2RDYA

Crystal structure of a putative glycoside hydrolase family protein from bacillus halodurans
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
789
structure length
787
Chain Sequence
b'LKIQFDFPASFWTEALPIGNGNLGAMVFGKVEKERIALNEDTLWSGYPKDWNNPKAKEVLPKVRELIAQEKYEEADQLSRDMMGPYTQSYLPFGDLNIFMDHGQVVAPHYHRELDLSTGIVTVTYTIGGVQYTRELFVTYPDRAIVVRLTASKEGFLSFRAKLDSLLRHVSSVEHYTISGTAPEHVSPSYYDEENPVRYGHPDMSQGMTFHGRLAAVNEGGSLKVDADGLHVMGATCATLYFSASTSFDPSTGASCLERDPSLRTIETIKAICKRGYKEIVNRHLEDYTKLFNRVSLHLGESIAPADMSTDQRIKEYGSRDLGLVELLFQYGRYLMIASSRPGTQPANLQGIWNEETRAPWSSNYTLNINAEMNYWPAETCNLAELHKPLIHFIERLAANGKKTAEINYGARGWVAHHNADLWGQTAPVGDFGHGDPVWAFWPMGGVWLTQHLWEHYTFGEDEAYLRDTAYPIMKEAALFCLDWLIENEAGYLVTSPSTSPEQRFRIGEKGYAVSSATTMDLSLIAECFDNCIQAAKRLSIDEDFVKALSDAKQRLLPLQIGKRGQLQEWSNDFEDEDVHHRHVSHLVGIYPGRLITEQSAPNLFEAAKTSLEIRGDEGTGWSLGWKISLWARFKDGNRCERLLSNMLTLIKEDESMQHRGGVYANLFGAHPPFQIDGNFSATAGIAEMLLQSHQGYLEFLPALPDSWKDGYVKGLRGRGGYEVDLAWTNGALVKVEIVSTKTQTCEVLTRISMRITESGEEVEGDVLDSGRMSFQVEKGKRYVLNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BH0842 protein
publication title Crystal structure of a putative glycoside hydrolase family protein from Bacillus halodurans.
rcsb
source organism Bacillus halodurans c-125
molecule tags Hydrolase
total genus 255
structure length 787
sequence length 789
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14498 Glyco_hyd_65N_2 Glycosyl hydrolase family 65, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.50 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 putative glycoside hydrolase family protein from bacillus halodurans 2rdyA01
2EAEA 5GW7A 2EABA 4UFCA 2EADA 3W7WA 3W7XA 2RDYA 2EACA 3D3IA 3W7SA 3W7UA 5CA3A 3W7TA
chains in the Genus database with same CATH superfamily
2WVZA 2CFWA 3X41A 2WOHA 4DUWA 3NBJA 4BZGA 3DCDA 4AQ0A 3T0BA 1LXMA 3I3BA 1NSSA 3VSMA 2E2TA 1F1SA 5GW7A 1MMXA 3SX1A 1X1IA 2BRWA 4MMIA 3S4BA 1JYWA 1D6UA 2CG0A 3D3IA 3W7SA 2Y73A 3EJUA 3S4CA 2ZL8A 4BTXA 1IVVA 4FNVA 3BVXA 3A0OA 1NS7A 5JMFA 4EV5A 1JZ3A 1X1HA 5CA3A 1JZ7A 3QFZA 1OACA 1LURA 1WMOA 1F4HA 1TQUA 1JYVA 1L7JA 2FUQA 3NJXA 3DX3A 3EJQA 3I3DA 3AFLA 1O7DD 2D73A 3W7UA 2WZSA 3Q1NA 3WVFA 3EJTA 4KFEA 1W2ZA 4KTRA 2Q1FA 3BUPA 1W5ZA 1UG9A 1V7XA 