2RDYA

Crystal structure of a putative glycoside hydrolase family protein from bacillus halodurans
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
789
structure length
787
Chain Sequence
LKIQFDFPASFWTEALPIGNGNLGAMVFGKVEKERIALNEDTLWSGYPKDWNNPKAKEVLPKVRELIAQEKYEEADQLSRDMMGPYTQSYLPFGDLNIFMDHGQVVAPHYHRELDLSTGIVTVTYTIGGVQYTRELFVTYPDRAIVVRLTASKEGFLSFRAKLDSLLRHVSSVEHYTISGTAPEHVSPSYYDEENPVRYGHPDMSQGMTFHGRLAAVNEGGSLKVDADGLHVMGATCATLYFSASTSFDPSTGASCLERDPSLRTIETIKAICKRGYKEIVNRHLEDYTKLFNRVSLHLGESIAPADMSTDQRIKEYGSRDLGLVELLFQYGRYLMIASSRPGTQPANLQGIWNEETRAPWSSNYTLNINAEMNYWPAETCNLAELHKPLIHFIERLAANGKKTAEINYGARGWVAHHNADLWGQTAPVGDFGHGDPVWAFWPMGGVWLTQHLWEHYTFGEDEAYLRDTAYPIMKEAALFCLDWLIENEAGYLVTSPSTSPEQRFRIGEKGYAVSSATTMDLSLIAECFDNCIQAAKRLSIDEDFVKALSDAKQRLLPLQIGKRGQLQEWSNDFEDEDVHHRHVSHLVGIYPGRLITEQSAPNLFEAAKTSLEIRGDEGTGWSLGWKISLWARFKDGNRCERLLSNMLTLIKEDESMQHRGGVYANLFGAHPPFQIDGNFSATAGIAEMLLQSHQGYLEFLPALPDSWKDGYVKGLRGRGGYEVDLAWTNGALVKVEIVSTKTQTCEVLTRISMRITESGEEVEGDVLDSGRMSFQVEKGKRYVLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BH0842 protein
publication title Crystal structure of a putative glycoside hydrolase family protein from Bacillus halodurans.
rcsb
source organism Bacillus halodurans c-125
molecule tags Hydrolase
total genus 255
structure length 787
sequence length 789
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14498 Glyco_hyd_65N_2 Glycosyl hydrolase family 65, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.50 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 putative glycoside hydrolase family protein from bacillus halodurans 2rdyA01
2EACA 3W7UA 5GW7A 3W7XA 3W7SA 3W7TA 5CA3A 2EAEA 2EADA 3W7WA 3D3IA 4UFCA 2EABA 2RDYA
chains in the Genus database with same CATH superfamily
1IU7A 1HM2A 4FNVA 2WW2A 2WW0A 1TQWA 1N7RA 3T0UA 2WGQA 2HTBA 3A24A 4BTXA 3VSNA 3VDBA 3BGAA 3S4BA 3BUDA 4KTPA 2WYHA 1WMOA 1HMUA 2CISA 3D50A 3WIRA 1EGUA 2FUTA 2JKEA 2WOHA 1NSVA 3CZNA 1W6CA 1TQVA 3E1F1 3J7HA 2F7PA 3BLBA 2E2TA 3T0BA 1SNZA 2XHNA 1QWUA 3DYMA 3DCDA 1V7VA 3HIIA 2C11A 2CQSA 1TXKA 3X41A 3VDCA 3ALAA 1N7OA 1RJOA 1K1YA 1JYWA 4BTWA 1N7QA 2WCOA 4BZEA 2CFGA 2CFLA 1UG9A 3DX3A 1O7DD 1OACA 3VD4A 1LF6A 3MUY1 1OJMA 3LVTA 1AVLA 2F1AA 4KTRA 