1NS0A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304q complexed with galactose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
340
structure length
340
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFQCQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 96
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns0A00
1RWHA 1UG9A 4DUXA 4DUWA 3BGAA 3MV11 2E22A 1HMUA 1N7RA 1TXKA 1RW9A 1NKGA 4DUVA 2WVZA 1N7PA 2XSGA 1JYXA 1CB8A 3VD7A 1I8QA 4AQ0A 1PX4A 3VDAA 3DYMA 1L7KA 2CIQA 1F4HA 2CIRA 3OB8A 1N7OA 1RWCA 3A24A 2WW2A 1LXKA 1C82A 1LOHA 3NJVA 1NS4A 3MUY1 3NJXA 1NSMA 1LF6A 3T08A 1JOVA 1JYNA 1JYWA 3Q1NA 3T0BA 2WVYA 3T0DA 2E24A 1OJMA 1JZ4A 3MV01 1K1WA 3I3BA 2JKPA 1X1HA 4BZEA 1F9GA 3NREA 1X1IA 1NS7A 2X03A 1HN0A 3VD3A 2ZXQA 1JZ2A 1HM3A 3DYPA 4TTGA 3ECQA 1LURA 3MUZ1 1NSRA 1JZ5A 1NS8A 1JZ7A 1J0NA 1F4AA 1JZ6A 1HN1A 2CISA 2JKEA 1K1XA 2WVXB 1SO0A 1HMWA 1NS2A 2BRVX 3IAPA 1J0MA 3E1F1 1JZ8A 3MWXA 1NS0A 1NSUA 3I3EA 1MMXA 3T0AA 1N7NA 2WVXA 4BZHA 2JKAA 1YGAA 1RWFA 1DP0A 2Q1FA 5A1AA 3IMHA 1MMZA 1JZ3A 3WFAA 2D73A 3T2PA 2WCOA 3OS7A 3K25A 2XHNA 1Z45A 1NSVA 3VD9A 1RWAA 1PX3A 3IAQA 3DCDA 3DECA 1F1SA 1NSXA 1N7QA 3DYOA 3VD4A 1MN0A 1ULVA 2HTAA 1LF9A 3OBAA 1EGUA 2ZQ0A 3T2QA 3SEPA 2WW0A 1OJPA 1JYVA 1W3YA 3VDCA 1SNZA 4BZGA 1HM2A 2WW3A 3CZJA 1OJNA 3I3DA 3VD5A 1LXMA 5E1QA 1RWGA 2WZSA 3J7HA 1X1JA 2WW1A 3VDBA 1L7JA 2BRPA 2WDAA 1K1YA 1MMUA 1MMYA 2HTBA 1NSSA 1NSZA 2BRWA 4RNLA 3T09A 3T2OA 4BZFA 1YQ2A 1OJOA
chains in the Genus database with same CATH superfamily
4K3AA 5GW7A 4DUXA 1OACA 1HMUA 3EJQA 1N7RA 3E80A 1TXKA 2CG1A 3WIQA 1N7PA 2XSGA 1CB8A 3X42A 1W7CA 1F4HA 3OB8A 3X3YA 4KFEA 1RWCA 1C82A 3NJVA 1HTYA 1NSMA 4FNVA 3DDGA 5JMDA 3Q1NA 3T0BA 1TQWA 2JKPA 4BTYA 4EV5A 1X1IA 1NS7A 4KTRA 2F7PA 3BLBA 1HM3A 1IQYA 3W7SA 4TTGA 3CZSA 1V7VA 3D4ZA 1HN1A 1K1XA 3D51A 2BRVX 2WOFA 1NSUA 2D1WA 1N7NA 2CFLA 4BZHA 1RKYA 