1NS0A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304q complexed with galactose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
340
structure length
340
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFQCQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 96
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns0A00
1JZ2A 2E24A 1NSSA 1HMWA 1SNZA 1Z45A 2E22A 1J0MA 1N7OA 3T09A 1NSRA 1TXKA 3I3EA 1YQ2A 1NSMA 3Q1NA 1NS7A 2WW0A 3DYMA 2XHNA 2XSGA 1JZ8A 1HN0A 2JKAA 1N7PA 3VD4A 1F9GA 3NJXA 1K1XA 3MV01 1L7JA 3E1F1 1RWAA 3DYPA 3MWXA 1YGAA 4BZHA 1UG9A 1LF6A 2CISA 1MMUA 2JKPA 1JZ6A 1NS8A 1OJNA 2X03A 1ULVA 1PX3A 3T08A 2BRWA 4DUXA 1K1WA 1LXMA 3CZJA 3NJVA 2WVXB 3NREA 3OS7A 3VD5A 1LURA 1OJOA 2WW2A 3IMHA 1MMXA 3I3DA 3SEPA 3VDAA 4AQ0A 3MUZ1 3IAQA 3MV11 1JZ7A 1F4HA 1JOVA 1RW9A 1HM2A 2D73A 3VD7A 1JYNA 1LF9A 2CIRA 3ECQA 1DP0A 2WVZA 2WZSA 5A1AA 3T0DA 3VDCA 4DUVA 1NSVA 2WW3A 3T2OA 1RWGA 4DUWA 1RWFA 1K1YA 3DCDA 1OJMA 1JYVA 1MN0A 1X1IA 2HTAA 2WVYA 1JYWA 1N7NA 1F1SA 2Q1FA 1HMUA 1JZ3A 1NS0A 1W3YA 3WFAA 1NSXA 1X1HA 1LXKA 5E1QA 4BZFA 1C82A 1MMYA 1CB8A 3T0BA 4RNLA 1JZ4A 3DECA 1J0NA 2JKEA 1X1JA 1I8QA 1JYXA 3T0AA 1LOHA 3BGAA 1PX4A 1MMZA 2ZQ0A 3VDBA 2HTBA 1N7QA 2ZXQA 1RWCA 1RWHA 3DYOA 4BZGA 1JZ5A 3OB8A 4TTGA 1OJPA 2WCOA 2WDAA 3MUY1 3T2QA 1L7KA 1HM3A 2CIQA 3VD3A 1NS4A 3IAPA 1EGUA 2BRPA 1NSZA 2BRVX 3I3BA 3T2PA 3A24A 3J7HA 3VD9A 1SO0A 1NS2A 1NKGA 1NSUA 1HN1A 1F4AA 2WVXA 2WW1A 3K25A 4BZEA 1N7RA 3OBAA
chains in the Genus database with same CATH superfamily
2CWUA 2WOHA 1KSIA 3DDGA 1EKMA 2E24A 1QALA 1W6CA 1HMWA 1Z45A 2PNCA 1IVXA 1N7OA 2CQTA 3D52A 3T09A 1LVNA 2W0QA 1IVWA 3S4BA 1TQTA 1H54A 3WIQA 3MV01 1RWAA 3AMOB 1YGAA 3D50A 3WVFA 1OJNA 2CWTA 3BVUA 1D6ZA 1PX3A 4KTRA 5KBPA 4DUXA 3NJVA 1LURA 2YX9A 2OQEA 4NEIA 1O7DD 3HI7A 1MMXA 3VDAA 1D6YA 1IQYA 3T0DA 1RWFA 1K1YA 4OK4A 2WGQA 1HMUA 1US1A 3BUBA 1QX1A 