1NS0A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304q complexed with galactose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
340
structure length
340
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFQCQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 96
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns0A00
1J0MA 1W3YA 1LXMA 2CISA 2HTBA 1HMWA 1K1YA 1LURA 2CIQA 1F1SA 3VD7A 3IMHA 1JZ6A 2BRPA 1OJPA 2WVYA 1HM2A 1NS7A 3VD5A 1PX4A 3VD3A 3VD4A 4DUWA 2CIRA 2WW1A 2WW3A 3J7HA 1NS0A 1NS4A 3I3DA 1JOVA 1NSZA 2ZQ0A 1L7JA 2X03A 1LXKA 1JZ4A 1SO0A 3T08A 3DECA 2WZSA 1N7QA 1MMZA 2WW0A 3DYOA 3MV11 3OB8A 1K1WA 3T2OA 1JZ7A 2XHNA 1OJMA 3K25A 1RWFA 4TTGA 1LOHA 1MMUA 1SNZA 3DYMA 1HN1A 3I3BA 1NSVA 2E22A 1K1XA 1NSRA 3NJVA 1NSUA 1N7OA 1RW9A 1Z45A 1N7NA 1JYNA 4BZGA 1NSMA 5E1QA 4BZEA 2WVZA 2WVXA 3MV01 3WFAA 3T0AA 3MUZ1 1MMXA 2ZXQA 3MWXA 1NS2A 1X1HA 3NREA 1TXKA 2HTAA 1N7RA 1NS8A 3DCDA 3VDBA 3BGAA 3NJXA 1MN0A 2E24A 3CZJA 2BRWA 4BZFA 1LF9A 1HM3A 3OBAA 1OJOA 2JKPA 1PX3A 1RWAA 3MUY1 3A24A 4BZHA 5A1AA 1JZ8A 1F9GA 3T0DA 1MMYA 1CB8A 1OJNA 1DP0A 1RWHA 1JZ3A 3T2QA 3T09A 4DUXA 3SEPA 1N7PA 3T0BA 1JYVA 2WDAA 2WW2A 1UG9A 1YGAA 3I3EA 2Q1FA 4RNLA 1RWGA 1LF6A 3E1F1 1F4AA 1I8QA 1F4HA 2XSGA 1NSXA 3ECQA 2JKEA 1X1IA 1EGUA 1C82A 2BRVX 3IAPA 3VDCA 1YQ2A 1RWCA 2JKAA 3DYPA 4AQ0A 3OS7A 3VDAA 1L7KA 2WCOA 3VD9A 2D73A 3IAQA 1NSSA 4DUVA 1JYXA 1J0NA 1JZ5A 3T2PA 1JYWA 1HN0A 2WVXB 1X1JA 1JZ2A 3Q1NA 1HMUA 1NKGA 1ULVA
chains in the Genus database with same CATH superfamily
1H54A 1J0MA 3HIIA 3AFLA 4NEIA 2BRPA 2YFNA 1PS3A 1LVNA 2WVYA 2WGQA 2OW7A 2CIRA 2FYVA 2WW3A 3W7WA 1JZ4A 1N7QA 3VSNA 1IVWA 1JZ7A 1W5ZA 3D4YA 3TY1A 3AFJA 5GW7A 2E22A 1QWUA 3NJVA 1N7OA 1N7NA 1WMPA 3BLBA 1JYNA 2ZL8A 3BUQA 1A2VA 3WFAA 4MMHA 3WIQA 1MMXA 3CV5A 3WA2X 2ZXQA 3K5TA 2PNCA 2HTAA 3VDBA 1NS8A 2OOVA 4FNUA 2OW6A 1HXKA 3CZJA 1HM3A 1WMOA 1OJOA 