3KIIA 3WFAA 1UI7A 3DX1A 2XHNA 3EJPA 1Z45A 1NSVA 2EADA 3S4AA 3X3ZA 1NSXA 4EV2A 1MN0A 1ULVA 4KFFA 1W2ZA 4KFDA 2ZQ0A 3T2QA 1WMPA 3SEPA 2F7QA 1QAKA 1JYVA 3VDCA 3W7XA 2WW3A 3CZJA 1AVKA 5E1QA 2FUTA 3VDBA 2BRPA 2C11A 2OOVA 1MMUA 2HTBA 1W6CA 3T09A 3EJRA 2F1BA 4FNSA 1RW9A 3HIGA 2WVZA 4OK2A 1JYXA 3LOYA 3D50A 4AQ0A 3DYMA 1L7KA 1UI8A 1N7OA 1DYUA 3DX4A 1EKMA 1LOHA 1SIHA 2CWUA 2C10A 3X3XA 3T08A 1JOVA 1JYNA 3DX3A 2WVYA 3T0DA 4BZEA 1TQUA 3BUDA 2ZXQA 3DDFA 2BT3A 3MUZ1 1O7DD 1JZ5A 3QDEA 3W7TA 3SX1A 3BLCA 1D6UA 1V7XA 1JZ6A 2WVXB 1NS2A 3QG0A 1LVNA 3W7UA 1MMXA 2XN0A 3ALAA 5KBPA 2WVXA 1RWFA 1JZ3A 2ALWA 2D73A 3T2PA 3ACSA 3VD9A 1RWAA 3D3IA 3DECA 1F1SA 3VD4A 2HTAA 4FNRA 1LF9A 1W3YA 2E2TA 3BUIA 3I3DA 3VD5A 1LXMA 2CWVA 2WZSA 3J7HA 3AFJA 2E2UA 3CZNA 1H54A 2XN1A 3N9HA 2OQEC 1TQSA 1TQTA 4FNQA 3EJTA 3T2OA 1YQ2A 3MI6A 1RWHA 1R34A 3BGAA 1N9EA 3MV11 3NBBA 2E22A 2F1AA 4MMIA 3E7JA 4DUVA 1A2VA 3AMOB 3BVUA 3VDAA 2EABA 3RSYA 2CIQA 3WIRA 3S4BA 2FUQA 3AMOA 3A24A 3TY1A 3MUY1 3NJXA 1JRQA 3LVTA 1LF6A 2EACA 3HI7A 1JYWA 2E24A 1OJMA 1IVXA 1K1WA 1X1HA 1F9GA 2WYIA 2X03A 2XN2A 1HN0A 3VD3A 1RJOA 3ECQA 4FNTA 1W4NA 2FYVA 3NBJA 1JZ7A 1F4AA 3S4CA 2JKEA 3IAPA 3BVTA 3E1F1 1JZ8A 3MWXA 1QAFA 3I3EA 4NEIA 3RRSA 3T0AA 3KN4A 2JKAA 3BVXA 2Q1FA 4K35A 1MMZA 1IVUA 1WMOA 1SIIA 1W5ZA 3IAQA 3A0OA 3DCDA 1IU7A 3EJSA 1V7WA 2WGQA 5CA3A 2W0QA 2WYHA 3WA3A 3VSNA 1OJPA 2YX9A 3S4DA 1SNZA 3EJUA 1HM2A 2E2VA 4J5TA 3VSMA 4UFCA 2OW7A 1R33A 3T0UA 2WW1A 1L7JA 2WDAA 2WOHA 1MMYA 3BS6A 1D6YA 3ACTA 2CQSA 2RDYA 1NSZA 2BRWA 2EAEA 1OJOA 1UG9A 3MPHA 3WA2X 4DUWA 3X41A 3QFYA 3DX2A 3AFLA 3CV5A 1IVVA 1NKGA 1WMNA 1PU4A 3K5TA 4MMHA 3VD7A 1I8QA 1HWWA 1PX4A 2F7RA 2CIRA 2CFGA 2CFDA 2WW2A 1LXKA 1AV4A 2ZL8A 1NS4A 1D6ZA 3BVWA 1PS3A 1IVWA 3BUQA 2Y73A 3W7WA 1JZ4A 3MV01 3I3BA 1TU5A 3PGBA 1US1A 2CFWA 3NREA 1QWUA 1SPUA 1JZ2A 3DYPA 2CQTA 1LURA 1NSRA 3BUBA 2OOVC 1NS8A 3QFZA 1J0NA 2CWTA 