1RFUA

Crystal structure of pyridoxal kinase complexed with adp and plp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
312
structure length
312
Chain Sequence
MEEECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRAPDGSVVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in the reaction of pyridoxal kinase
pubmed doi rcsb
molecule tags Transferase
molecule keywords pyridoxal kinase
total genus 96
structure length 312
sequence length 312
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1rfuA00
1VM7A 4KALA 3H49A 4K8TA 3RQ5A 4U7XA 4KANA 5C3ZA 4E8ZA 3QAIA 2VARA 2QHPA 3IH0A 3RPHA 1ESQA 1VI9A 2HLZA 4B8RA 3NL5A 4UBEA 3RM5A 3EWMA 3RPZA 4DU5A 3NL6A 2A9YA 3HPDA 4N08A 5CGEA 3K5WA 2PKMA 1VK4A 3RTDA 3N1CA 3RTGA 1V1BA 2YXUA 2JGVA 3CQDA 2ABQA 3H74A 3B3LA 4LBXA 3RTEA 4S1HA 5BYDA 4KBEA 1YHJA 4E69A 3FHXA 4E84A 4S1IB 1YGKA 2DDOA 3PZSA 2AWDA 3RRBA 1L2LA 4C5MA 1C3QA 5TRWA 5CGAA 2NWHA 3RS8A 4EOHA 2YXTA 3ZS7A 1UB0A 2AFBA 1WYEA 3LOOA 1UA4A 3OTXA 3GBUA 3RSSA 2XTBA 2V78A 3NL3A 2AB8A 2I6BA 3RQXA 3IBQA 3B1QA 1U2XA 1LIJA 3B1PA 3FHYA 3KD6A 1TZ6A 2DDWA 2Q5RA 4K93A 5COJA 3UQ9A 4B8SA 1LIKA 2DDMA 2C49A 3RT9A 1EKKA 2PKKA 2JG5A 4JKUA 4KADA 3W4SA 3NM3A 3RRJA 1RKDA 1V1SA 4DC3A 5F11A 2C4EA 3KEUA 1KYHA 3UQDA 1GC5A 1V19A 2AJRA 3LJSA 5BYEA 3RY7A 2QCVA 1GQTA 3UBOA 4LC4A 3HYOA 1V1AA 3IN1A 4K8PA 4S1IA 3VASA 1LHRA 3IE7A 2R3EA 3RU3A 1JXHA 3RQ8A 1RFVA 1EKQA 5EY7A 1TD2A 1LHPA 3BF5A 4O1LA 5BYFA 5C41A 2AX3A 4EBUA 1YGJA 3IKHA 3VAQA 3HICA 3RT7A 1RK2A 5B6AA 3KZHA 5C3YA 3PL2A 2HQQA 3RQHA 3RQ6A 3RQQA 2AJPA 5TQIA 2F7KA 3I3YA 3NBVA 4YL5A 4C5LA 4E3AA 4JKSA 4EN4A 5F0ZA 1RFTA 2PKFA 3UMOA 3DZVA 4K9CA 4PVVA 4XDAA 3KTNA 3LHXA 3Q92A 4S1MA 3B1OA 3IQ0A 3JULA 3LKIA 4K9IA 4N09A 4XF7A 3RTAA 5EYNA 4GM6A 3UQ6A 1LIOA 3DRWA 2FV7A 3RSGA 3GO7A 3B1RA 4C5JA 3GO6A 3K9EA 3RREA 1TYYA 5BYCA 5C40A 4WJMA 3RU2A 4K8CA 4KAHA 4O1GA 3NBWA 1RKSA 3RS9A 2RBCA 3B1NA 2JG1A 1BX4A 3RSQA 3RTCA 4E8WA 3NL2A 4XCKA 2PKNA 3NCAA 2A9ZA 2HW1A 1RFUA 4LCAA 2I5BA 4E8YA 4K8KA 3RSFA 5CM5A 1JXIA 2ABSA 1ESJA 4LBGA 3UQEA 4YWRA 3RQ2A 4C5KA 3MBHA 3QA2A 1TZ3A 3NC9A 3UMPA 4JJPA 3NC2A 4X8FA 3RRFA 3RO4A 3BGKA 2DCNA 4C5NA 4EUMA 2F02A 3MBJA 2R3BA 2I6AA 2AA0A 1LIIA 1RKAA 4XF6A 3NM1A 1DGMA 3RTBA 3Q1YA
