1MMUA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-glucose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 93
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmuA00
1OJNA 1NS0A 1LOHA 1SO0A 1RWAA 1RWFA 2ZQ0A 3MV01 2D73A 1NSVA 3VD7A 4DUVA 3DYOA 1HMWA 3BGAA 1N7OA 1LXKA 3E1F1 3T09A 2WDAA 2JKEA 4DUXA 1NS4A 1N7PA 1JZ5A 2WVXB 1K1XA 1UG9A 4AQ0A 2HTAA 3DECA 3T08A 1TXKA 1NS2A 1NS8A 2ZXQA 1YQ2A 3IAQA 3T0BA 1SNZA 2JKAA 2BRWA 2WW2A 1JZ6A 1N7RA 1LXMA 1ULVA 3DCDA 1CB8A 1NSXA 2CIQA 3VD5A 1RWCA 1X1JA 3OBAA 1Z45A 2BRPA 2CIRA 4RNLA 1JYWA 3K25A 3I3DA 1OJPA 1HM3A 3IAPA 1NSZA 3CZJA 3SEPA 1F4HA 1JOVA 1JYXA 3IMHA 3MUY1 3T2OA 3WFAA 1X1HA 3NREA 1J0NA 1LF6A 2BRVX 3MWXA 1NSSA 3Q1NA 1OJMA 1K1WA 1PX4A 3NJVA 4BZFA 2E24A 1LF9A 3VDBA 3ECQA 3MUZ1 1F4AA 3T0AA 2Q1FA 2WW0A 1JZ8A 1L7JA 1MMXA 1JYVA 1HN1A 1NSUA 1K1YA 2WZSA 3OB8A 3T2PA 2CISA 1MMZA 3VDAA 3I3BA 1JZ4A 1N7NA 2WCOA 3DYPA 2WVYA 1RW9A 2XSGA 3VD4A 2X03A 1C82A 2WVZA 1DP0A 1W3YA 1J0MA 1LURA 1MMYA 1NSMA 3NJXA 2XHNA 3OS7A 3DYMA 3VD3A 1N7QA 1JZ7A 2HTBA 3T0DA 4TTGA 1OJOA 1NSRA 2WVXA 3A24A 3MV11 1NKGA 1EGUA 1RWHA 1RWGA 1X1IA 5A1AA 1JYNA 1L7KA 1I8QA 1MN0A 3J7HA 2WW3A 1JZ2A 2E22A 5E1QA 1JZ3A 4BZGA 4BZHA 1F9GA 1PX3A 3T2QA 1NS7A 4BZEA 3I3EA 1MMUA 1HM2A 4DUWA 1HMUA 3VDCA 2JKPA 3VD9A 2WW1A 1YGAA 1HN0A 1F1SA
chains in the Genus database with same CATH superfamily
3X3YA 1NS0A 3W7WA 1RWFA 2ZQ0A 1H54A 4FNSA 3BVXA 3ACSA 3DX3A 2F7RA 3DYOA 4DUVA 1HMWA 1N7OA 1LXKA 3E1F1 3SX1A 1AV4A 2Y73A 1W4NA 3DX4A 3QDEA 1JZ5A 3T08A 4FNRA 1US1A 3IAQA 4OK4A 1IVVA 1ULVA 5GW7A 4FNQA 3VD5A 1Z45A 3AMOB 3CV5A 2EACA 3BUIA 4RNLA 3I3DA 3S4AA 3CZJA 1F4HA 3IMHA 1WMOA 1D6YA 4KFFA 3MUY1 3NREA 2BRVX 2CFKA 3Q1NA 3CZSA 1AVKA 1LF9A 3VDBA 3BVUA 3T0AA 1WMPA 3BUBA 1QAKA 1L7JA 1HN1A 1K1YA 1MMZA 1TQWA 3A0OA 3I3BA 3BLBA 4EV5A 1QWUA 2FUTA 4OK2A 1PU4A 3N9HA 3VD4A 1C82A 3ACTA 1MMYA 2XHNA 3X40A 2CFDA 3VD3A 1N7QA 2HTBA 3T0DA 3D51A 2WVXA 2OOVC 5A1AA 4FNTA 1OACA 2WW3A 2CQTA 4KTPA 2F7OA 1JZ3A 2CWTA 2OQEC 1MMUA 4KFDA 2CG1A 2WW1A 3BVTA 4KFEA 1OJNA 5CA3A 3X3XA 3NBBA 3D4ZA 2WDAA 1N7PA 2WYHA 4AQ0A 3S4CA 1NS8A 2RDYA 1RKYA 2ZXQA 1SNZA 2JKAA 1EKMA 3RSYA 2BRWA 1JZ6A 1N7RA 1LXMA 2F7QA 