2OW6A 2OQEA 2CISA 3DX0A 4FNPA 3X40A 1SO0A 1HMWA 2F18A 2PNCA 4FNUA 1J0MA 3D52A 1KSIA 1NS0A 3BVVA 2F7OA 1W6GA 1QX1A 1YGAA 1DP0A 4BTXA 4BTWA 1QWNA 3IMHA 5A1AA 2WCOA 3OS7A 3K25A 3HIIA 2YFNA 2YFOA 1PX3A 5JMFA 1N7QA 3DYOA 3OBAA 1AVLA 1EGUA 2Y74A 2WW0A 4KTPA 3SXXA 4BZGA 1IQXA 1OJNA 2CFKA 3BUPA 1RWGA 1X1JA 4OK4A 1TQVA 1K1YA 1NSSA 1QALA 3WVFA 1HXKA 4OJZA 4RNLA 3D4YA 4BZFA 2CG0A 2WO0A
chains in the Genus database with same CATH topology
1RWHA 1UG9A 4DUXA 4DUWA 3BGAA 3MV11 2E22A 1HMUA 1N7RA 3E80A 3AFLA 1TXKA 1RW9A 1NKGA 4MMIA 3E7JA 2WVZA 4DUVA 1N7PA 4OK2A 2XSGA 1JYXA 4MMHA 1CB8A 3VD7A 1I8QA 4AQ0A 1PX4A 3VDAA 3DYMA 1L7KA 2CIQA 1F4HA 2CIRA 3OB8A 2FUQA 1N7OA 1RWCA 3A24A 2WW2A 3TY1A 1LXKA 1C82A 1LOHA 3NJVA 1NS4A 3MUY1 3NJXA 1NSMA 4FNVA 1LF6A 3T08A 1JOVA 1JYNA 5JMDA 1JYWA 3Q1NA 3T0BA 2WVYA 3T0DA 2E24A 1OJMA 1JZ4A 3MV01 1K1WA 3I3BA 2JKPA 1X1HA 4BZEA 1F9GA 3NREA 1X1IA 1NS7A 2X03A 1HN0A 3VD3A 2ZXQA 1JZ2A 1HM3A 3DYPA 4TTGA 3ECQA 1LURA 3MUZ1 1NSRA 1JZ5A 1NS8A 1JZ7A 1J0NA 1F4AA 3BLCA 1JZ6A 1HN1A 2CISA 2JKEA 1K1XA 2WVXB 1SO0A 1HMWA 1NS2A 2BRVX 3IAPA 1J0MA 3E1F1 1JZ8A 3MWXA 1NS0A 1NSUA 3I3EA 1MMXA 4NEIA 1N7NA 2WVXA 3T0AA 4BZHA 2JKAA 1YGAA 1RWFA 1DP0A 2Q1FA 5A1AA 3IMHA 1MMZA 1JZ3A 3WFAA 2D73A 3T2PA 2WCOA 3OS7A 3K25A 2XHNA 1Z45A 1NSVA 3VD9A 1RWAA 1PX3A 3IAQA 3A0OA 3DCDA 3DECA 5JMFA 1F1SA 1NSXA 1N7QA 3DYOA 3VD4A 1MN0A 1ULVA 2HTAA 1LF9A 3OBAA 1EGUA 2ZQ0A 3T2QA 3SEPA 2WW0A 3VSNA 1OJPA 1JYVA 1W3YA 3VDCA 1SNZA 4BZGA 1HM2A 4J5TA 2WW3A 3CZJA 1OJNA 3I3DA 3VSMA 3VD5A 1LXMA 5E1QA 1RWGA 2FUTA 2WZSA 3J7HA 1X1JA 4OK4A 2WW1A 3VDBA 1L7JA 2BRPA 2WDAA 1K1YA 1MMUA 1MMYA 2HTBA 1NSSA 3BS6A 1NSZA 3WVFA 2BRWA 4OJZA 4RNLA 3T09A 3T2OA 4BZFA 1YQ2A 1OJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWH A;  1UG9 A;  4DUX A;  4DUW A;  3BGA A;  3MV1 1;  2E22 A;  1HMU A;  1N7R A;  1TXK A;  1RW9 A;  1NKG A;  4DUV A;  2WVZ A;  