chains in the Genus database with same CATH superfamily
1VM7A 4KALA 3H49A 4K8TA 3RQ5A 4C12A 4U7XA 4KANA 2AM2A 5C3ZA 1UAGA 3QAIA 4BUCA 4E8ZA 2Y1OA 2VARA 2QHPA 4CVMA 3IH0A 4C13A 3RPHA 2GCBA 1ESQA 1VI9A 2HLZA 2VTDA 4B8RA 1O5ZA 3HN7A 4ZIYA 2GC5A 5A5FA 3NL5A 4UBEA 3RM5A 3EWMA 3RPZA 4DU5A 3NL6A 2A9YA 3HPDA 4N08A 5CGEA 3K5WA 2PKMA 1VK4A 3RTDA 4E3AA 3N1CA 2XPCA 1V1BA 3RTGA 2YXUA 2UUOA 2JGVA 3CQDA 2ABQA 3H74A 3ZM5A 3B3LA 2GC6A 4QF5A 4LBXA 3RTEA 4S1HA 5BYDA 4KBEA 1YHJA 3EAGA 4E69A 3FHXA 4E84A 3N2AA 3ZL8A 4S1IB 1YGKA 2DDOA 3PZSA 4CVKA 2AWDA 3RRBA 1L2LA 4C5MA 1C3QA 5TRWA 5CGAA 1W78A 2NWHA 3RS8A 4EOHA 2YXTA 3ZS7A 1UB0A 2AFBA 1WYEA 3LOOA 1UA4A 3OTXA 3GBUA 3RSSA 2XTBA 2V78A 3NL3A 2AB8A 2I6BA 2UAGA 4QDIA 3RQXA 3IBQA 3B1QA 1U2XA 1LIJA 3B1PA 3FHYA 3KD6A 1TZ6A 2DDWA 2Q5RA 2UUPA 4K93A 5COJA 3UQ9A 4B8SA 4UAGA 1E8CA 1LIKA 2DDMA 2C49A 3RT9A 1EKKA 2PKKA 2JG5A 4JKUA 4KADA 1GG4A 3NM3A 3RRJA 1RKDA 1V1SA 3W4SA 4DC3A 5F11A 2C4EA 3KEUA 1KYHA 3UQDA 1GC5A 1V19A 2AJRA 3LJSA 3PYZA 5BYEA 3RY7A 2QCVA 1GQTA 3UBOA 4LC4A 3HYOA 1V1AA 3IN1A 4K8PA 4S1IA 3VASA 1LHRA 3IE7A 2R3EA 3RU3A 1JXHA 3UAGA 3RQ8A 1RFVA 1EKQA 5EY7A 1TD2A 1LHPA 3BF5A 4O1LA 5BYFA 5C41A 4CVLA 2AX3A 4EBUA 1YGJA 3IKHA 3VAQA 3HICA 3RT7A 1RK2A 5B6AA 3KZHA 4BUBA 3PL2A 5C3YA 1GQYA 2HQQA 3RQHA 3RQ6A 3RQQA 2AJPA 5TQIA 2F7KA 3I3YA 3NBVA 4YL5A 4C5LA 3QCZA 4JKSA 4EN4A 5F0ZA 3NRSA 1RFTA 2VTEA 1E0DA 2PKFA 3UMOA 1J6UA 3DZVA 4K9CA 4PVVA 4XDAA 1W7KA 5A5EA 2VOSA 3KTNA 3LHXA 2WTZA 3Q92A 2JFHA 3B1OA 4S1MA 2Y67A 3IQ0A 3JULA 3LKIA 4K9IA 1GQQA 1P31A 1JBVA 4GM6A 4N09A 4XF7A 1LIOA 3DRWA 2FV7A 5EYNA 3RSGA 3GO7A 3B1RA 3UQ6A 4C5JA 2GCAA 3GO6A 3K9EA 3RREA 1TYYA 5BYCA 5C40A 4WJMA 3RU2A 4K8CA 4KAHA 4O1GA 3NBWA 1RKSA 1JBWA 3RS9A 2RBCA 3B1NA 2JG1A 1BX4A 3RSQA 3RTCA 4E8WA 3NL2A 4XCKA 2PKNA 1P3DA 3NCAA 2A9ZA 2HW1A 1FGSA 1RFUA 2WJPA 4LCAA 2I5BA 4E8YA 4K8KA 4HV4A 2Y68A 2VORA 3RSFA 5CM5A 1JXIA 2ABSA 1ESJA 2Y66A 4LBGA 4YWRA 3UQEA 3RQ2A 3RTAA 3MBHA 3QA2A 4C5KA 1TZ3A 2JFGA 3HJ6A 3NC9A 3UMPA 4JJPA 3NC2A 4X8FA 2F00A 2X5OA 3RO4A 3RRFA 3BGKA 2DCNA 4C5NA 4EUMA 2F02A 3LK7A 3MBJA 1EEHA 3ZM6A 2I6AA 2AA0A 2JFFA 1LIIA 1RKAA 2AM1A 2R3BA 2XJAA 4XF6A 3NM1A 1DGMA 3RTBA 3Q1YA