4OK4A 2D1WA 4FNUA 3WA3A 3AFLA 5GW7A 3WVFA 1US1A 3VSMA 2EADA 1C82A 3OBAA 1LF9A 1TQTA 2OQEC 1V7WA 1JRQA 3X3XA 1DP0A 3Q1NA 3BVVA 2E2VA 2WDAA 1NSMA 2CIQA 3T0DA 3X3ZA 4MMHA 2YX9A 3NJXA 3PGBA 1OJPA 2XN0A 4FNPA 1L7KA 2Y73A 1D6YA 1W6GA 1X1IA 3NBJA 1PX4A 1NSRA 3BUQA 1R33A 1NKGA 3VD3A 1W4NA 4K35A 3DX1A 3D4YA 1F4AA 1J0MA 3ECQA 4DUWA 1JYNA 1D6UA 3VD9A 3SX1A 3DYPA 1NSXA 1HWWA 1WMPA 1RWAA 2WZSA 3QFYA 1PS3A 2CFDA 3KN4A 1JYVA 1YGAA 3IAPA 2CWTA 3IMHA 1QX1A 3BUBA 1Z45A 1NSUA 2WYIA 1RWGA 3BVXA 3CZSA 4OJZA 3T0AA 3W7UA 3W7TA 4UFCA 1F9GA 1DYUA 1NS0A 2JKPA 1D6ZA 3NBBA 1F4HA 4DUVA 1UI7A 1HXKA 1LVNA 3BS6A 1J0NA 1RWCA 3DECA 1W3YA 4KFFA 1HTYA 3EJUA 2E24A 1X1JA 3K25A 3T2QA 3S4CA 1MN0A 2BT3A 2W0QA 3ACSA 3E7JA 3I3EA 1F1SA 1K1XA 2OOVC 1CB8A 3T09A 2WVXB 2PNCA 3OB8A 3HIGA 2ZQ0A 1IQXA 3BUIA 3MV01 1KSIA 3IAQA 1QALA 3EJQA 3A0OA 2CWVA 3BVUA 2F1BA 1EKMA 3QFZA 2ZXQA 4BTYA 2Y74A 2F7RA 1W5ZA 2WW1A 1RWHA 1NS4A 1NSZA 2OW7A 4NEIA 3WFAA 2EACA 4AQ0A 1SIIA 1L7JA 1TQUA 3MV11 4TTGA 1R34A 1W2ZA 2C10A 3KIIA 5E1QA 1QWNA 3CZJA 3I3BA 4FNSA 2CG0A 1PX3A 2XSGA 3DDGA 4BZGA 2XN2A 3SEPA 3QDEA 3E80A 4K3AA 1N9EA 3DX4A 1W7CA 4KFDA 5JMFA 1UI8A 2XN1A 2E22A 4FNRA 1LXKA 3X40A 1LURA 1QAFA 2WW3A 3RSYA 1OJOA 5JMDA 2WVZA 4EV5A 3X3YA 3WIQA 2EAEA 3CV5A 2WOFA 3DDFA 3AFJA 2OQEA 3VD7A 3AMOB 2E2UA 1OJNA 1IVWA 1I8QA 1MMYA 2Q1FA 3RRSA 3T08A 3DX2A 1JZ5A 1JZ8A 3EJTA 2OW6A 3HI7A 1K1WA 4OK2A 1H54A 3BUPA 3K5TA 3MWXA 2X03A 2ALWA 3S4AA 1TU5A 2CQTA 3N9HA 1V7XA 3EJPA 4KFEA 2WVYA 1AVKA 5CA3A 2BRWA 1IVUA 2HTAA 2BRPA 4EV2A 3BVWA 2FUQA 3NJVA 1N7NA 1NSSA 1LOHA 1LXMA 3TY1A 3VD5A 3I3DA 1RWFA 3ACTA 2F7QA 2WVXA 4BZFA 1WMNA 3W7XA 3NREA 1HN1A 3LOYA 1ULVA 3T2PA 1X1HA 1JZ6A 1JZ7A 1JZ3A 2CIRA 3DYOA 2YFOA 1YQ2A 1AV4A 1HMWA 1RKYA 1MMUA 2CG1A 1NS8A 3OS7A 4FNTA 1JZ4A 1SIHA 2F18A 1NS7A 4RNLA 3D3IA 2F7OA 1N7PA 3EJRA 1HN0A 2OOVA 1NS2A 1MMZA 1QAKA 4FNQA 1JOVA 3T2OA 1RW9A 3W7SA 1SPUA 3QG0A 1SO0A 2YFNA 1IQYA 4DUXA 3X42A 3MUZ1 2D73A 3WA2X 2RDYA 2BRVX 3EJSA 4MMIA 3BVTA 1JZ2A 1IVVA 1IVXA 3DX0A 2CFWA 2WO0A 3MPHA 1MMXA 2FYVA 3BLCA 4J5TA 5KBPA 2CWUA 1PU4A 2EABA 3D4ZA 2JKAA 1JYXA 3AMOA 3MI6A 3S4DA 3W7WA 1TQSA 1HM3A 1A2VA 4BZHA 3D52A 2ZL8A 3D51A 5A1AA 3VDAA 2CFKA 3SXXA
chains in the Genus database with same CATH topology