2FYVA 1CB8A 4K35A 2PNCA 3T0UA 2EABA 1RWCA 3MI6A 1R34A 2CIRA 3D50A 3EJSA 3IAPA 1NSZA 1O7DD 2ZL8A 3T2OA 1X1HA 5KBPA 1J0NA 1LF6A 2WOFA 2F1BA 3W7SA 3BUQA 3MUZ1 2YX9A 2Q1FA 3CZNA 4FNVA 3HIGA 1JZ8A 1QALA 2OW7A 1JYVA 2WZSA 3E80A 2F7PA 3VDAA 3PGBA 3KN4A 3WIRA 1UI8A 2F18A 3X41A 2WGQA 3W7TA 1TQUA 1DP0A 1J0MA 1LURA 1IQYA 3DYMA 1NSRA 3D52A 1W6CA 3MV11 1RWGA 3WA2X 1I8QA 3NBJA 5JMFA 1D6UA 3EJQA 2FUQA 3BS6A 4BZGA 1F9GA 1PX3A 3T2QA 3HI7A 3QG0A 1NS7A 3VSMA 3I3EA 1HM2A 3DX1A 1TQSA 4J5TA 1YGAA 3WA3A 1SPUA 1LOHA 3QFYA 3S4DA 3BUPA 1SO0A 1TQTA 3VD7A 3KIIA 1QAFA 2WO0A 3BGAA 3WVFA 1NS4A 2CG0A 1K1XA 1UG9A 1HXKA 1TXKA 2CFLA 1NS2A 2C10A 2F1AA 3ALAA 2D1WA 3T0BA 2WW2A 4MMIA 3DCDA 3HIIA 1W6GA 1NSXA 2CIQA 2EAEA 3OBAA 2OOVA 3MPHA 1W7CA 1OJPA 1IVWA 1RJOA 1JOVA 1JYXA 3EJUA 3X3ZA 1W2ZA 3MWXA 3BLCA 1TQVA 2WW0A 1LVNA 3D4YA 3BVWA 1MMXA 1NSUA 3TY1A 3OB8A 3EJPA 1R33A 1JZ4A 1QX1A 1N7NA 1SIIA 1SIHA 3DYPA 3E7JA 1RW9A 2YFOA 1HTYA 3NJXA 1NSMA 3BUDA 3S4BA 4FNUA 3K5TA 1MN0A 3J7HA 2E2UA 2C11A 3RRSA 2CQSA 1QWNA 1TU5A 4BZEA 3W7XA 1UI7A 5JMDA 1IU7A 3VD9A 1HN0A 1F1SA 2E2TA 4NEIA 1RWAA 2Y74A 3MV01 2D73A 1AVLA 1NSVA 1JRQA 3T09A 4DUXA 2JKEA 3BVVA 2WVXB 2CFGA 2HTAA 3DECA 4UFCA 2BT3A 1IQXA 2EADA 3AMOA 3EJRA 2YFNA 1V7XA 3X42A 1YQ2A 3VSNA 2CFWA 2W0QA 3WIQA 1X1JA 3DDGA 2BRPA 1WMNA 1JYWA 1IVXA 3K25A 1HM3A 3DX2A 3LVTA 1N9EA 3SEPA 1W5ZA 3WFAA 3QFZA 3AFLA 1NSSA 3EJTA 1OJMA 4K3AA 1K1WA 1PX4A 3NJVA 4FNPA 2E24A 4BZFA 3DX0A 3ECQA 4BTXA 1F4AA 2XN1A 2ALWA 4BTYA 1A2VA 3T2PA 2CISA 4KTRA 3DDFA 2WCOA 2OW6A 1HWWA 2WVYA 1V7VA 4OJZA 3D3IA 2XSGA 2X03A 2WVZA 1PS3A 2OQEA 1W3YA 4BTWA 3OS7A 3LOYA 1JZ7A 1DYUA 1V7WA 4TTGA 1OJOA 3A24A 1NKGA 1EGUA 1RWHA 1D6ZA 1X1IA 2XN0A 1JYNA 1L7KA 2CWUA 1JZ2A 3AFJA 3SXXA 2XN2A 4MMHA 1KSIA 3W7UA 2E22A 5E1QA 2E2VA 4BZHA 2WOHA 4DUWA 1HMUA 3VDCA 4EV2A 2JKPA 2CWVA 1IVUA 2WYIA
chains in the Genus database with same CATH topology