chains in the Genus database with same CATH topology
1VM7A 4KALA 3H49A 4K8TA 3RQ5A 4U7XA 4KANA 5C3ZA 4E8ZA 3QAIA 2VARA 2QHPA 3IH0A 3RPHA 1ESQA 1VI9A 2HLZA 4B8RA 3NL5A 4UBEA 3RM5A 3EWMA 3RPZA 4DU5A 3NL6A 2A9YA 3HPDA 4N08A 5CGEA 3K5WA 2PKMA 1VK4A 3RTDA 3N1CA 3RTGA 1V1BA 2YXUA 2JGVA 3CQDA 2ABQA 3H74A 3B3LA 4LBXA 3RTEA 4S1HA 5BYDA 4KBEA 1YHJA 4E69A 3FHXA 4E84A 4S1IB 1YGKA 2DDOA 3PZSA 2AWDA 3RRBA 1L2LA 4C5MA 1C3QA 5TRWA 5CGAA 2NWHA 3RS8A 4EOHA 2YXTA 3ZS7A 1UB0A 2AFBA 1WYEA 3LOOA 1UA4A 3OTXA 3GBUA 3RSSA 2XTBA 2V78A 3NL3A 2AB8A 2I6BA 3RQXA 3IBQA 3B1QA 1U2XA 1LIJA 3B1PA 3FHYA 3KD6A 1TZ6A 2DDWA 2Q5RA 4K93A 5COJA 3UQ9A 4B8SA 1LIKA 2DDMA 2C49A 3RT9A 1EKKA 2PKKA 2JG5A 4JKUA 4KADA 3W4SA 3NM3A 3RRJA 1RKDA 1V1SA 4DC3A 5F11A 2C4EA 3KEUA 1KYHA 3UQDA 1GC5A 1V19A 2AJRA 3LJSA 5BYEA 3RY7A 2QCVA 1GQTA 3UBOA 4LC4A 3HYOA 1V1AA 3IN1A 4K8PA 4S1IA 3VASA 1LHRA 3IE7A 2R3EA 3RU3A 1JXHA 3RQ8A 1RFVA 1EKQA 5EY7A 1TD2A 1LHPA 3BF5A 4O1LA 5BYFA 5C41A 2AX3A 4EBUA 1YGJA 3IKHA 3VAQA 3HICA 3RT7A 1RK2A 5B6AA 3KZHA 5C3YA 3PL2A 2HQQA 3RQHA 3RQ6A 3RQQA 2AJPA 5TQIA 2F7KA 3I3YA 3NBVA 4YL5A 4C5LA 4E3AA 4JKSA 4EN4A 5F0ZA 1RFTA 2PKFA 3UMOA 3DZVA 4K9CA 4PVVA 4XDAA 3KTNA 3LHXA 3Q92A 4S1MA 3B1OA 3IQ0A 3JULA 3LKIA 4K9IA 4N09A 4XF7A 3RTAA 5EYNA 4GM6A 3UQ6A 1LIOA 3DRWA 2FV7A 3RSGA 3GO7A 3B1RA 4C5JA 3GO6A 3K9EA 3RREA 1TYYA 5BYCA 5C40A 4WJMA 3RU2A 4K8CA 4KAHA 4O1GA 3NBWA 1RKSA 3RS9A 2RBCA 3B1NA 2JG1A 1BX4A 3RSQA 3RTCA 4E8WA 3NL2A 4XCKA 2PKNA 3NCAA 2A9ZA 2HW1A 1RFUA 4LCAA 2I5BA 4E8YA 4K8KA 3RSFA 5CM5A 1JXIA 2ABSA 1ESJA 4LBGA 3UQEA 4YWRA 3RQ2A 4C5KA 3MBHA 3QA2A 1TZ3A 3HJ6A 3NC9A 3UMPA 4JJPA 3NC2A 4X8FA 3RRFA 3RO4A 3BGKA 2DCNA 4C5NA 4EUMA 2F02A 3MBJA 2R3BA 2I6AA 2AA0A 1LIIA 1RKAA 4XF6A 3NM1A 1DGMA 3RTBA 3Q1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM7 A;  4KAL A;  3H49 A;  4K8T A;  3RQ5 A;  4U7X A;  4KAN A;  5C3Z A;  4E8Z A;  3QAI A;  2VAR A;  2QHP A;  3IH0 A;  3RPH A;  1ESQ A;  1VI9 A;  2HLZ A;  4B8R A;  3NL5 A;  4UBE A;  3RM5 A;  3EWM A;  3RPZ A;  4DU5 A;  3NL6 A;  2A9Y A;  