3WIQA 2XN1A 1NS4A 1AVLA 1L7KA 2CWTA 1RWAA 2Y74A 2HTBA 3BVVA 1SIHA 1F9GA 1LVNA 1NS8A 2CWUA 1IVWA 3KIIA 4K35A 1TXKA 1QX1A 1WMPA 4RNLA 1QAFA 1YQ2A 3QG0A 3CV5A 4KTPA 3X42A 3W7WA 3T2OA 2WYHA 1W6GA 2CQTA 2C11A 4FNSA 2OW7A 2W0QA 4BZEA 3EJSA 1QWUA 1PX3A 3A24A 1HM2A 2E24A 3DX2A 1F4AA 3MV01 3IMHA 2WVYA 1DP0A 3T0DA 2E2UA 3X3ZA 3BLCA 2WCOA 2BT3A 1HM3A 3TY1A 3BUIA 3KN4A 1WMNA 1HMWA 1OJNA 3SEPA 3VDCA 3D52A 1R34A 3HI7A 1OJPA 1NSXA 3HIGA 1MMZA 1AVKA 3DX1A 3CZSA 1HMUA 3MWXA 2CFKA 2OQEA 1MMUA 4BZFA 3N9HA 3X3YA 1IVXA 2YX9A 1Z45A 3BVUA 3WA3A 3OB8A 2OOVA 1J0MA 1JZ5A 2WW0A 1K1YA 3W7XA 1N7RA 1C82A 2YFNA 2CG1A 3E1F1 2EADA 3MPHA 1D6ZA 1RWGA 1RW9A 3WA2X 5A1AA 1DYUA 3BLBA 1TQVA 1SNZA 3W7TA 2WDAA 3PGBA 2F1BA 3MUY1 1IVUA 3DDFA 2CQSA 1V7VA 2HTAA 1HWWA 1SO0A 1R33A 2CIRA 3BS6A 2WGQA 3BVWA 2C10A 1LXKA 2F7RA 3BGAA 4FNQA 1D6YA 2E2VA 1W7CA 2OQEC 3DX0A 3IAPA 1KSIA 2E22A 3VD3A 2OW6A 1IQYA 1QWNA 2CWVA 2F7OA 2OOVC 1LF9A 4OK2A 3J7HA 1TQTA 1TQWA 3LVTA 3AFJA 1JRQA 1NSUA 2ZXQA 3VD5A 1W3YA 2XSGA 1V7WA 1X1JA 1W6CA 1NSZA 1HN1A 3HIIA 2ALWA 2F7PA 3WFAA 4FNUA 1JYNA 3CZNA 1AV4A 3T08A 3DYPA 3T09A 1UI7A 1MN0A 1UI8A 1NS0A 1JZ2A 1EKMA 4DUVA 1EGUA 1W4NA 3ACTA 2BRVX 3VDBA 4FNPA 2XHNA 3T0UA 1H54A 2ZQ0A 2FYVA 1HN0A 3BUDA 2JKAA 2WW1A 1LF6A 2EACA 1ULVA 3OBAA 3X3XA 2XN0A 1RWHA 3OS7A 3T2PA 1YGAA 3EJRA 3K5TA 1N7QA 1TU5A 3D51A 3D4YA 4KFDA 3ALAA 1CB8A 2RDYA 5KBPA 1LOHA 1IU7A 2D1WA 1PX4A 3AMOA 1HXKA 3D4ZA 4FNRA 1NKGA 1RWFA 1QAKA 1OJMA 1JZ8A 2FUTA 2WO0A 2BRPA 2JKEA 3MV11 4DUXA 4K3AA 3DECA 5JMDA 3DYOA 2WYIA 1RWCA 2JKPA 3AMOB 1HTYA 4NEIA 1RKYA 3BVTA 1N9EA 3RRSA 3SXXA 3LOYA 1SPUA 1I8QA 1A2VA 2CISA 1MMYA 2WW2A 3VD7A 1US1A 3VDAA 4KFFA 3NBBA 3MUZ1 3QFYA 1PU4A 3VSNA 2WVXA 1JYXA 1K1WA 1J0NA 2EABA 4EV2A 4BZHA 4OJZA 1N7NA 1OJOA 3BUBA 3S4DA 2CIQA 4J5TA 2CFDA 3DYMA 5E1QA 2F18A 3VD4A 3E80A 2CFGA 3DDGA 3QDEA 3NREA 2PNCA 1N7PA 3DX4A 2WVXB 3T2QA 1PS3A 1NSRA 2EAEA 1K1XA 2F7QA 3VD9A 4BTWA 1SIIA 3WIRA 4FNTA 1TQSA 3NJVA 4TTGA 3D50A 2F1AA 1NSMA 2WW3A 3ACSA 1QALA 2XN2A 1JZ6A 2YFOA 3IAQA 3EJPA 2CFLA 3I3EA 2X03A 4BTYA 1RJOA 3K25A 3T0AA 1JOVA 1JZ4A 3CZJA 4UFCA 1NS2A 3ECQA 3S4AA 3X40A 1IQXA 3E7JA 2WOFA 1NSVA 3MI6A 4OK4A 1N7OA 4MMHA 3BUQA 3RSYA
chains in the Genus database with same CATH topology
