 A;  4BTY A;  3I3E A;  2ZL8 A;  2F7Q A;  2C10 A;  4NEI A;  3J7H A;  1IU7 A;  3DYP A;  3NJX A;  2CIR A;  5JMF A;  2OQE A;  1ULV A;  3QFZ A;  3OS7 A;  2Y74 A;  1L7K A;  3EJR A;  3W7S A;  2WCO A;  1WMO A;  2OOV A;  2YFO A;  4FNS A;  1TQV A;  1C82 A;  2ZQ0 A;  2FUT A;  3IAQ A;  4OK4 A;  5E1Q A;  3X42 A;  3BVW A;  1UG9 A;  1W5Z A;  1RKY A;  2WYH A;  3S4B A;  1TQS A;  1SNZ A;  3QDE A;  3I3D A;  1W6C A;  1W2Z A;  1JYN A;  3RSY A;  1HMW A;  1W3Y A;  4BZH A;  1D6Z A;  2EAD A;  3MV1 1;  1TQW A;  4KTP A;  3E1F 1;  1V7X A;  2YFN A;  1LOH A;  2E2U A;  2XN2 A;  3MUY 1;  3DEC A;  1J0N A;  1NS2 A;  2E24 A;  3W7T A;  1LXM A;  1NSM A;  1RWF A;  2F18 A;  1OJN A;  2EAB A;  1TXK A;  3NBB A;  1O7D D;  1K1X A;  3W7W A;  2Y73 A;  2D1W A;  1HMU A;  3S4A A;  2EAE A;  2F7R A;  2E2T A;  3S4C A;  1N7P A;  3MWX A;  1LUR A;  1CB8 A;  3T0B A;  1JOV A;  1SPU A;  3AMO A;  1LF9 A;  1WMN A;  2BRV X;  3WA3 A;  3KII A;  2WW3 A;  1JYW A;  2WW1 A;  3PGB A;  1SO0 A;  5JMD A;  5KBP A;  3AFL A;  2OQE C;  3W7U A;  1HN0 A;  1EGU A;  3BS6 A;  3BVU A;  4MMI A;  3HIG A;  1X1I A;  1SIH A;  1SII A;  4K35 A;  2OOV C;  1L7J A;  3WA2 X;  1D6U A;  1PS3 A;  1F1S A;  2WVX A;  3CV5 A;  1US1 A;  3OB8 A;  1HXK A;  1QAL A;  1W4N A;  2JKA A; 
#chains in the Genus database with same CATH homology
 3J7H A;  3NJX A;  3VD5 A;  2CIR A;  1K1Y A;  5JMF A;  1ULV A;  1RWA A;  3OS7 A;  1NSV A;  1RWC A;  4BZE A;  1L7K A;  4DUX A;  1NKG A;  1HM3 A;  3CZJ A;  2WCO A;  4TTG A;  3ECQ A;  3VDC A;  2HTA A;  1MN0 A;  2D73 A;  3IMH A;  1PX3 A;  1Z45 A;  3VSN A;  5A1A A;  3VD7 A;  1PX4 A;  3K25 A;  1C82 A;  2ZQ0 A;  2FUT A;  3IAQ A;  4OK4 A;  5E1Q A;  3DCD A;  3WFA A;  3VD4 A;  1JYV A;  1UG9 A;  4RNL A;  2WZS A;  3NJV A;  3TY1 A;  2WW0 A;  2CIS A;  1HM2 A;  1SNZ A;  2WW2 A;  3I3D A;  1X1J A;  2HTB A;  2Q1F A;  2WVY A;  1JYN A;  2XHN A;  1DP0 A;  3MV0 1;  3T2Q A;  1HN1 A;  1HMW A;  1W3Y A;  4OJZ A;  1LXK A;  1MMY A;  4BZH A;  2FUQ A;  1X1H A;  3E80 A;  2ZXQ A;  1F9G A;  1N7Q A;  3T09 A;  3MV1 1;  1OJM A;  1JZ4 A;  4MMH A;  3T2P A;  3E1F 1;  3DYO A;  1LOH A;  2JKE A;  1K1W A;  1JZ5 A;  1F4H A;  2X03 A;  1JZ7 A;  3MUY 1;  1N7R A;  3DEC A;  1RWH A;  1NSZ A;  1J0N A;  1NS2 A;  2BRP A;  1J0M A;  2E22 A;  2E24 A;  4DUW A;  3MUZ 1;  1LXM A;  1NSM A;  1RWF A;  3T0A A;  2CIQ A;  1OJN A;  3NRE A;  1TXK A;  1JZ8 A;  3A24 A;  3OBA A;  2WVZ A;  1K1X A;  4DUV A;  1JZ3 A;  1NSX A;  2BRW A;  1NS8 A;  1HMU A;  3T2O A;  4BZG A;  3I3B A;  3VSM A;  1JZ6 A;  1MMU A;  1JYX A;  4OK2 A;  1N7P A;  1RWG A;  3MWX A;  1LUR A;  1NSU A;  1OJO A;  1CB8 A;  3BGA A;  3SEP A;  3T0B A;  1JOV A;  1LF9 A;  2BRV X;  1I8Q A;  1MMX A;  3DYM A;  3WVF A;  1NS7 A;  3A0O A;  1JZ2 A;  3VDA A;  2WW3 A;  1N7N A;  1F4A A;  4FNV A;  1JYW A;  2WW1 A;  1RW9 A;  1SO0 A;  5JMD A;  3T08 A;  2JKP A;  1OJP A;  3AFL A;  3BLC A;  1HN0 A;  1EGU A;  2WDA A;  3VD9 A;  1NS4 A;  3VD3 A;  2XSG A;  3BS6 A;  4MMI A;  4J5T A;  1X1I A;  4BZF A;  2WVX B;  3E7J A;  1NSR A;  3T0D A;  1L7J A;  3IAP A;  1NS0 A;  1YQ2 A;  3DYP A;  3I3E A;  1F1S A;  1MMZ A;  2WVX A;  4AQ0 A;  1N7O A;  3OB8 A;  3Q1N A;  4NEI A;  3VDB A;  1YGA A;  1LF6 A;  2JKA A;  1NSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...