3HPD A;  4N08 A;  5CGE A;  3K5W A;  2PKM A;  1VK4 A;  3RTD A;  3N1C A;  3RTG A;  1V1B A;  2YXU A;  2JGV A;  3CQD A;  2ABQ A;  3H74 A;  3B3L A;  4LBX A;  3RTE A;  4S1H A;  5BYD A;  4KBE A;  1YHJ A;  4E69 A;  3FHX A;  4E84 A;  4S1I B;  1YGK A;  2DDO A;  3PZS A;  2AWD A;  3RRB A;  1L2L A;  4C5M A;  1C3Q A;  5TRW A;  5CGA A;  2NWH A;  3RS8 A;  4EOH A;  2YXT A;  3ZS7 A;  1UB0 A;  2AFB A;  1WYE A;  3LOO A;  1UA4 A;  3OTX A;  3GBU A;  3RSS A;  2XTB A;  2V78 A;  3NL3 A;  2AB8 A;  2I6B A;  3RQX A;  3IBQ A;  3B1Q A;  1U2X A;  1LIJ A;  3B1P A;  3FHY A;  3KD6 A;  1TZ6 A;  2DDW A;  2Q5R A;  4K93 A;  5COJ A;  3UQ9 A;  4B8S A;  1LIK A;  2DDM A;  2C49 A;  3RT9 A;  1EKK A;  2PKK A;  2JG5 A;  4JKU A;  4KAD A;  3W4S A;  3NM3 A;  3RRJ A;  1RKD A;  1V1S A;  4DC3 A;  5F11 A;  2C4E A;  3KEU A;  1KYH A;  3UQD A;  1GC5 A;  1V19 A;  2AJR A;  3LJS A;  5BYE A;  3RY7 A;  2QCV A;  1GQT A;  3UBO A;  4LC4 A;  3HYO A;  1V1A A;  3IN1 A;  4K8P A;  4S1I A;  3VAS A;  1LHR A;  3IE7 A;  2R3E A;  3RU3 A;  1JXH A;  3RQ8 A;  1RFV A;  1EKQ A;  5EY7 A;  1TD2 A;  1LHP A;  3BF5 A;  4O1L A;  5BYF A;  5C41 A;  2AX3 A;  4EBU A;  1YGJ A;  3IKH A;  3VAQ A;  3HIC A;  3RT7 A;  1RK2 A;  5B6A A;  3KZH A;  5C3Y A;  3PL2 A;  2HQQ A;  3RQH A;  3RQ6 A;  3RQQ A;  2AJP A;  5TQI A;  2F7K A;  3I3Y A;  3NBV A;  4YL5 A;  4C5L A;  4E3A A;  4JKS A;  4EN4 A;  5F0Z A;  1RFT A;  2PKF A;  3UMO A;  3DZV A;  4K9C A;  4PVV A;  4XDA A;  3KTN A;  3LHX A;  3Q92 A;  4S1M A;  3B1O A;  3IQ0 A;  3JUL A;  3LKI A;  4K9I A;  4N09 A;  4XF7 A;  3RTA A;  5EYN A;  4GM6 A;  3UQ6 A;  1LIO A;  3DRW A;  2FV7 A;  3RSG A;  3GO7 A;  3B1R A;  4C5J A;  3GO6 A;  3K9E A;  3RRE A;  1TYY A;  5BYC A;  5C40 A;  4WJM A;  3RU2 A;  4K8C A;  4KAH A;  4O1G A;  3NBW A;  1RKS A;  3RS9 A;  2RBC A;  3B1N A;  2JG1 A;  1BX4 A;  3RSQ A;  3RTC A;  4E8W A;  3NL2 A;  4XCK A;  2PKN A;  3NCA A;  2A9Z A;  2HW1 A;  1RFU A;  4LCA A;  2I5B A;  4E8Y A;  4K8K A;  3RSF A;  5CM5 A;  1JXI A;  2ABS A;  1ESJ A;  4LBG A;  3UQE A;  4YWR A;  3RQ2 A;  4C5K A;  3MBH A;  3QA2 A;  1TZ3 A;  3NC9 A;  3UMP A;  4JJP A;  3NC2 A;  4X8F A;  3RRF A;  3RO4 A;  3BGK A;  2DCN A;  4C5N A;  4EUM A;  2F02 A;  3MBJ A;  2R3B A;  2I6A A;  2AA0 A;  1LII A;  1RKA A;  4XF6 A;  3NM1 A;  1DGM A;  3RTB A;  3Q1Y A; 