1OJNA 1NS0A 1LOHA 1SO0A 4NEIA 1RWAA 1RWFA 2ZQ0A 3MV01 2D73A 1NSVA 3VD7A 4DUVA 3DYOA 1HMWA 3BGAA 1N7OA 1LXKA 3E1F1 3T09A 3WVFA 2WDAA 2JKEA 4DUXA 1NS4A 1N7PA 1JZ5A 2WVXB 1K1XA 1UG9A 4AQ0A 2HTAA 3DECA 3T08A 1TXKA 1NS2A 1NS8A 2ZXQA 1YQ2A 3IAQA 4OK4A 1SNZA 3T0BA 2JKAA 3VSNA 2BRWA 2WW2A 1JZ6A 4MMIA 1N7RA 1LXMA 1ULVA 3DCDA 1CB8A 1NSXA 2CIQA 3VD5A 1RWCA 1X1JA 3OBAA 1Z45A 2BRPA 2CIRA 4RNLA 1JYWA 3K25A 3I3DA 1OJPA 1HM3A 3IAPA 1NSZA 3CZJA 3SEPA 1F4HA 1JOVA 1JYXA 3IMHA 3MUY1 3T2OA 3WFAA 1X1HA 3NREA 1J0NA 1LF6A 3AFLA 2BRVX 3MWXA 1NSSA 3Q1NA 1OJMA 1K1WA 1PX4A 3NJVA 4BZFA 2E24A 1LF9A 3VDBA 3ECQA 3MUZ1 1F4AA 3T0AA 3BLCA 2Q1FA 4FNVA 2WW0A 1JZ8A 1L7JA 1MMXA 1JYVA 1HN1A 1NSUA 1K1YA 2WZSA 3E80A 3OB8A 3TY1A 3T2PA 2CISA 1MMZA 3VDAA 3I3BA 3A0OA 1JZ4A 1N7NA 2FUTA 2WCOA 4OK2A 3DYPA 3E7JA 2WVYA 1RW9A 4OJZA 2XSGA 3VD4A 2X03A 1C82A 2WVZA 1DP0A 1W3YA 1J0MA 1LURA 1MMYA 1NSMA 3NJXA 2XHNA 3OS7A 3DYMA 3VD3A 1N7QA 1JZ7A 2HTBA 3T0DA 4TTGA 1OJOA 1NSRA 2WVXA 3A24A 3MV11 1NKGA 1EGUA 1RWHA 1RWGA 1X1IA 5A1AA 1JYNA 1L7KA 1I8QA 1MN0A 3J7HA 5JMFA 2WW3A 1JZ2A 4MMHA 2E22A 5E1QA 1JZ3A 2FUQA 3BS6A 4BZGA 4BZHA 1F9GA 1PX3A 3T2QA 1NS7A 4BZEA 3VSMA 3I3EA 1MMUA 1HM2A 5JMDA 4DUWA 1HMUA 3VDCA 2JKPA 3VD9A 4J5TA 2WW1A 1YGAA 1HN0A 1F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJN A;  1NS0 A;  1LOH A;  1SO0 A;  1RWA A;  1RWF A;  2ZQ0 A;  3MV0 1;  2D73 A;  1NSV A;  3VD7 A;  4DUV A;  3DYO A;  1HMW A;  3BGA A;  1N7O A;  1LXK A;  3E1F 1;  3T09 A;  2WDA A;  2JKE A;  4DUX A;  1NS4 A;  1N7P A;  1JZ5 A;  2WVX B;  1K1X A;  1UG9 A;  4AQ0 A;  2HTA A;  3DEC A;  3T08 A;  1TXK A;  1NS2 A;  1NS8 A;  2ZXQ A;  1YQ2 A;  3IAQ A;  3T0B A;  1SNZ A;  2JKA A;  2BRW A;  2WW2 A;  1JZ6 A;  1N7R A;  1LXM A;  1ULV A;  3DCD A;  1CB8 A;  1NSX A;  2CIQ A;  3VD5 A;  1RWC A;  1X1J A;  3OBA A;  1Z45 A;  2BRP A;  2CIR A;  4RNL A;  1JYW A;  3K25 A;  3I3D A;  1OJP A;  1HM3 A;  3IAP A;  1NSZ A;  3CZJ A;  3SEP A;  1F4H A;  1JOV A;  1JYX A;  3IMH A;  3MUY 1;  3T2O A;  3WFA A;  1X1H A;  3NRE A;  1J0N A;  1LF6 A;  2BRV X;  3MWX A;  1NSS A;  3Q1N A;  1OJM A;  1K1W A;  1PX4 A;  3NJV A;  4BZF A;  2E24 A;  1LF9 A;  3VDB A;  3ECQ A;  3MUZ 1;  1F4A A;  3T0A A;  2Q1F A;  2WW0 A;  1JZ8 A;  1L7J A;  1MMX A;  1JYV A;  1HN1 A;  1NSU A;  1K1Y A;  2WZS A;  3OB8 A;  3T2P A;  2CIS A;  1MMZ A;  3VDA A;  3I3B A;  1JZ4 A;  1N7N A;  2WCO A;  3DYP A;  2WVY A;  1RW9 A;  2XSG A;  3VD4 A;  2X03 A;  1C82 A;  2WVZ A;  1DP0 A;  