1WMNA 1V7VA 3EJSA 1IVXA 1W6GA 2BT3A 3W7TA 1QAKA 2CWVA 1JZ8A 2F7RA 4KTRA 1CB8A 1OJNA 1RWHA 2D1WA 3DX2A 1N7PA 3T0BA 4FNPA 1UG9A 3X42A 1YGAA 4J5TA 4RNLA 1I8QA 3QDEA 2F1BA 3D51A 1NSXA 2JKEA 3HI7A 4BTYA 1C82A 1EGUA 1RWCA 3DYPA 3OS7A 3VDAA 3DX4A 4DUVA 2CFWA 1JYWA 1HWWA 2CFGA 2WDAA 4MMIA 3X3XA 1LXMA 3DX3A 2E2TA 1LURA 2E2VA 3WVFA 3BUDA 3EJPA 1JZ6A 2F18A 1RJOA 1HM2A 1TU5A 1NS7A 3BVTA 3VD3A 4DUWA 4KFFA 2XN1A 4FNQA 2Y74A 2F7QA 2F7PA 1SO0A 2CWUA 3DECA 2WZSA 2WW0A 5CA3A 3OB8A 4KFDA 1IVVA 2XHNA 1OJMA 3K25A 4EV2A 1LOHA 1MMUA 3DYMA 3D50A 4UFCA 1W4NA 1K1XA 1JRQA 3D52A 2ALWA 1SIHA 2OOVC 1R33A 2WVXA 1D6YA 3HIGA 4K35A 1NS2A 1AVLA 1D6UA 1X1HA 3EJUA 1MN0A 2BRWA 3A0OA 2OQEC 1PX3A 4BZHA 2F7OA 1R34A 3QFYA 3T0DA 4BTWA 2YX9A 3DX0A 2W0QA 1W6CA 3SEPA 1KSIA 1JYVA 2WW2A 1AVKA 3RSYA 1N9EA 3SX1A 2WOFA 2XSGA 2WOHA 3ECQA 4OK2A 2BRVX 3IAPA 4FNSA 2JKAA 1EKMA 2FUTA 3VD9A 2EACA 1QALA 4OJZA 3W7XA 2OQEA 3EJRA 3X3ZA 1J0NA 1JZ5A 3BVUA 1V7WA 1IVUA 2YFOA 3DDFA 4EV5A 2HTBA 2CISA 1HMWA 1K1YA 1V7XA 2CIQA 3VD7A 3IMHA 3DDGA 3VD5A 2WW1A 3AMOB 3J7HA 3LOYA 2ZQ0A 4FNRA 4KFEA 3RRSA 1W7CA 2E2UA 1TQWA 1MMZA 4OK4A 3DYOA 3T2OA 3CZNA 1IQXA 1SNZA 3D3IA 1HN1A 1US1A 1NSVA 4FNTA 1RKYA 1NSUA 4BZGA 3D4ZA 1O7DD 1NSMA 5E1QA 2WVZA 3NBBA 3MUZ1 2C11A 3W7SA 3MWXA 3KN4A 3NREA 1TXKA 3BGAA 3MPHA 3NJXA 2E24A 3WA3A 3E80A 3OBAA 2JKPA 3BUPA 2CFKA 1OACA 3BVXA 1QWNA 2CQTA 1F9GA 3DX1A 3EJQA 3LVTA 3BVWA 1JZ3A 3T2QA 3T09A 4DUXA 3X3YA 4K3AA 3I3EA 1SPUA 1RWGA 1TQUA 1LF6A 1D6ZA 2CG0A 2EADA 5KBPA 2WO0A 1X1IA 2XN0A 1SIIA 3BVVA 3S4CA 4AQ0A 3IAQA 1JYXA 3NBJA 3T2PA 1HN0A 3T0UA 1X1JA 3Q1NA 3SXXA 1AV4A 1NKGA 1W3YA 3S4AA 1F1SA 5JMFA 1OJPA 2CG1A 2C10A 1PX4A 3VD4A 3KIIA 1NS0A 1NS4A 3I3DA 1JOVA 1NSZA 3VSMA 1L7JA 2X03A 1LXKA 5JMDA 3T08A 3X41A 3MV11 2XN2A 1K1WA 1PU4A 2CQSA 1RWFA 4TTGA 3I3BA 1TQTA 1DYUA 3X40A 1NSRA 3BUIA 3ALAA 1IU7A 1RW9A 1Z45A 1IQYA 2CFLA 4BZEA 3MV01 3BLCA 