1JZ3A 3K5TA 1W3YA 4MMIA 3T0BA 4RNLA 2XN1A 3RSYA 1OACA 1QAFA 1I8QA 1JYXA 1PX4A 1MMZA 2ZQ0A 1N7QA 2ZXQA 1W7CA 3DYOA 3CV5A 4BZGA 4TTGA 3OB8A 1HM3A 1JRQA 3VD3A 3ALAA 2OOVC 2ZL8A 3DX0A 3BVXA 3T2PA 2CFLA 5JMDA 3J7HA 3VD9A 3HIGA 3BLCA 1NSUA 3QFYA 2WYHA 1V7XA 3S4CA 4FNPA 2WW1A 3QDEA 3EJSA 1N7RA 2Y74A 3WA3A 2C10A 3EJRA 4OJZA 3T0UA 3I3EA 1NSMA 3WA2X 1IVUA 3Q1NA 1NS7A 2WW0A 3DYMA 1JZ8A 1V7WA 2JKAA 4KFDA 1QWUA 3RRSA 3DYPA 2WOFA 3KN4A 4BZHA 1UG9A 1LF6A 3MPHA 2WO0A 3W7SA 1ULVA 4FNRA 2CFDA 3T08A 4J5TA 1LXMA 1TQSA 3CZSA 4BTYA 2WW2A 3I3DA 3MUZ1 1W2ZA 3IAQA 2OW6A 1JZ7A 1HM2A 2D73A 1JYNA 3ACTA 3DX2A 4DUWA 1OJMA 1JYVA 2HTAA 2WVYA 1D6UA 1N7NA 2Q1FA 3X40A 3BUPA 4UFCA 1WMOA 3PGBA 1X1HA 3HIIA 4KFEA 4BZFA 2YFOA 3BVVA 3SXXA 1CB8A 1J0NA 2CG0A 2BT3A 3T0AA 3BGAA 3W7XA 1RJOA 2FUTA 3VDBA 2XN2A 1HXKA 4FNUA 1N9EA 2WCOA 3MUY1 1L7KA 2CIQA 2CFKA 3IAPA 2Y73A 3DX4A 1TQUA 2BRPA 1AVLA 2F18A 3CZNA 2BRVX 3I3BA 1R34A 1NS2A 5CA3A 1UI8A 3DX3A 3K25A 3VSNA 3X3XA 3X42A 3EJUA 1NSSA 2E22A 1J0MA 2FYVA 2OQEC 1YQ2A 2XHNA 2XSGA 3VD4A 1SPUA 3E1F1 3MWXA 1MMUA 2JKPA 1RKYA 1NS8A 4MMHA 1W6GA 2F7RA 1K1WA 2EACA 4EV2A 1OJOA 4AQ0A 3SEPA 3S4AA 3X41A 3VD7A 2CIRA 1DP0A 2WVZA 2WZSA 5A1AA 3VDCA 1NSVA 2C11A 2WW3A 3T2OA 3WIRA 1MN0A 3E80A 1A2VA 1R33A 1NS0A 3AFLA 1NSXA 1LXKA 1DYUA 5E1QA 3NBBA 1C82A 1JZ4A 5GW7A 3DECA 2FUQA 1X1JA 3D3IA 3DDFA 5JMFA 4EV5A 3DX1A 2HTBA 1QWNA 1RWCA 3KIIA 1AV4A 1OJPA 3W7WA 1EGUA 3BLBA 3EJTA 3BUQA 1SIIA 1WMPA 1SO0A 2OW7A 4FNQA 3N9HA 1QAKA 2WVXA 1IU7A 3A0OA 3TY1A 4BZEA 4BTXA 1PS3A 1JZ2A 3W7UA 2CWVA 3MI6A 2F1BA 1SNZA 4FNSA 2E2VA 1NSRA 1SIHA 1TXKA 3D4YA 2OOVA 3EJQA 2CG1A 3SX1A 4K35A 1HN0A 1N7PA 3X3YA 1F9GA 3NJXA 1K1XA 1L7JA 2XN0A 2F1AA 2CISA 1JZ6A 2WYIA 3QG0A 2X03A 2BRWA 3CZJA 3OS7A 2WVXB 3NREA 3VD5A 4FNVA 2CFGA 2EAEA 3VSMA 3IMHA 3E7JA 3BVWA 4BTWA 2D1WA 3MV11 1F4HA 1JOVA 1TQWA 1RW9A 1LF9A 3ECQA 3D4ZA 1HWWA 4DUVA 2RDYA 1RWGA 