2EAEA 5GW7A 2EABA 4UFCA 2EADA 3W7WA 3W7XA 2RDYA 2EACA 3D3IA 3W7SA 3W7UA 5CA3A 3W7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAE A;  5GW7 A;  2EAB A;  4UFC A;  2EAD A;  3W7W A;  3W7X A;  2RDY A;  2EAC A;  3D3I A;  3W7S A;  3W7U A;  5CA3 A;  3W7T A; 
#chains in the Genus database with same CATH topology
 2WVZ A;  2CFW A;  3X41 A;  2WOH A;  4DUW A;  3NBJ A;  4BZG A;  3DCD A;  4AQ0 A;  3T0B A;  1LXM A;  3I3B A;  1NSS A;  3VSM A;  2E2T A;  1F1S A;  5GW7 A;  1MMX A;  3SX1 A;  1X1I A;  2BRW A;  4MMI A;  3S4B A;  1JYW A;  1D6U A;  2CG0 A;  3D3I A;  3W7S A;  2Y73 A;  3EJU A;  3S4C A;  2ZL8 A;  4BTX A;  1IVV A;  4FNV A;  3BVX A;  3A0O A;  1NS7 A;  5JMF A;  4EV5 A;  1JZ3 A;  1X1H A;  5CA3 A;  1JZ7 A;  3QFZ A;  1OAC A;  1LUR A;  1WMO A;  1F4H A;  1TQU A;  1JYV A;  1L7J A;  2FUQ A;  3NJX A;  3DX3 A;  3EJQ A;  3I3D A;  3AFL A;  1O7D D;  2D73 A;  3W7U A;  2WZS A;  3Q1N A;  3WVF A;  3EJT A;  4KFE A;  1W2Z A;  4KTR A;  2Q1F A;  3BUP A;  1W5Z A;  1UG9 A;  1V7X A;  3WIQ A;  2XN1 A;  1NS4 A;  1AVL A;  1L7K A;  2CWT A;  1RWA A;  2Y74 A;  2HTB A;  3BVV A;  1SIH A;  1F9G A;  1LVN A;  1NS8 A;  2CWU A;  1IVW A;  3KII A;  4K35 A;  1TXK A;  1QX1 A;  1WMP A;  4RNL A;  1QAF A;  1YQ2 A;  3QG0 A;  3CV5 A;  4KTP A;  3X42 A;  3W7W A;  3T2O A;  2WYH A;  1W6G A;  2CQT A;  2C11 A;  4FNS A;  2OW7 A;  2W0Q A;  4BZE A;  3EJS A;  1QWU A;  1PX3 A;  3A24 A;  1HM2 A;  2E24 A;  3DX2 A;  1F4A A;  3MV0 1;  3IMH A;  2WVY A;  1DP0 A;  3T0D A;  2E2U A;  3X3Z A;  3BLC A;  2WCO A;  2BT3 A;  1HM3 A;  3TY1 A;  3BUI A;  3KN4 A;  1WMN A;  1HMW A;  1OJN A;  3SEP A;  3VDC A;  3D52 A;  1R34 A;  3HI7 A;  1OJP A;  1NSX A;  3HIG A;  1MMZ A;  1AVK A;  3DX1 A;  3CZS A;  1HMU A;  3MWX A;  2CFK A;  2OQE A;  1MMU A;  4BZF A;  3N9H A;  3X3Y A;  1IVX A;  2YX9 A;  1Z45 A;  3BVU A;  3WA3 A;  3OB8 A;  2OOV A;  1J0M A;  1JZ5 A;  2WW0 A;  1K1Y A;  3W7X A;  1N7R A;  1C82 A;  2YFN A;  2CG1 A;  3E1F 1;  2EAD A;  3MPH A;  1D6Z A;  1RWG A;  1RW9 A;  3WA2 X;  5A1A A;  1DYU A;  3BLB A;  1TQV A;  1SNZ A;  3W7T A;  2WDA A;  3PGB A;  2F1B A;  3MUY 1;  1IVU A;  3DDF A;  2CQS A;  1V7V A;  2HTA A;  1HWW A;  1SO0 A;  1R33 A;  2CIR A;  3BS6 A;  2WGQ A;  3BVW A;  2C10 A;  1LXK A;  2F7R A;  3BGA A;  4FNQ A;  1D6Y A;  