1W2ZA 3T0AA 1TQSA 3S4DA 3WIRA 4KTPA 3BUBA 3QFZA 1QX1A 2CWTA 3DCDA 1N7RA 1UI8A 3AMOA 4FNVA 4BZFA 1LF9A 2WYIA 1RWAA 3PGBA 3MUY1 3A24A 3W7UA 2CFDA 2EABA 5A1AA 1MMYA 1TQVA 1DP0A 1QAFA 3S4BA 1HTYA 2Y73A 2Q1FA 2FUQA 4BTXA 3E1F1 2RDYA 1F4AA 1F4HA 2WYHA 3CZSA 3E7JA 3EJTA 3VDCA 1UI7A 3QG0A 1YQ2A 3BS6A 3MI6A 3ACSA 1L7KA 2WCOA 2D73A 1NSSA 3ACTA 3N9HA 2WVXB 1JZ2A 2EAEA 2F1AA 1HMUA 1ULVA
chains in the Genus database with same CATH topology
1J0MA 1W3YA 1LXMA 2CISA 2HTBA 1HMWA 1K1YA 1LURA 2CIQA 1F1SA 3AFLA 4NEIA 3IMHA 3VD7A 3WVFA 1JZ6A 2BRPA 5JMFA 1OJPA 2WVYA 1HM2A 1NS7A 3VD5A 1PX4A 3VD3A 3VD4A 4DUWA 2CIRA 2WW1A 2WW3A 3J7HA 1NS0A 1NS4A 3I3DA 1JOVA 1NSZA 2ZQ0A 1L7JA 3VSMA 2X03A 1LXKA 5JMDA 1JZ4A 1SO0A 3T08A 3DECA 2WZSA 1N7QA 1MMZA 2WW0A 4OK4A 3VSNA 3DYOA 3MV11 3OB8A 1K1WA 3T2OA 1JZ7A 2XHNA 1OJMA 3K25A 1RWFA 4TTGA 1LOHA 1MMUA 1SNZA 3DYMA 1HN1A 3I3BA 3TY1A 1NSVA 2E22A 1K1XA 1NSRA 3NJVA 1NSUA 1N7OA 1RW9A 1Z45A 1N7NA 1JYNA 4BZGA 1NSMA 5E1QA 4BZEA 2WVZA 2WVXA 3MV01 3BLCA 3WFAA 3T0AA 3MUZ1 4MMHA 1MMXA 2ZXQA 3MWXA 1NS2A 1X1HA 3NREA 1TXKA 2HTAA 1N7RA 1NS8A 3DCDA 3VDBA 3BGAA 3NJXA 1MN0A 2E24A 3CZJA 2BRWA 3A0OA 4FNVA 4BZFA 3E80A 1LF9A 1HM3A 3OBAA 1OJOA 2JKPA 1PX3A 1RWAA 3MUY1 3A24A 4BZHA 5A1AA 1JZ8A 1F9GA 3T0DA 1MMYA 1CB8A 1OJNA 1DP0A 1RWHA 1JZ3A 3T2QA 3T09A 4DUXA 3SEPA 1N7PA 3T0BA 1JYVA 2WDAA 2WW2A 1UG9A 1YGAA 4J5TA 3I3EA 2Q1FA 2FUQA 4RNLA 1RWGA 1LF6A 3E1F1 1F4AA 1I8QA 1F4HA 2XSGA 3E7JA 1NSXA 3ECQA 2JKEA 1X1IA 1EGUA 1C82A 2BRVX 3IAPA 4OK2A 3VDCA 1YQ2A 1RWCA 2JKAA 3DYPA 2FUTA 4AQ0A 3BS6A 3OS7A 3VDAA 1L7KA 2WCOA 3VD9A 2D73A 3IAQA 4OJZA 1NSSA 4DUVA 1JYXA 1J0NA 1JZ5A 3T2PA 1JYWA 1HN0A 2WVXB 1X1JA 1JZ2A 3Q1NA 1HMUA 4MMIA 1NKGA 1ULVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0M A;  1W3Y A;  1LXM A;  2CIS A;  2HTB A;  1HMW A;  1K1Y A;  1LUR A;  2CIQ A;  1F1S A;  3VD7 A;  3IMH A;  1JZ6 A;  2BRP A;  