3DCDA 3BVTA 2F7PA 1X1IA 1IVVA 4FNTA 3QFZA 1JYWA 4K3AA 1F1SA 3LVTA 1HTYA 2E2UA 3LOYA 1W5ZA 4OK2A 2YFNA 2E2TA 3WFAA 3EJPA 1TU5A 1MMYA 4KFFA 1AVKA 2ALWA 2JKEA 2F7OA 3AFJA 3BUDA 1LOHA 2EABA 1TQVA 4KTPA 2CQSA 1RWHA 1W4NA 3BS6A 1JZ5A 2EADA 2WDAA 3T2QA 1PU4A 1NS4A 1UI7A 1V7VA 2CFWA 3AMOA 3W7TA 3A24A 1WMNA 3X3ZA 2F7QA 3BUIA 3S4DA 1NKGA 1IQXA 3D51A 3NBJA 1HN1A 1F4AA 3ACSA 1NSZA 3OBAA
chains in the Genus database with same CATH topology
1JZ2A 2E24A 4OJZA 1NSSA 1HMWA 1SNZA 1Z45A 2E22A 1J0MA 1N7OA 3T09A 1NSRA 1TXKA 3I3EA 1YQ2A 1NSMA 3Q1NA 1NS7A 2WW0A 3DYMA 2XHNA 2XSGA 1JZ8A 1HN0A 2JKAA 1N7PA 3VD4A 1F9GA 3NJXA 1K1XA 3MV01 1L7JA 3E1F1 1RWAA 3DYPA 3MWXA 1YGAA 4BZHA 1UG9A 1LF6A 2CISA 1MMUA 2JKPA 3WVFA 1JZ6A 1NS8A 1OJNA 2X03A 4MMHA 1ULVA 1PX3A 3T08A 2BRWA 4J5TA 4DUXA 1K1WA 1LXMA 3CZJA 3NJVA 2WVXB 3NREA 3OS7A 3VD5A 1LURA 4FNVA 4NEIA 1OJOA 2WW2A 3IMHA 3VSMA 1MMXA 3I3DA 3SEPA 3E7JA 3VDAA 4AQ0A 3MUZ1 3IAQA 3MV11 1JZ7A 1F4HA 1JOVA 1RW9A 1HM2A 2D73A 3VD7A 1JYNA 1LF9A 2CIRA 3ECQA 1DP0A 2WVZA 2WZSA 5A1AA 3T0DA 3VDCA 4DUVA 1NSVA 2WW3A 3T2OA 1RWGA 4DUWA 1RWFA 1K1YA 3DCDA 1OJMA 4OK4A 1JYVA 1MN0A 1X1IA 2HTAA 3VSNA 3E80A 2WVYA 1JYWA 1N7NA 1F1SA 2Q1FA 1HMUA 1JZ3A 1NS0A 4OK2A 1W3YA 3AFLA 3WFAA 1NSXA 1X1HA 1LXKA 5E1QA 4MMIA 4BZFA 1C82A 1MMYA 1CB8A 3T0BA 4RNLA 1JZ4A 3DECA 2FUQA 1J0NA 2JKEA 1X1JA 1I8QA 1JYXA 3T0AA 1LOHA 5JMFA 3BGAA 1PX4A 1MMZA 2ZQ0A 2FUTA 3VDBA 2HTBA 1N7QA 2ZXQA 1RWCA 1RWHA 3BS6A 3DYOA 4BZGA 3OB8A 1JZ5A 4TTGA 1OJPA 2WCOA 2WDAA 3MUY1 3T2QA 1L7KA 1HM3A 2CIQA 3VD3A 1NS4A 3IAPA 1EGUA 2BRPA 1NSZA 2BRVX 3I3BA 3T2PA 3A24A 5JMDA 3J7HA 3VD9A 1SO0A 1NS2A 1NKGA 3BLCA 1NSUA 1HN1A 1F4AA 2WVXA 2WW1A 3A0OA 3K25A 3TY1A 4BZEA 1N7RA 3OBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZ2 A;  2E24 A;  1NSS A;  1HMW A;  1SNZ A;  1Z45 A;  2E22 A;  1J0M A;  1N7O A;  3T09 A;  1NSR A;  1TXK A;  3I3E A;  1YQ2 A;  