1N7P A;  2XSG A;  1JYX A;  1CB8 A;  3VD7 A;  1I8Q A;  4AQ0 A;  1PX4 A;  3VDA A;  3DYM A;  1L7K A;  2CIQ A;  1F4H A;  2CIR A;  3OB8 A;  1N7O A;  1RWC A;  3A24 A;  2WW2 A;  1LXK A;  1C82 A;  1LOH A;  3NJV A;  1NS4 A;  3MUY 1;  3NJX A;  1NSM A;  1LF6 A;  3T08 A;  1JOV A;  1JYN A;  1JYW A;  3Q1N A;  3T0B A;  2WVY A;  3T0D A;  2E24 A;  1OJM A;  1JZ4 A;  3MV0 1;  1K1W A;  3I3B A;  2JKP A;  1X1H A;  4BZE A;  1F9G A;  3NRE A;  1X1I A;  1NS7 A;  2X03 A;  1HN0 A;  3VD3 A;  2ZXQ A;  1JZ2 A;  1HM3 A;  3DYP A;  4TTG A;  3ECQ A;  1LUR A;  3MUZ 1;  1NSR A;  1JZ5 A;  1NS8 A;  1JZ7 A;  1J0N A;  1F4A A;  1JZ6 A;  1HN1 A;  2CIS A;  2JKE A;  1K1X A;  2WVX B;  1SO0 A;  1HMW A;  1NS2 A;  2BRV X;  3IAP A;  1J0M A;  3E1F 1;  1JZ8 A;  3MWX A;  1NS0 A;  1NSU A;  3I3E A;  1MMX A;  3T0A A;  1N7N A;  2WVX A;  4BZH A;  2JKA A;  1YGA A;  1RWF A;  1DP0 A;  2Q1F A;  5A1A A;  3IMH A;  1MMZ A;  1JZ3 A;  3WFA A;  2D73 A;  3T2P A;  2WCO A;  3OS7 A;  3K25 A;  2XHN A;  1Z45 A;  1NSV A;  3VD9 A;  1RWA A;  1PX3 A;  3IAQ A;  3DCD A;  3DEC A;  1F1S A;  1NSX A;  1N7Q A;  3DYO A;  3VD4 A;  1MN0 A;  1ULV A;  2HTA A;  1LF9 A;  3OBA A;  1EGU A;  2ZQ0 A;  3T2Q A;  3SEP A;  2WW0 A;  1OJP A;  1JYV A;  1W3Y A;  3VDC A;  1SNZ A;  4BZG A;  1HM2 A;  2WW3 A;  3CZJ A;  1OJN A;  3I3D A;  3VD5 A;  1LXM A;  5E1Q A;  1RWG A;  2WZS A;  3J7H A;  1X1J A;  2WW1 A;  3VDB A;  1L7J A;  2BRP A;  2WDA A;  1K1Y A;  1MMU A;  1MMY A;  2HTB A;  1NSS A;  1NSZ A;  2BRW A;  4RNL A;  3T09 A;  3T2O A;  4BZF A;  1YQ2 A;  1OJO A; 
#chains in the Genus database with same CATH topology
 4K3A A;  5GW7 A;  4DUX A;  1OAC A;  1HMU A;  3EJQ A;  1N7R A;  3E80 A;  1TXK A;  2CG1 A;  3WIQ A;  1N7P A;  2XSG A;  1CB8 A;  3X42 A;  1W7C A;  1F4H A;  3OB8 A;  3X3Y A;  4KFE A;  1RWC A;  1C82 A;  3NJV A;  1HTY A;  1NSM A;  4FNV A;  3DDG A;  5JMD A;  3Q1N A;  3T0B A;  1TQW