2EACA 3W7UA 5GW7A 3W7XA 3W7SA 3W7TA 5CA3A 2EAEA 2EADA 3W7WA 3D3IA 4UFCA 2EABA 2RDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAC A;  3W7U A;  5GW7 A;  3W7X A;  3W7S A;  3W7T A;  5CA3 A;  2EAE A;  2EAD A;  3W7W A;  3D3I A;  4UFC A;  2EAB A;  2RDY A; 
#chains in the Genus database with same CATH topology
 1IU7 A;  1HM2 A;  4FNV A;  2WW2 A;  2WW0 A;  1TQW A;  1N7R A;  3T0U A;  2WGQ A;  2HTB A;  3A24 A;  4BTX A;  3VSN A;  3VDB A;  3BGA A;  3S4B A;  3BUD A;  4KTP A;  2WYH A;  1WMO A;  1HMU A;  2CIS A;  3D50 A;  3WIR A;  1EGU A;  2FUT A;  2JKE A;  2WOH A;  1NSV A;  3CZN A;  1W6C A;  1TQV A;  3E1F 1;  3J7H A;  2F7P A;  3BLB A;  2E2T A;  3T0B A;  1SNZ A;  2XHN A;  1QWU A;  3DYM A;  3DCD A;  1V7V A;  3HII A;  2C11 A;  2CQS A;  1TXK A;  3X41 A;  3VDC A;  3ALA A;  1N7O A;  1RJO A;  1K1Y A;  1JYW A;  4BTW A;  1N7Q A;  2WCO A;  4BZE A;  2CFG A;  2CFL A;  1UG9 A;  3DX3 A;  1O7D D;  1OAC A;  3VD4 A;  1LF6 A;  3MUY 1;  1OJM A;  3LVT A;  1AVL A;  2F1A A;  4KTR A;  4OK4 A;  2D1W A;  4FNU A;  3WA3 A;  3AFL A;  5GW7 A;  3WVF A;  1US1 A;  3VSM A;  2EAD A;  1C82 A;  3OBA A;  1LF9 A;  1TQT A;  2OQE C;  1V7W A;  1JRQ A;  3X3X A;  1DP0 A;  3Q1N A;  3BVV A;  2E2V A;  2WDA A;  1NSM A;  2CIQ A;  3T0D A;  3X3Z A;  4MMH A;  2YX9 A;  3NJX A;  3PGB A;  1OJP A;  2XN0 A;  4FNP A;  1L7K A;  2Y73 A;  1D6Y A;  1W6G A;  1X1I A;  3NBJ A;  1PX4 A;  1NSR A;  3BUQ A;  1R33 A;  1NKG A;  3VD3 A;  1W4N A;  4K35 A;  3DX1 A;  3D4Y A;  1F4A A;  1J0M A;  3ECQ A;  4DUW A;  1JYN A;  1D6U A;  3VD9 A;  3SX1 A;  3DYP A;  1NSX A;  1HWW A;  1WMP A;  1RWA A;  2WZS A;  3QFY A;  1PS3 A;  2CFD A;  3KN4 A;  1JYV A;  1YGA A;  3IAP A;  2CWT A;  3IMH A;  1QX1 A;  3BUB A;  1Z45 A;  1NSU A;  2WYI A;  1RWG A;  3BVX A;  3CZS A;  4OJZ A;  3T0A A;  3W7U A;  3W7T A;  4UFC A;  1F9G A;  1DYU A;  1NS0 A;  2JKP A;  1D6Z A;  3NBB A;  1F4H A;  4DUV A;  1UI7 A;  1HXK A;  1LVN A;  3BS6 A;  1J0N A;  1RWC A;  3DEC A;  1W3Y A;  4KFF A;  1HTY A;  3EJU A;  2E24 A;  1X1J A;  3K25 A;  3T2Q A;  3S4C A;  1MN0 A;  2BT3 A;  2W0Q A;  3ACS A;  3E7J A;  3I3E A;  1F1S A;  1K1X A;  2OOV C;  1CB8 A;  3T09 A;  2WVX B;  2PNC A;  3OB8 A;  3HIG A;  2ZQ0 A;  1IQX A;  3BUI A;  3MV0 1;  1KSI A;  3IAQ A;  1QAL A;  3EJQ A;  3A0O A;  