1W3Y A;  1J0M A;  1LUR A;  1MMY A;  1NSM A;  3NJX A;  2XHN A;  3OS7 A;  3DYM A;  3VD3 A;  1N7Q A;  1JZ7 A;  2HTB A;  3T0D A;  4TTG A;  1OJO A;  1NSR A;  2WVX A;  3A24 A;  3MV1 1;  1NKG A;  1EGU A;  1RWH A;  1RWG A;  1X1I A;  5A1A A;  1JYN A;  1L7K A;  1I8Q A;  1MN0 A;  3J7H A;  2WW3 A;  1JZ2 A;  2E22 A;  5E1Q A;  1JZ3 A;  4BZG A;  4BZH A;  1F9G A;  1PX3 A;  3T2Q A;  1NS7 A;  4BZE A;  3I3E A;  1MMU A;  1HM2 A;  4DUW A;  1HMU A;  3VDC A;  2JKP A;  3VD9 A;  2WW1 A;  1YGA A;  1HN0 A;  1F1S A; 
#chains in the Genus database with same CATH topology
 3X3Y A;  1NS0 A;  3W7W A;  1RWF A;  2ZQ0 A;  1H54 A;  4FNS A;  3BVX A;  3ACS A;  3DX3 A;  2F7R A;  3DYO A;  4DUV A;  1HMW A;  1N7O A;  1LXK A;  3E1F 1;  3SX1 A;  1AV4 A;  2Y73 A;  1W4N A;  3DX4 A;  3QDE A;  1JZ5 A;  3T08 A;  4FNR A;  1US1 A;  3IAQ A;  4OK4 A;  1IVV A;  1ULV A;  5GW7 A;  4FNQ A;  3VD5 A;  1Z45 A;  3AMO B;  3CV5 A;  2EAC A;  3BUI A;  4RNL A;  3I3D A;  3S4A A;  3CZJ A;  1F4H A;  3IMH A;  1WMO A;  1D6Y A;  4KFF A;  3MUY 1;  3NRE A;  2BRV X;  2CFK A;  3Q1N A;  3CZS A;  1AVK A;  1LF9 A;  3VDB A;  3BVU A;  3T0A A;  1WMP A;  3BUB A;  1QAK A;  1L7J A;  1HN1 A;  1K1Y A;  1MMZ A;  1TQW A;  3A0O A;  3I3B A;  3BLB A;  4EV5 A;  1QWU A;  2FUT A;  4OK2 A;  1PU4 A;  3N9H A;  3VD4 A;  1C82 A;  3ACT A;  1MMY A;  2XHN A;  3X40 A;  2CFD A;  3VD3 A;  1N7Q A;  2HTB A;  3T0D A;  3D51 A;  2WVX A;  2OOV C;  5A1A A;  4FNT A;  1OAC A;  2WW3 A;  2CQT A;  4KTP A;  2F7O A;  1JZ3 A;  2CWT A;  2OQE C;  1MMU A;  4KFD A;  2CG1 A;  2WW1 A;  3BVT A;  4KFE A;  1OJN A;  5CA3 A;  3X3X A;  3NBB A;  3D4Z A;  2WDA A;  1N7P A;  2WYH A;  4AQ0 A;  3S4C A;  1NS8 A;  2RDY A;  1RKY A;  2ZXQ A;  1SNZ A;  2JKA A;  1EKM A;  3RSY A;  2BRW A;  1JZ6 A;  1N7R A;  1LXM A;  2F7Q A;  2FYV A;  1CB8 A;  4K35 A;  2PNC A;  3T0U A;  2EAB A;  1RWC A;  3MI6 A;  1R34 A;  2CIR A;  3D50 A;  3EJS A;  3IAP A;  1NSZ A;  1O7D D;  2ZL8 A;  3T2O A;  1X1H A;  5KBP A;  1J0N A;  1LF6 A;  2WOF A;  2F1B A;  3W7S A;  3BUQ A;  3MUZ 1;  2YX9 A;  2Q1F A;  3CZN A;  4FNV A;  3HIG A;  1JZ8 A;  1QAL A;  2OW7 A;  1JYV A;  2WZS A;  3E80 A;  2F7P A;  3VDA A;  3PGB A;  3KN4 A;  