1NSM A;  3Q1N A;  1NS7 A;  2WW0 A;  3DYM A;  2XHN A;  2XSG A;  1JZ8 A;  1HN0 A;  2JKA A;  1N7P A;  3VD4 A;  1F9G A;  3NJX A;  1K1X A;  3MV0 1;  1L7J A;  3E1F 1;  1RWA A;  3DYP A;  3MWX A;  1YGA A;  4BZH A;  1UG9 A;  1LF6 A;  2CIS A;  1MMU A;  2JKP A;  1JZ6 A;  1NS8 A;  1OJN A;  2X03 A;  1ULV A;  1PX3 A;  3T08 A;  2BRW A;  4DUX A;  1K1W A;  1LXM A;  3CZJ A;  3NJV A;  2WVX B;  3NRE A;  3OS7 A;  3VD5 A;  1LUR A;  1OJO A;  2WW2 A;  3IMH A;  1MMX A;  3I3D A;  3SEP A;  3VDA A;  4AQ0 A;  3MUZ 1;  3IAQ A;  3MV1 1;  1JZ7 A;  1F4H A;  1JOV A;  1RW9 A;  1HM2 A;  2D73 A;  3VD7 A;  1JYN A;  1LF9 A;  2CIR A;  3ECQ A;  1DP0 A;  2WVZ A;  2WZS A;  5A1A A;  3T0D A;  3VDC A;  4DUV A;  1NSV A;  2WW3 A;  3T2O A;  1RWG A;  4DUW A;  1RWF A;  1K1Y A;  3DCD A;  1OJM A;  1JYV A;  1MN0 A;  1X1I A;  2HTA A;  2WVY A;  1JYW A;  1N7N A;  1F1S A;  2Q1F A;  1HMU A;  1JZ3 A;  1NS0 A;  1W3Y A;  3WFA A;  1NSX A;  1X1H A;  1LXK A;  5E1Q A;  4BZF A;  1C82 A;  1MMY A;  1CB8 A;  3T0B A;  4RNL A;  1JZ4 A;  3DEC A;  1J0N A;  2JKE A;  1X1J A;  1I8Q A;  1JYX A;  3T0A A;  1LOH A;  3BGA A;  1PX4 A;  1MMZ A;  2ZQ0 A;  3VDB A;  2HTB A;  1N7Q A;  2ZXQ A;  1RWC A;  1RWH A;  3DYO A;  4BZG A;  1JZ5 A;  3OB8 A;  4TTG A;  1OJP A;  2WCO A;  2WDA A;  3MUY 1;  3T2Q A;  1L7K A;  1HM3 A;  2CIQ A;  3VD3 A;  1NS4 A;  3IAP A;  1EGU A;  2BRP A;  1NSZ A;  2BRV X;  3I3B A;  3T2P A;  3A24 A;  3J7H A;  3VD9 A;  1SO0 A;  1NS2 A;  1NKG A;  1NSU A;  1HN1 A;  1F4A A;  2WVX A;  2WW1 A;  3K25 A;  4BZE A;  1N7R A;  3OBA A; 
#chains in the Genus database with same CATH topology
 2CWU A;  2WOH A;  1KSI A;  3DDG A;  1EKM A;  2E24 A;  1QAL A;  1W6C A;  1HMW A;  1Z45 A;  2PNC A;  1IVX A;  1N7O A;  2CQT A;  3D52 A;  3T09 A;  1LVN A;  2W0Q A;  1IVW A;  3S4B A;  1TQT A;  1H54 A;  3WIQ A;  3MV0 1;  1RWA A;  3AMO B;  1YGA A;  3D50 A;  3WVF A;  1OJN A;  2CWT