#chains in the Genus database with same CATH topology
 1VM7 A;  4KAL A;  3H49 A;  4K8T A;  3RQ5 A;  4C12 A;  4U7X A;  4KAN A;  2AM2 A;  5C3Z A;  1UAG A;  3QAI A;  4BUC A;  4E8Z A;  2Y1O A;  2VAR A;  2QHP A;  4CVM A;  3IH0 A;  4C13 A;  3RPH A;  2GCB A;  1ESQ A;  1VI9 A;  2HLZ A;  2VTD A;  4B8R A;  1O5Z A;  3HN7 A;  4ZIY A;  2GC5 A;  5A5F A;  3NL5 A;  4UBE A;  3RM5 A;  3EWM A;  3RPZ A;  4DU5 A;  3NL6 A;  2A9Y A;  3HPD A;  4N08 A;  5CGE A;  3K5W A;  2PKM A;  1VK4 A;  3RTD A;  4E3A A;  3N1C A;  2XPC A;  1V1B A;  3RTG A;  2YXU A;  2UUO A;  2JGV A;  3CQD A;  2ABQ A;  3H74 A;  3ZM5 A;  3B3L A;  2GC6 A;  4QF5 A;  4LBX A;  3RTE A;  4S1H A;  5BYD A;  4KBE A;  1YHJ A;  3EAG A;  4E69 A;  3FHX A;  4E84 A;  3N2A A;  3ZL8 A;  4S1I B;  1YGK A;  2DDO A;  3PZS A;  4CVK A;  2AWD A;  3RRB A;  1L2L A;  4C5M A;  1C3Q A;  5TRW A;  5CGA A;  1W78 A;  2NWH A;  3RS8 A;  4EOH A;  2YXT A;  3ZS7 A;  1UB0 A;  2AFB A;  1WYE A;  3LOO A;  1UA4 A;  3OTX A;  3GBU A;  3RSS A;  2XTB A;  2V78 A;  3NL3 A;  2AB8 A;  2I6B A;  2UAG A;  4QDI A;  3RQX A;  3IBQ A;  3B1Q A;  1U2X A;  1LIJ A;  3B1P A;  3FHY A;  3KD6 A;  1TZ6 A;  2DDW A;  2Q5R A;  2UUP A;  4K93 A;  5COJ A;  3UQ9 A;  4B8S A;  4UAG A;  1E8C A;  1LIK A;  2DDM A;  2C49 A;  3RT9 A;  1EKK A;  2PKK A;  2JG5 A;  4JKU A;  4KAD A;  1GG4 A;  3NM3 A;  3RRJ A;  1RKD A;  1V1S A;  3W4S A;  4DC3 A;  5F11 A;  2C4E A;  3KEU A;  1KYH A;  3UQD A;  1GC5 A;  1V19 A;  2AJR A;  3LJS A;  3PYZ A;  5BYE A;  3RY7 A;  2QCV A;  1GQT A;  3UBO A;  4LC4 A;  3HYO A;  1V1A A;  3IN1 A;  4K8P A;  4S1I A;  3VAS A;  1LHR A;  3IE7 A;  2R3E A;  3RU3 A;  1JXH A;  3UAG A;  3RQ8 A;  1RFV A;  1EKQ A;  5EY7 A;  1TD2 A;  1LHP A;  3BF5 A;  4O1L A;  5BYF A;  5C41 A;  4CVL A;  2AX3 A;  4EBU A;  1YGJ A;  3IKH A;  3VAQ A;  3HIC A;  3RT7 A;  1RK2 A;  5B6A A;  3KZH A;  4BUB A;  3PL2 A;  5C3Y A;  1GQY A;  2HQQ A;  3RQH A;  3RQ6 A;  3RQQ A;  2AJP A;  5TQI A;  2F7K A;  3I3Y A;  3NBV A;  4YL5 A;  4C5L A;  3QCZ A;  4JKS A;  4EN4 