3WIR A;  1UI8 A;  2F18 A;  3X41 A;  2WGQ A;  3W7T A;  1TQU A;  1DP0 A;  1J0M A;  1LUR A;  1IQY A;  3DYM A;  1NSR A;  3D52 A;  1W6C A;  3MV1 1;  1RWG A;  3WA2 X;  1I8Q A;  3NBJ A;  5JMF A;  1D6U A;  3EJQ A;  2FUQ A;  3BS6 A;  4BZG A;  1F9G A;  1PX3 A;  3T2Q A;  3HI7 A;  3QG0 A;  1NS7 A;  3VSM A;  3I3E A;  1HM2 A;  3DX1 A;  1TQS A;  4J5T A;  1YGA A;  3WA3 A;  1SPU A;  1LOH A;  3QFY A;  3S4D A;  3BUP A;  1SO0 A;  1TQT A;  3VD7 A;  3KII A;  1QAF A;  2WO0 A;  3BGA A;  3WVF A;  1NS4 A;  2CG0 A;  1K1X A;  1UG9 A;  1HXK A;  1TXK A;  2CFL A;  1NS2 A;  2C10 A;  2F1A A;  3ALA A;  2D1W A;  3T0B A;  2WW2 A;  4MMI A;  3DCD A;  3HII A;  1W6G A;  1NSX A;  2CIQ A;  2EAE A;  3OBA A;  2OOV A;  3MPH A;  1W7C A;  1OJP A;  1IVW A;  1RJO A;  1JOV A;  1JYX A;  3EJU A;  3X3Z A;  1W2Z A;  3MWX A;  3BLC A;  1TQV A;  2WW0 A;  1LVN A;  3D4Y A;  3BVW A;  1MMX A;  1NSU A;  3TY1 A;  3OB8 A;  3EJP A;  1R33 A;  1JZ4 A;  1QX1 A;  1N7N A;  1SII A;  1SIH A;  3DYP A;  3E7J A;  1RW9 A;  2YFO A;  1HTY A;  3NJX A;  1NSM A;  3BUD A;  3S4B A;  4FNU A;  3K5T A;  1MN0 A;  3J7H A;  2E2U A;  2C11 A;  3RRS A;  2CQS A;  1QWN A;  1TU5 A;  4BZE A;  3W7X A;  1UI7 A;  5JMD A;  1IU7 A;  3VD9 A;  1HN0 A;  1F1S A;  2E2T A;  4NEI A;  1RWA A;  2Y74 A;  3MV0 1;  2D73 A;  1AVL A;  1NSV A;  1JRQ A;  3T09 A;  4DUX A;  2JKE A;  3BVV A;  2WVX B;  2CFG A;  2HTA A;  3DEC A;  4UFC A;  2BT3 A;  1IQX A;  2EAD A;  3AMO A;  3EJR A;  2YFN A;  1V7X A;  3X42 A;  1YQ2 A;  3VSN A;  2CFW A;  2W0Q A;  3WIQ A;  1X1J A;  3DDG A;  2BRP A;  1WMN A;  1JYW A;  1IVX A;  3K25 A;  1HM3 A;  3DX2 A;  3LVT A;  1N9E A;  3SEP A;  1W5Z A;  3WFA A;  3QFZ A;  3AFL A;  1NSS A;  3EJT A;  1OJM A;  4K3A A;  1K1W A;  1PX4 A;  3NJV A;  4FNP A;  2E24 A;  4BZF A;  3DX0 A;  3ECQ A;  4BTX A;  1F4A A;  2XN1 A;  2ALW A;  4BTY A;  1A2V A;  3T2P A;  2CIS A;  4KTR A;  3DDF A;  2WCO A;  2OW6 A;  1HWW A;  2WVY A;  1V7V A;  4OJZ A;  3D3I A;  2XSG A;  2X03 A;  2WVZ A;  1PS3 A;  2OQE A;  1W3Y A;  4BTW A;  3OS7 A;  3LOY A;  1JZ7 A;  1DYU A;  1V7W A;  4TTG A;  1OJO A;  3A24 A;  1NKG A;  1EGU A;  1RWH A;  1D6Z A;  1X1I A;  2XN0 A;  1JYN A;  1L7K A;  2CWU A;  1JZ2 A;  3AFJ A;  3SXX A;  2XN2 A;  4MMH A;  1KSI A;  3W7U A;  2E22 A;  5E1Q A;  2E2V A;  4BZH A;  2WOH A;  4DUW A;  1HMU A;  3VDC A;  4EV2 A;  2JKP A;  2CWV A;  1IVU A;  2WYI A; 