2E2V A;  1W7C A;  2OQE C;  3DX0 A;  3IAP A;  1KSI A;  2E22 A;  3VD3 A;  2OW6 A;  1IQY A;  1QWN A;  2CWV A;  2F7O A;  2OOV C;  1LF9 A;  4OK2 A;  3J7H A;  1TQT A;  1TQW A;  3LVT A;  3AFJ A;  1JRQ A;  1NSU A;  2ZXQ A;  3VD5 A;  1W3Y A;  2XSG A;  1V7W A;  1X1J A;  1W6C A;  1NSZ A;  1HN1 A;  3HII A;  2ALW A;  2F7P A;  3WFA A;  4FNU A;  1JYN A;  3CZN A;  1AV4 A;  3T08 A;  3DYP A;  3T09 A;  1UI7 A;  1MN0 A;  1UI8 A;  1NS0 A;  1JZ2 A;  1EKM A;  4DUV A;  1EGU A;  1W4N A;  3ACT A;  2BRV X;  3VDB A;  4FNP A;  2XHN A;  3T0U A;  1H54 A;  2ZQ0 A;  2FYV A;  1HN0 A;  3BUD A;  2JKA A;  2WW1 A;  1LF6 A;  2EAC A;  1ULV A;  3OBA A;  3X3X A;  2XN0 A;  1RWH A;  3OS7 A;  3T2P A;  1YGA A;  3EJR A;  3K5T A;  1N7Q A;  1TU5 A;  3D51 A;  3D4Y A;  4KFD A;  3ALA A;  1CB8 A;  2RDY A;  5KBP A;  1LOH A;  1IU7 A;  2D1W A;  1PX4 A;  3AMO A;  1HXK A;  3D4Z A;  4FNR A;  1NKG A;  1RWF A;  1QAK A;  1OJM A;  1JZ8 A;  2FUT A;  2WO0 A;  2BRP A;  2JKE A;  3MV1 1;  4DUX A;  4K3A A;  3DEC A;  5JMD A;  3DYO A;  2WYI A;  1RWC A;  2JKP A;  3AMO B;  1HTY A;  4NEI A;  1RKY A;  3BVT A;  1N9E A;  3RRS A;  3SXX A;  3LOY A;  1SPU A;  1I8Q A;  1A2V A;  2CIS A;  1MMY A;  2WW2 A;  3VD7 A;  1US1 A;  3VDA A;  4KFF A;  3NBB A;  3MUZ 1;  3QFY A;  1PU4 A;  3VSN A;  2WVX A;  1JYX A;  1K1W A;  1J0N A;  2EAB A;  4EV2 A;  4BZH A;  4OJZ A;  1N7N A;  1OJO A;  3BUB A;  3S4D A;  2CIQ A;  4J5T A;  2CFD A;  3DYM A;  5E1Q A;  2F18 A;  3VD4 A;  3E80 A;  2CFG A;  3DDG A;  3QDE A;  3NRE A;  2PNC A;  1N7P A;  3DX4 A;  2WVX B;  3T2Q A;  1PS3 A;  1NSR A;  2EAE A;  1K1X A;  2F7Q A;  3VD9 A;  4BTW A;  1SII A;  3WIR A;  4FNT A;  1TQS A;  3NJV A;  4TTG A;  3D50 A;  2F1A A;  1NSM A;  2WW3 A;  3ACS A;  1QAL A;  2XN2 A;  1JZ6 A;  2YFO A;  3IAQ A;  3EJP A;  2CFL A;  3I3E A;  2X03 A;  4BTY A;  1RJO A;  3K25 A;  3T0A A;  1JOV A;  1JZ4 A;  3CZJ A;  4UFC A;  1NS2 A;  3ECQ A;  3S4A A;  3X40 A;  1IQX A;  3E7J A;  2WOF A;  1NSV A;  3MI6 A;  4OK4 A;  1N7O A;  4MMH A;  3BUQ A;  3RSY A; 
#chains in the Genus database with same CATH homology
 2EAE A;  5GW7 A;  2EAB A;  4UFC A;  2EAD A;  3W7W A;  3W7X A;  2RDY A;  2EAC A;  3D3I A;  3W7S A;  3W7U A;  5CA3 A;  3W7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...