1OJP A;  2WVY A;  1HM2 A;  1NS7 A;  3VD5 A;  1PX4 A;  3VD3 A;  3VD4 A;  4DUW A;  2CIR A;  2WW1 A;  2WW3 A;  3J7H A;  1NS0 A;  1NS4 A;  3I3D A;  1JOV A;  1NSZ A;  2ZQ0 A;  1L7J A;  2X03 A;  1LXK A;  1JZ4 A;  1SO0 A;  3T08 A;  3DEC A;  2WZS A;  1N7Q A;  1MMZ A;  2WW0 A;  3DYO A;  3MV1 1;  3OB8 A;  1K1W A;  3T2O A;  1JZ7 A;  2XHN A;  1OJM A;  3K25 A;  1RWF A;  4TTG A;  1LOH A;  1MMU A;  1SNZ A;  3DYM A;  1HN1 A;  3I3B A;  1NSV A;  2E22 A;  1K1X A;  1NSR A;  3NJV A;  1NSU A;  1N7O A;  1RW9 A;  1Z45 A;  1N7N A;  1JYN A;  4BZG A;  1NSM A;  5E1Q A;  4BZE A;  2WVZ A;  2WVX A;  3MV0 1;  3WFA A;  3T0A A;  3MUZ 1;  1MMX A;  2ZXQ A;  3MWX A;  1NS2 A;  1X1H A;  3NRE A;  1TXK A;  2HTA A;  1N7R A;  1NS8 A;  3DCD A;  3VDB A;  3BGA A;  3NJX A;  1MN0 A;  2E24 A;  3CZJ A;  2BRW A;  4BZF A;  1LF9 A;  1HM3 A;  3OBA A;  1OJO A;  2JKP A;  1PX3 A;  1RWA A;  3MUY 1;  3A24 A;  4BZH A;  5A1A A;  1JZ8 A;  1F9G A;  3T0D A;  1MMY A;  1CB8 A;  1OJN A;  1DP0 A;  1RWH A;  1JZ3 A;  3T2Q A;  3T09 A;  4DUX A;  3SEP A;  1N7P A;  3T0B A;  1JYV A;  2WDA A;  2WW2 A;  1UG9 A;  1YGA A;  3I3E A;  2Q1F A;  4RNL A;  1RWG A;  1LF6 A;  3E1F 1;  1F4A A;  1I8Q A;  1F4H A;  2XSG A;  1NSX A;  3ECQ A;  2JKE A;  1X1I A;  1EGU A;  1C82 A;  2BRV X;  3IAP A;  3VDC A;  1YQ2 A;  1RWC A;  2JKA A;  3DYP A;  4AQ0 A;  3OS7 A;  3VDA A;  1L7K A;  2WCO A;  3VD9 A;  2D73 A;  3IAQ A;  1NSS A;  4DUV A;  1JYX A;  1J0N A;  1JZ5 A;  3T2P A;  1JYW A;  1HN0 A;  2WVX B;  1X1J A;  1JZ2 A;  3Q1N A;  1HMU A;  1NKG A;  1ULV A; 
#chains in the Genus database with same CATH topology
 1H54 A;  1J0M A;  3HII A;  3AFL A;  4NEI A;  2BRP A;  2YFN A;  1PS3 A;  1LVN A;  2WVY A;  2WGQ A;  2OW7 A;  2CIR A;  2FYV A;  2WW3 A;  3W7W A;  1JZ4 A;  1N7Q A;  3VSN A;  1IVW A;  1JZ7 A;  1W5Z A;  3D4Y A;  3TY1 A;  3AFJ A;  5GW7 A;  2E22 A;  1QWU A;  3NJV A;  1N7O A;  1N7N