A;  2JKP A;  4BTY A;  4EV5 A;  1X1I A;  1NS7 A;  4KTR A;  2F7P A;  3BLB A;  1HM3 A;  1IQY A;  3W7S A;  4TTG A;  3CZS A;  1V7V A;  3D4Z A;  1HN1 A;  1K1X A;  3D51 A;  2BRV X;  2WOF A;  1NSU A;  2D1W A;  1N7N A;  2CFL A;  4BZH A;  1RKY A;  3KII A;  3WFA A;  1UI7 A;  3DX1 A;  2XHN A;  3EJP A;  1Z45 A;  1NSV A;  2EAD A;  3S4A A;  3X3Z A;  1NSX A;  4EV2 A;  1MN0 A;  1ULV A;  4KFF A;  1W2Z A;  4KFD A;  2ZQ0 A;  3T2Q A;  1WMP A;  3SEP A;  2F7Q A;  1QAK A;  1JYV A;  3VDC A;  3W7X A;  2WW3 A;  3CZJ A;  1AVK A;  5E1Q A;  2FUT A;  3VDB A;  2BRP A;  2C11 A;  2OOV A;  1MMU A;  2HTB A;  1W6C A;  3T09 A;  3EJR A;  2F1B A;  4FNS A;  1RW9 A;  3HIG A;  2WVZ A;  4OK2 A;  1JYX A;  3LOY A;  3D50 A;  4AQ0 A;  3DYM A;  1L7K A;  1UI8 A;  1N7O A;  1DYU A;  3DX4 A;  1EKM A;  1LOH A;  1SIH A;  2CWU A;  2C10 A;  3X3X A;  3T08 A;  1JOV A;  1JYN A;  3DX3 A;  2WVY A;  3T0D A;  4BZE A;  1TQU A;  3BUD A;  2ZXQ A;  3DDF A;  2BT3 A;  3MUZ 1;  1O7D D;  1JZ5 A;  3QDE A;  3W7T A;  3SX1 A;  3BLC A;  1D6U A;  1V7X A;  1JZ6 A;  2WVX B;  1NS2 A;  3QG0 A;  1LVN A;  3W7U A;  1MMX A;  2XN0 A;  3ALA A;  5KBP A;  2WVX A;  1RWF A;  1JZ3 A;  2ALW A;  2D73 A;  3T2P A;  3ACS A;  3VD9 A;  1RWA A;  3D3I A;  3DEC A;  1F1S A;  3VD4 A;  2HTA A;  4FNR A;  1LF9 A;  1W3Y A;  2E2T A;  3BUI A;  3I3D A;  3VD5 A;  1LXM A;  2CWV A;  2WZS A;  3J7H A;  3AFJ A;  2E2U A;  3CZN A;  1H54 A;  2XN1 A;  3N9H A;  2OQE C;  1TQS A;  1TQT A;  4FNQ A;  3EJT A;  3T2O A;  1YQ2 A;  3MI6 A;  1RWH A;  1R34 A;  3BGA A;  1N9E A;  3MV1 1;  3NBB A;  2E22 A;  2F1A A;  4MMI A;  3E7J A;  4DUV A;  1A2V A;  3AMO B;  3BVU A;  3VDA A;  2EAB A;  3RSY A;  2CIQ A;  3WIR A;  3S4B A;  2FUQ A;  3AMO A;  3A24 A;  3TY1 A;  3MUY 1;  3NJX A;  1JRQ A;  3LVT A;  1LF6 A;  2EAC A;  3HI7 A;  1JYW A;  2E24 A;  1OJM A;  1IVX A;  1K1W A;  1X1H A;  1F9G A;  2WYI A;  2X03 A;  2XN2 A;  1HN0 