A;  3BVU A;  1D6Z A;  1PX3 A;  4KTR A;  5KBP A;  4DUX A;  3NJV A;  1LUR A;  2YX9 A;  2OQE A;  4NEI A;  1O7D D;  3HI7 A;  1MMX A;  3VDA A;  1D6Y A;  1IQY A;  3T0D A;  1RWF A;  1K1Y A;  4OK4 A;  2WGQ A;  1HMU A;  1US1 A;  3BUB A;  1QX1 A;  1JZ3 A;  3K5T A;  1W3Y A;  4MMI A;  3T0B A;  4RNL A;  2XN1 A;  3RSY A;  1OAC A;  1QAF A;  1I8Q A;  1JYX A;  1PX4 A;  1MMZ A;  2ZQ0 A;  1N7Q A;  2ZXQ A;  1W7C A;  3DYO A;  3CV5 A;  4BZG A;  4TTG A;  3OB8 A;  1HM3 A;  1JRQ A;  3VD3 A;  3ALA A;  2OOV C;  2ZL8 A;  3DX0 A;  3BVX A;  3T2P A;  2CFL A;  5JMD A;  3J7H A;  3VD9 A;  3HIG A;  3BLC A;  1NSU A;  3QFY A;  2WYH A;  1V7X A;  3S4C A;  4FNP A;  2WW1 A;  3QDE A;  3EJS A;  1N7R A;  2Y74 A;  3WA3 A;  2C10 A;  3EJR A;  4OJZ A;  3T0U A;  3I3E A;  1NSM A;  3WA2 X;  1IVU A;  3Q1N A;  1NS7 A;  2WW0 A;  3DYM A;  1JZ8 A;  1V7W A;  2JKA A;  4KFD A;  1QWU A;  3RRS A;  3DYP A;  2WOF A;  3KN4 A;  4BZH A;  1UG9 A;  1LF6 A;  3MPH A;  2WO0 A;  3W7S A;  1ULV A;  4FNR A;  2CFD A;  3T08 A;  4J5T A;  1LXM A;  1TQS A;  3CZS A;  4BTY A;  2WW2 A;  3I3D A;  3MUZ 1;  1W2Z A;  3IAQ A;  2OW6 A;  1JZ7 A;  1HM2 A;  2D73 A;  1JYN A;  3ACT A;  3DX2 A;  4DUW A;  1OJM A;  1JYV A;  2HTA A;  2WVY A;  1D6U A;  1N7N A;  2Q1F A;  3X40 A;  3BUP A;  4UFC A;  1WMO A;  3PGB A;  1X1H A;  3HII A;  4KFE A;  4BZF A;  2YFO A;  3BVV A;  3SXX A;  1CB8 A;  1J0N A;  2CG0 A;  2BT3 A;  3T0A A;  3BGA A;  3W7X A;  1RJO A;  2FUT A;  3VDB A;  2XN2 A;  1HXK A;  4FNU A;  1N9E A;  2WCO A;  3MUY 1;  1L7K A;  2CIQ A;  2CFK A;  3IAP A;  2Y73 A;  3DX4 A;  1TQU A;  2BRP A;  1AVL A;  2F18 A;  3CZN A;  2BRV X;  3I3B A;  1R34 A;  1NS2 A;  5CA3 A;  1UI8 A;  3DX3 A;  3K25 A;  3VSN A;  3X3X A;  3X42 A;  3EJU A;  1NSS A;  2E22 A;  1J0M A;  2FYV A;  2OQE C;  1YQ2 A;  2XHN A;  2XSG A;  3VD4 A;  1SPU A;  3E1F 1;  3MWX A;  1MMU A;  2JKP A;  1RKY A;  1NS8 A;  4MMH A;  1W6G