A;  1WMP A;  3BLB A;  1JYN A;  2ZL8 A;  3BUQ A;  1A2V A;  3WFA A;  4MMH A;  3WIQ A;  1MMX A;  3CV5 A;  3WA2 X;  2ZXQ A;  3K5T A;  2PNC A;  2HTA A;  3VDB A;  1NS8 A;  2OOV A;  4FNU A;  2OW6 A;  1HXK A;  3CZJ A;  1HM3 A;  1WMO A;  1OJO A;  1WMN A;  1V7V A;  3EJS A;  1IVX A;  1W6G A;  2BT3 A;  3W7T A;  1QAK A;  2CWV A;  1JZ8 A;  2F7R A;  4KTR A;  1CB8 A;  1OJN A;  1RWH A;  2D1W A;  3DX2 A;  1N7P A;  3T0B A;  4FNP A;  1UG9 A;  3X42 A;  1YGA A;  4J5T A;  4RNL A;  1I8Q A;  3QDE A;  2F1B A;  3D51 A;  1NSX A;  2JKE A;  3HI7 A;  4BTY A;  1C82 A;  1EGU A;  1RWC A;  3DYP A;  3OS7 A;  3VDA A;  3DX4 A;  4DUV A;  2CFW A;  1JYW A;  1HWW A;  2CFG A;  2WDA A;  4MMI A;  3X3X A;  1LXM A;  3DX3 A;  2E2T A;  1LUR A;  2E2V A;  3WVF A;  3BUD A;  3EJP A;  1JZ6 A;  2F18 A;  1RJO A;  1HM2 A;  1TU5 A;  1NS7 A;  3BVT A;  3VD3 A;  4DUW A;  4KFF A;  2XN1 A;  4FNQ A;  2Y74 A;  2F7Q A;  2F7P A;  1SO0 A;  2CWU A;  3DEC A;  2WZS A;  2WW0 A;  5CA3 A;  3OB8 A;  4KFD A;  1IVV A;  2XHN A;  1OJM A;  3K25 A;  4EV2 A;  1LOH A;  1MMU A;  3DYM A;  3D50 A;  4UFC A;  1W4N A;  1K1X A;  1JRQ A;  3D52 A;  2ALW A;  1SIH A;  2OOV C;  1R33 A;  2WVX A;  1D6Y A;  3HIG A;  4K35 A;  1NS2 A;  1AVL A;  1D6U A;  1X1H A;  3EJU A;  1MN0 A;  2BRW A;  3A0O A;  2OQE C;  1PX3 A;  4BZH A;  2F7O A;  1R34 A;  3QFY A;  3T0D A;  4BTW A;  2YX9 A;  3DX0 A;  2W0Q A;  1W6C A;  3SEP A;  1KSI A;  1JYV A;  2WW2 A;  1AVK A;  3RSY A;  1N9E A;  3SX1 A;  2WOF A;  2XSG A;  2WOH A;  3ECQ A;  4OK2 A;  2BRV X;  3IAP A;  4FNS A;  2JKA A;  1EKM A;  2FUT A;  3VD9 A;  2EAC A;  1QAL A;  4OJZ A;  3W7X A;  2OQE A;  3EJR A;  3X3Z A;  1J0N A;  1JZ5 A;  3BVU A;  1V7W A;  1IVU A;  2YFO A;  3DDF A;  4EV5 A;  2HTB A;  2CIS A;  1HMW A;  1K1Y A;  1V7X A;  2CIQ A;  3VD7 A;  3IMH A;  3DDG A;  3VD5 A;  2WW1 A;  3AMO B;  3J7H A;  3LOY A;  2ZQ0 A;  4FNR A;  4KFE A;  3RRS A;  1W7C