A;  3VD3 A;  1RJO A;  3ECQ A;  4FNT A;  1W4N A;  2FYV A;  3NBJ A;  1JZ7 A;  1F4A A;  3S4C A;  2JKE A;  3IAP A;  3BVT A;  3E1F 1;  1JZ8 A;  3MWX A;  1QAF A;  3I3E A;  4NEI A;  3RRS A;  3T0A A;  3KN4 A;  2JKA A;  3BVX A;  2Q1F A;  4K35 A;  1MMZ A;  1IVU A;  1WMO A;  1SII A;  1W5Z A;  3IAQ A;  3A0O A;  3DCD A;  1IU7 A;  3EJS A;  1V7W A;  2WGQ A;  5CA3 A;  2W0Q A;  2WYH A;  3WA3 A;  3VSN A;  1OJP A;  2YX9 A;  3S4D A;  1SNZ A;  3EJU A;  1HM2 A;  2E2V A;  4J5T A;  3VSM A;  4UFC A;  2OW7 A;  1R33 A;  3T0U A;  2WW1 A;  1L7J A;  2WDA A;  2WOH A;  1MMY A;  3BS6 A;  1D6Y A;  3ACT A;  2CQS A;  2RDY A;  1NSZ A;  2BRW A;  2EAE A;  1OJO A;  1UG9 A;  3MPH A;  3WA2 X;  4DUW A;  3X41 A;  3QFY A;  3DX2 A;  3AFL A;  3CV5 A;  1IVV A;  1NKG A;  1WMN A;  1PU4 A;  3K5T A;  4MMH A;  3VD7 A;  1I8Q A;  1HWW A;  1PX4 A;  2F7R A;  2CIR A;  2CFG A;  2CFD A;  2WW2 A;  1LXK A;  1AV4 A;  2ZL8 A;  1NS4 A;  1D6Z A;  3BVW A;  1PS3 A;  1IVW A;  3BUQ A;  2Y73 A;  3W7W A;  1JZ4 A;  3MV0 1;  3I3B A;  1TU5 A;  3PGB A;  1US1 A;  2CFW A;  3NRE A;  1QWU A;  1SPU A;  1JZ2 A;  3DYP A;  2CQT A;  1LUR A;  1NSR A;  3BUB A;  2OOV C;  1NS8 A;  3QFZ A;  1J0N A;  2CWT A;  2OW6 A;  2OQE A;  2CIS A;  3DX0 A;  4FNP A;  3X40 A;  1SO0 A;  1HMW A;  2F18 A;  2PNC A;  4FNU A;  1J0M A;  3D52 A;  1KSI A;  1NS0 A;  3BVV A;  2F7O A;  1W6G A;  1QX1 A;  1YGA A;  1DP0 A;  4BTX A;  4BTW A;  1QWN A;  3IMH A;  5A1A A;  2WCO A;  3OS7 A;  3K25 A;  3HII A;  2YFN A;  2YFO A;  1PX3 A;  5JMF A;  1N7Q A;  3DYO A;  3OBA A;  1AVL A;  1EGU A;  2Y74 A;  2WW0 A;  4KTP A;  3SXX A;  4BZG A;  1IQX A;  1OJN A;  2CFK A;  3BUP A;  1RWG A;  1X1J A;  4OK4 A;  1TQV A;  1K1Y A;  1NSS A;  1QAL A;  3WVF A;  1HXK A;  4OJZ A;  4RNL A;  3D4Y A;  4BZF A;  2CG0 A;  2WO0 A; 
#chains in the Genus database with same CATH homology