2CWV A;  3BVU A;  2F1B A;  1EKM A;  3QFZ A;  2ZXQ A;  4BTY A;  2Y74 A;  2F7R A;  1W5Z A;  2WW1 A;  1RWH A;  1NS4 A;  1NSZ A;  2OW7 A;  4NEI A;  3WFA A;  2EAC A;  4AQ0 A;  1SII A;  1L7J A;  1TQU A;  3MV1 1;  4TTG A;  1R34 A;  1W2Z A;  2C10 A;  3KII A;  5E1Q A;  1QWN A;  3CZJ A;  3I3B A;  4FNS A;  2CG0 A;  1PX3 A;  2XSG A;  3DDG A;  4BZG A;  2XN2 A;  3SEP A;  3QDE A;  3E80 A;  4K3A A;  1N9E A;  3DX4 A;  1W7C A;  4KFD A;  5JMF A;  1UI8 A;  2XN1 A;  2E22 A;  4FNR A;  1LXK A;  3X40 A;  1LUR A;  1QAF A;  2WW3 A;  3RSY A;  1OJO A;  5JMD A;  2WVZ A;  4EV5 A;  3X3Y A;  3WIQ A;  2EAE A;  3CV5 A;  2WOF A;  3DDF A;  3AFJ A;  2OQE A;  3VD7 A;  3AMO B;  2E2U A;  1OJN A;  1IVW A;  1I8Q A;  1MMY A;  2Q1F A;  3RRS A;  3T08 A;  3DX2 A;  1JZ5 A;  1JZ8 A;  3EJT A;  2OW6 A;  3HI7 A;  1K1W A;  4OK2 A;  1H54 A;  3BUP A;  3K5T A;  3MWX A;  2X03 A;  2ALW A;  3S4A A;  1TU5 A;  2CQT A;  3N9H A;  1V7X A;  3EJP A;  4KFE A;  2WVY A;  1AVK A;  5CA3 A;  2BRW A;  1IVU A;  2HTA A;  2BRP A;  4EV2 A;  3BVW A;  2FUQ A;  3NJV A;  1N7N A;  1NSS A;  1LOH A;  1LXM A;  3TY1 A;  3VD5 A;  3I3D A;  1RWF A;  3ACT A;  2F7Q A;  2WVX A;  4BZF A;  1WMN A;  3W7X A;  3NRE A;  1HN1 A;  3LOY A;  1ULV A;  3T2P A;  1X1H A;  1JZ6 A;  1JZ7 A;  1JZ3 A;  2CIR A;  3DYO A;  2YFO A;  1YQ2 A;  1AV4 A;  1HMW A;  1RKY A;  1MMU A;  2CG1 A;  1NS8 A;  3OS7 A;  4FNT A;  1JZ4 A;  1SIH A;  2F18 A;  1NS7 A;  4RNL A;  3D3I A;  2F7O A;  1N7P A;  3EJR A;  1HN0 A;  2OOV A;  1NS2 A;  1MMZ A;  1QAK A;  4FNQ A;  1JOV A;  3T2O A;  1RW9 A;  3W7S A;  1SPU A;  3QG0 A;  1SO0 A;  2YFN A;  1IQY A;  4DUX A;  3X42 A;  3MUZ 1;  2D73 A;  3WA2 X;  2RDY A;  2BRV X;  3EJS A;  4MMI A;  3BVT A;  1JZ2 A;  1IVV A;  1IVX A;  3DX0 A;  2CFW A;  2WO0 A;  3MPH A;  1MMX A;  2FYV A;  3BLC A;  4J5T A;  5KBP A;  2CWU A;  1PU4 A;  2EAB A;  3D4Z A;  2JKA A;  1JYX A;  3AMO A;  3MI6 A;  3S4D A;  3W7W A;  1TQS A;  1HM3 A;  1A2V A;  4BZH A;  3D52 A;  2ZL8 A;  3D51 A;  5A1A A;  3VDA A;  2CFK A;  3SXX A; 
#chains in the Genus database with same CATH homology
 2EAC A;  3W7U A;  5GW7 A;  3W7X A;  3W7S A;  3W7T A;  5CA3 A;  2EAE A;  2EAD A;  3W7W A;  3D3I A;  4UFC A;  2EAB A;  2RDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...