#chains in the Genus database with same CATH homology
 1OJN A;  1NS0 A;  1LOH A;  1SO0 A;  4NEI A;  1RWA A;  1RWF A;  2ZQ0 A;  3MV0 1;  2D73 A;  1NSV A;  3VD7 A;  4DUV A;  3DYO A;  1HMW A;  3BGA A;  1N7O A;  1LXK A;  3E1F 1;  3T09 A;  3WVF A;  2WDA A;  2JKE A;  4DUX A;  1NS4 A;  1N7P A;  1JZ5 A;  2WVX B;  1K1X A;  1UG9 A;  4AQ0 A;  2HTA A;  3DEC A;  3T08 A;  1TXK A;  1NS2 A;  1NS8 A;  2ZXQ A;  1YQ2 A;  3IAQ A;  4OK4 A;  1SNZ A;  3T0B A;  2JKA A;  3VSN A;  2BRW A;  2WW2 A;  1JZ6 A;  4MMI A;  1N7R A;  1LXM A;  1ULV A;  3DCD A;  1CB8 A;  1NSX A;  2CIQ A;  3VD5 A;  1RWC A;  1X1J A;  3OBA A;  1Z45 A;  2BRP A;  2CIR A;  4RNL A;  1JYW A;  3K25 A;  3I3D A;  1OJP A;  1HM3 A;  3IAP A;  1NSZ A;  3CZJ A;  3SEP A;  1F4H A;  1JOV A;  1JYX A;  3IMH A;  3MUY 1;  3T2O A;  3WFA A;  1X1H A;  3NRE A;  1J0N A;  1LF6 A;  3AFL A;  2BRV X;  3MWX A;  1NSS A;  3Q1N A;  1OJM A;  1K1W A;  1PX4 A;  3NJV A;  4BZF A;  2E24 A;  1LF9 A;  3VDB A;  3ECQ A;  3MUZ 1;  1F4A A;  3T0A A;  3BLC A;  2Q1F A;  4FNV A;  2WW0 A;  1JZ8 A;  1L7J A;  1MMX A;  1JYV A;  1HN1 A;  1NSU A;  1K1Y A;  2WZS A;  3E80 A;  3OB8 A;  3TY1 A;  3T2P A;  2CIS A;  1MMZ A;  3VDA A;  3I3B A;  3A0O A;  1JZ4 A;  1N7N A;  2FUT A;  2WCO A;  4OK2 A;  3DYP A;  3E7J A;  2WVY A;  1RW9 A;  4OJZ A;  2XSG A;  3VD4 A;  2X03 A;  1C82 A;  2WVZ A;  1DP0 A;  1W3Y A;  1J0M A;  1LUR A;  1MMY A;  1NSM A;  3NJX A;  2XHN A;  3OS7 A;  3DYM A;  3VD3 A;  1N7Q A;  1JZ7 A;  2HTB A;  3T0D A;  4TTG A;  1OJO A;  1NSR A;  2WVX A;  3A24 A;  3MV1 1;  1NKG A;  1EGU A;  1RWH A;  1RWG A;  1X1I A;  5A1A A;  1JYN A;  1L7K A;  1I8Q A;  1MN0 A;  3J7H A;  5JMF A;  2WW3 A;  1JZ2 A;  4MMH A;  2E22 A;  5E1Q A;  1JZ3 A;  2FUQ A;  3BS6 A;  4BZG A;  4BZH A;  1F9G A;  1PX3 A;  3T2Q A;  1NS7 A;  4BZE A;  3VSM A;  3I3E A;  1MMU A;  1HM2 A;  5JMD A;  4DUW A;  1HMU A;  3VDC A;  2JKP A;  3VD9 A;  4J5T A;  2WW1 A;  1YGA A;  1HN0 A;  1F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...