A;  2E2U A;  1TQW A;  1MMZ A;  4OK4 A;  3DYO A;  3T2O A;  3CZN A;  1IQX A;  1SNZ A;  3D3I A;  1HN1 A;  1US1 A;  1NSV A;  4FNT A;  1RKY A;  1NSU A;  4BZG A;  3D4Z A;  1O7D D;  1NSM A;  5E1Q A;  2WVZ A;  3NBB A;  3MUZ 1;  2C11 A;  3W7S A;  3MWX A;  3KN4 A;  3NRE A;  1TXK A;  3BGA A;  3MPH A;  3NJX A;  2E24 A;  3WA3 A;  3E80 A;  3OBA A;  2JKP A;  3BUP A;  2CFK A;  1OAC A;  3BVX A;  1QWN A;  2CQT A;  1F9G A;  3DX1 A;  3EJQ A;  3LVT A;  3BVW A;  1JZ3 A;  3T2Q A;  3T09 A;  4DUX A;  3X3Y A;  4K3A A;  3I3E A;  1SPU A;  1RWG A;  1TQU A;  1LF6 A;  1D6Z A;  2CG0 A;  2EAD A;  5KBP A;  2WO0 A;  1X1I A;  2XN0 A;  1SII A;  3BVV A;  3S4C A;  4AQ0 A;  3IAQ A;  1JYX A;  3NBJ A;  3T2P A;  1HN0 A;  3T0U A;  1X1J A;  3Q1N A;  3SXX A;  1AV4 A;  1NKG A;  1W3Y A;  3S4A A;  1F1S A;  5JMF A;  1OJP A;  2CG1 A;  2C10 A;  1PX4 A;  3VD4 A;  3KII A;  1NS0 A;  1NS4 A;  3I3D A;  1JOV A;  1NSZ A;  3VSM A;  1L7J A;  2X03 A;  1LXK A;  5JMD A;  3T08 A;  3X41 A;  3MV1 1;  2XN2 A;  1K1W A;  1PU4 A;  2CQS A;  1RWF A;  4TTG A;  3I3B A;  1TQT A;  1DYU A;  3X40 A;  1NSR A;  3BUI A;  3ALA A;  1IU7 A;  1RW9 A;  1Z45 A;  1IQY A;  2CFL A;  4BZE A;  3MV0 1;  3BLC A;  1W2Z A;  3T0A A;  1TQS A;  3S4D A;  3WIR A;  4KTP A;  3BUB A;  3QFZ A;  1QX1 A;  2CWT A;  3DCD A;  1N7R A;  1UI8 A;  3AMO A;  4FNV A;  4BZF A;  1LF9 A;  2WYI A;  1RWA A;  3PGB A;  3MUY 1;  3A24 A;  3W7U A;  2CFD A;  2EAB A;  5A1A A;  1MMY A;  1TQV A;  1DP0 A;  1QAF A;  3S4B A;  1HTY A;  2Y73 A;  2Q1F A;  2FUQ A;  4BTX A;  3E1F 1;  2RDY A;  1F4A A;  1F4H A;  2WYH A;  3CZS A;  3E7J A;  3EJT A;  3VDC A;  1UI7 A;  3QG0 A;  1YQ2 A;  3BS6 A;  3MI6 A;  3ACS A;  1L7K A;  2WCO A;  2D73 A;  1NSS A;  3ACT A;  3N9H A;  2WVX B;  1JZ2 A;  2EAE A;  2F1A A;  1HMU A;  1ULV A; 
#chains in the Genus database with same CATH homology