A;  2F7R A;  1K1W A;  2EAC A;  4EV2 A;  1OJO A;  4AQ0 A;  3SEP A;  3S4A A;  3X41 A;  3VD7 A;  2CIR A;  1DP0 A;  2WVZ A;  2WZS A;  5A1A A;  3VDC A;  1NSV A;  2C11 A;  2WW3 A;  3T2O A;  3WIR A;  1MN0 A;  3E80 A;  1A2V A;  1R33 A;  1NS0 A;  3AFL A;  1NSX A;  1LXK A;  1DYU A;  5E1Q A;  3NBB A;  1C82 A;  1JZ4 A;  5GW7 A;  3DEC A;  2FUQ A;  1X1J A;  3D3I A;  3DDF A;  5JMF A;  4EV5 A;  3DX1 A;  2HTB A;  1QWN A;  1RWC A;  3KII A;  1AV4 A;  1OJP A;  3W7W A;  1EGU A;  3BLB A;  3EJT A;  3BUQ A;  1SII A;  1WMP A;  1SO0 A;  2OW7 A;  4FNQ A;  3N9H A;  1QAK A;  2WVX A;  1IU7 A;  3A0O A;  3TY1 A;  4BZE A;  4BTX A;  1PS3 A;  1JZ2 A;  3W7U A;  2CWV A;  3MI6 A;  2F1B A;  1SNZ A;  4FNS A;  2E2V A;  1NSR A;  1SIH A;  1TXK A;  3D4Y A;  2OOV A;  3EJQ A;  2CG1 A;  3SX1 A;  4K35 A;  1HN0 A;  1N7P A;  3X3Y A;  1F9G A;  3NJX A;  1K1X A;  1L7J A;  2XN0 A;  2F1A A;  2CIS A;  1JZ6 A;  2WYI A;  3QG0 A;  2X03 A;  2BRW A;  3CZJ A;  3OS7 A;  2WVX B;  3NRE A;  3VD5 A;  4FNV A;  2CFG A;  2EAE A;  3VSM A;  3IMH A;  3E7J A;  3BVW A;  4BTW A;  2D1W A;  3MV1 1;  1F4H A;  1JOV A;  1TQW A;  1RW9 A;  1LF9 A;  3ECQ A;  3D4Z A;  1HWW A;  4DUV A;  2RDY A;  1RWG A;  3DCD A;  3BVT A;  2F7P A;  1X1I A;  1IVV A;  4FNT A;  3QFZ A;  1JYW A;  4K3A A;  1F1S A;  3LVT A;  1HTY A;  2E2U A;  3LOY A;  1W5Z A;  4OK2 A;  2YFN A;  2E2T A;  3WFA A;  3EJP A;  1TU5 A;  1MMY A;  4KFF A;  1AVK A;  2ALW A;  2JKE A;  2F7O A;  3AFJ A;  3BUD A;  1LOH A;  2EAB A;  1TQV A;  4KTP A;  2CQS A;  1RWH A;  1W4N A;  3BS6 A;  1JZ5 A;  2EAD A;  2WDA A;  3T2Q A;  1PU4 A;  1NS4 A;  1UI7 A;  1V7V A;  2CFW A;  3AMO A;  3W7T A;  3A24 A;  1WMN A;  3X3Z A;  2F7Q A;  3BUI A;  3S4D A;  1NKG A;  1IQX A;  3D51 A;  3NBJ A;  1HN1 A;  1F4A A;  3ACS A;  1NSZ A;  3OBA A; 
#chains in the Genus database with same CATH homology