 1RWH A;  1UG9 A;  4DUX A;  4DUW A;  3BGA A;  3MV1 1;  2E22 A;  1HMU A;  1N7R A;  3E80 A;  3AFL A;  1TXK A;  1RW9 A;  1NKG A;  4MMI A;  3E7J A;  2WVZ A;  4DUV A;  1N7P A;  4OK2 A;  2XSG A;  1JYX A;  4MMH A;  1CB8 A;  3VD7 A;  1I8Q A;  4AQ0 A;  1PX4 A;  3VDA A;  3DYM A;  1L7K A;  2CIQ A;  1F4H A;  2CIR A;  3OB8 A;  2FUQ A;  1N7O A;  1RWC A;  3A24 A;  2WW2 A;  3TY1 A;  1LXK A;  1C82 A;  1LOH A;  3NJV A;  1NS4 A;  3MUY 1;  3NJX A;  1NSM A;  4FNV A;  1LF6 A;  3T08 A;  1JOV A;  1JYN A;  5JMD A;  1JYW A;  3Q1N A;  3T0B A;  2WVY A;  3T0D A;  2E24 A;  1OJM A;  1JZ4 A;  3MV0 1;  1K1W A;  3I3B A;  2JKP A;  1X1H A;  4BZE A;  1F9G A;  3NRE A;  1X1I A;  1NS7 A;  2X03 A;  1HN0 A;  3VD3 A;  2ZXQ A;  1JZ2 A;  1HM3 A;  3DYP A;  4TTG A;  3ECQ A;  1LUR A;  3MUZ 1;  1NSR A;  1JZ5 A;  1NS8 A;  1JZ7 A;  1J0N A;  1F4A A;  3BLC A;  1JZ6 A;  1HN1 A;  2CIS A;  2JKE A;  1K1X A;  2WVX B;  1SO0 A;  1HMW A;  1NS2 A;  2BRV X;  3IAP A;  1J0M A;  3E1F 1;  1JZ8 A;  3MWX A;  1NS0 A;  1NSU A;  3I3E A;  1MMX A;  4NEI A;  1N7N A;  2WVX A;  3T0A A;  4BZH A;  2JKA A;  1YGA A;  1RWF A;  1DP0 A;  2Q1F A;  5A1A A;  3IMH A;  1MMZ A;  1JZ3 A;  3WFA A;  2D73 A;  3T2P A;  2WCO A;  3OS7 A;  3K25 A;  2XHN A;  1Z45 A;  1NSV A;  3VD9 A;  1RWA A;  1PX3 A;  3IAQ A;  3A0O A;  3DCD A;  3DEC A;  5JMF A;  1F1S A;  1NSX A;  1N7Q A;  3DYO A;  3VD4 A;  1MN0 A;  1ULV A;  2HTA A;  1LF9 A;  3OBA A;  1EGU A;  2ZQ0 A;  3T2Q A;  3SEP A;  2WW0 A;  3VSN A;  1OJP A;  1JYV A;  1W3Y A;  3VDC A;  1SNZ A;  4BZG A;  1HM2 A;  4J5T A;  2WW3 A;  3CZJ A;  1OJN A;  3I3D A;  3VSM A;  3VD5 A;  1LXM A;  5E1Q A;  1RWG A;  2FUT A;  2WZS A;  3J7H A;  1X1J A;  4OK4 A;  2WW1 A;  3VDB A;  1L7J A;  2BRP A;  2WDA A;  1K1Y A;  1MMU A;  1MMY A;  2HTB A;  1NSS A;  3BS6 A;  1NSZ A;  3WVF A;  2BRW A;  4OJZ A;  4RNL A;  3T09 A;  3T2O A;  4BZF A;  1YQ2 A;  1OJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...