 1J0M A;  1W3Y A;  1LXM A;  2CIS A;  2HTB A;  1HMW A;  1K1Y A;  1LUR A;  2CIQ A;  1F1S A;  3AFL A;  4NEI A;  3IMH A;  3VD7 A;  3WVF A;  1JZ6 A;  2BRP A;  5JMF A;  1OJP A;  2WVY A;  1HM2 A;  1NS7 A;  3VD5 A;  1PX4 A;  3VD3 A;  3VD4 A;  4DUW A;  2CIR A;  2WW1 A;  2WW3 A;  3J7H A;  1NS0 A;  1NS4 A;  3I3D A;  1JOV A;  1NSZ A;  2ZQ0 A;  1L7J A;  3VSM A;  2X03 A;  1LXK A;  5JMD A;  1JZ4 A;  1SO0 A;  3T08 A;  3DEC A;  2WZS A;  1N7Q A;  1MMZ A;  2WW0 A;  4OK4 A;  3VSN A;  3DYO A;  3MV1 1;  3OB8 A;  1K1W A;  3T2O A;  1JZ7 A;  2XHN A;  1OJM A;  3K25 A;  1RWF A;  4TTG A;  1LOH A;  1MMU A;  1SNZ A;  3DYM A;  1HN1 A;  3I3B A;  3TY1 A;  1NSV A;  2E22 A;  1K1X A;  1NSR A;  3NJV A;  1NSU A;  1N7O A;  1RW9 A;  1Z45 A;  1N7N A;  1JYN A;  4BZG A;  1NSM A;  5E1Q A;  4BZE A;  2WVZ A;  2WVX A;  3MV0 1;  3BLC A;  3WFA A;  3T0A A;  3MUZ 1;  4MMH A;  1MMX A;  2ZXQ A;  3MWX A;  1NS2 A;  1X1H A;  3NRE A;  1TXK A;  2HTA A;  1N7R A;  1NS8 A;  3DCD A;  3VDB A;  3BGA A;  3NJX A;  1MN0 A;  2E24 A;  3CZJ A;  2BRW A;  3A0O A;  4FNV A;  4BZF A;  3E80 A;  1LF9 A;  1HM3 A;  3OBA A;  1OJO A;  2JKP A;  1PX3 A;  1RWA A;  3MUY 1;  3A24 A;  4BZH A;  5A1A A;  1JZ8 A;  1F9G A;  3T0D A;  1MMY A;  1CB8 A;  1OJN A;  1DP0 A;  1RWH A;  1JZ3 A;  3T2Q A;  3T09 A;  4DUX A;  3SEP A;  1N7P A;  3T0B A;  1JYV A;  2WDA A;  2WW2 A;  1UG9 A;  1YGA A;  4J5T A;  3I3E A;  2Q1F A;  2FUQ A;  4RNL A;  1RWG A;  1LF6 A;  3E1F 1;  1F4A A;  1I8Q A;  1F4H A;  2XSG A;  3E7J A;  1NSX A;  3ECQ A;  2JKE A;  1X1I A;  1EGU A;  1C82 A;  2BRV X;  3IAP A;  4OK2 A;  3VDC A;  1YQ2 A;  1RWC A;  2JKA A;  3DYP A;  2FUT A;  4AQ0 A;  3BS6 A;  3OS7 A;  3VDA A;  1L7K A;  2WCO A;  3VD9 A;  2D73 A;  3IAQ A;  4OJZ A;  1NSS A;  4DUV A;  1JYX A;  1J0N A;  1JZ5 A;  3T2P A;  1JYW A;  1HN0 A;  2WVX B;  1X1J A;  1JZ2 A;  3Q1N A;  1HMU A;  4MMI A;  1NKG A;  1ULV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...