 1JZ2 A;  2E24 A;  4OJZ A;  1NSS A;  1HMW A;  1SNZ A;  1Z45 A;  2E22 A;  1J0M A;  1N7O A;  3T09 A;  1NSR A;  1TXK A;  3I3E A;  1YQ2 A;  1NSM A;  3Q1N A;  1NS7 A;  2WW0 A;  3DYM A;  2XHN A;  2XSG A;  1JZ8 A;  1HN0 A;  2JKA A;  1N7P A;  3VD4 A;  1F9G A;  3NJX A;  1K1X A;  3MV0 1;  1L7J A;  3E1F 1;  1RWA A;  3DYP A;  3MWX A;  1YGA A;  4BZH A;  1UG9 A;  1LF6 A;  2CIS A;  1MMU A;  2JKP A;  3WVF A;  1JZ6 A;  1NS8 A;  1OJN A;  2X03 A;  4MMH A;  1ULV A;  1PX3 A;  3T08 A;  2BRW A;  4J5T A;  4DUX A;  1K1W A;  1LXM A;  3CZJ A;  3NJV A;  2WVX B;  3NRE A;  3OS7 A;  3VD5 A;  1LUR A;  4FNV A;  4NEI A;  1OJO A;  2WW2 A;  3IMH A;  3VSM A;  1MMX A;  3I3D A;  3SEP A;  3E7J A;  3VDA A;  4AQ0 A;  3MUZ 1;  3IAQ A;  3MV1 1;  1JZ7 A;  1F4H A;  1JOV A;  1RW9 A;  1HM2 A;  2D73 A;  3VD7 A;  1JYN A;  1LF9 A;  2CIR A;  3ECQ A;  1DP0 A;  2WVZ A;  2WZS A;  5A1A A;  3T0D A;  3VDC A;  4DUV A;  1NSV A;  2WW3 A;  3T2O A;  1RWG A;  4DUW A;  1RWF A;  1K1Y A;  3DCD A;  1OJM A;  4OK4 A;  1JYV A;  1MN0 A;  1X1I A;  2HTA A;  3VSN A;  3E80 A;  2WVY A;  1JYW A;  1N7N A;  1F1S A;  2Q1F A;  1HMU A;  1JZ3 A;  1NS0 A;  4OK2 A;  1W3Y A;  3AFL A;  3WFA A;  1NSX A;  1X1H A;  1LXK A;  5E1Q A;  4MMI A;  4BZF A;  1C82 A;  1MMY A;  1CB8 A;  3T0B A;  4RNL A;  1JZ4 A;  3DEC A;  2FUQ A;  1J0N A;  2JKE A;  1X1J A;  1I8Q A;  1JYX A;  3T0A A;  1LOH A;  5JMF A;  3BGA A;  1PX4 A;  1MMZ A;  2ZQ0 A;  2FUT A;  3VDB A;  2HTB A;  1N7Q A;  2ZXQ A;  1RWC A;  1RWH A;  3BS6 A;  3DYO A;  4BZG A;  3OB8 A;  1JZ5 A;  4TTG A;  1OJP A;  2WCO A;  2WDA A;  3MUY 1;  3T2Q A;  1L7K A;  1HM3 A;  2CIQ A;  3VD3 A;  1NS4 A;  3IAP A;  1EGU A;  2BRP A;  1NSZ A;  2BRV X;  3I3B A;  3T2P A;  3A24 A;  5JMD A;  3J7H A;  3VD9 A;  1SO0 A;  1NS2 A;  1NKG A;  3BLC A;  1NSU A;  1HN1 A;  1F4A A;  2WVX A;  2WW1 A;  3A0O A;  3K25 A;  3TY1 A;  4BZE A;  1N7R A;  3OBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...