A;  5F0Z A;  3NRS A;  1RFT A;  2VTE A;  1E0D A;  2PKF A;  3UMO A;  1J6U A;  3DZV A;  4K9C A;  4PVV A;  4XDA A;  1W7K A;  5A5E A;  2VOS A;  3KTN A;  3LHX A;  2WTZ A;  3Q92 A;  2JFH A;  3B1O A;  4S1M A;  2Y67 A;  3IQ0 A;  3JUL A;  3LKI A;  4K9I A;  1GQQ A;  1P31 A;  1JBV A;  4GM6 A;  4N09 A;  4XF7 A;  1LIO A;  3DRW A;  2FV7 A;  5EYN A;  3RSG A;  3GO7 A;  3B1R A;  3UQ6 A;  4C5J A;  2GCA A;  3GO6 A;  3K9E A;  3RRE A;  1TYY A;  5BYC A;  5C40 A;  4WJM A;  3RU2 A;  4K8C A;  4KAH A;  4O1G A;  3NBW A;  1RKS A;  1JBW A;  3RS9 A;  2RBC A;  3B1N A;  2JG1 A;  1BX4 A;  3RSQ A;  3RTC A;  4E8W A;  3NL2 A;  4XCK A;  2PKN A;  1P3D A;  3NCA A;  2A9Z A;  2HW1 A;  1FGS A;  1RFU A;  2WJP A;  4LCA A;  2I5B A;  4E8Y A;  4K8K A;  4HV4 A;  2Y68 A;  2VOR A;  3RSF A;  5CM5 A;  1JXI A;  2ABS A;  1ESJ A;  2Y66 A;  4LBG A;  4YWR A;  3UQE A;  3RQ2 A;  3RTA A;  3MBH A;  3QA2 A;  4C5K A;  1TZ3 A;  2JFG A;  3HJ6 A;  3NC9 A;  3UMP A;  4JJP A;  3NC2 A;  4X8F A;  2F00 A;  2X5O A;  3RO4 A;  3RRF A;  3BGK A;  2DCN A;  4C5N A;  4EUM A;  2F02 A;  3LK7 A;  3MBJ A;  1EEH A;  3ZM6 A;  2I6A A;  2AA0 A;  2JFF A;  1LII A;  1RKA A;  2AM1 A;  2R3B A;  2XJA A;  4XF6 A;  3NM1 A;  1DGM A;  3RTB A;  3Q1Y A; 
#chains in the Genus database with same CATH homology
 1VM7 A;  4KAL A;  3H49 A;  4K8T A;  3RQ5 A;  4U7X A;  4KAN A;  5C3Z A;  4E8Z A;  3QAI A;  2VAR A;  2QHP A;  3IH0 A;  3RPH A;  1ESQ A;  1VI9 A;  2HLZ A;  4B8R A;  3NL5 A;  4UBE A;  3RM5 A;  3EWM A;  3RPZ A;  4DU5 A;  3NL6 A;  2A9Y A;  3HPD A;  4N08 A;  5CGE A;  3K5W A;  2PKM A;  1VK4 A;  3RTD A;  3N1C A;  3RTG A;  1V1B A;  2YXU A;  2JGV A;  3CQD A;  2ABQ A;  3H74 A;  3B3L A;  4LBX A;  3RTE A;  4S1H A;  5BYD A;  4KBE A;  1YHJ A;  4E69 A;  3FHX A;  4E84 A;  4S1I B;  1YGK A;  2DDO A;  3PZS A;  2AWD A;  3RRB A;  1L2L A;  4C5M A;  1C3Q A;  5TRW A;  5CGA A;  2NWH A;  3RS8 A;  4EOH A;  2YXT A;  3ZS7 A;  1UB0 A;  2AFB A;  1WYE A;  3LOO A;  1UA4 A;  3OTX A;  3GBU A;  3RSS A;  2XTB A;  2V78 A;  3NL3 A;  2AB8 A;  2I6B A;  3RQX A;  3IBQ A;  3B1Q A;  1U2X A;  1LIJ A;  3B1P A;  3FHY A;  3KD6 A;  1TZ6 A;  2DDW A;  2Q5R A;  4K93 A;  5COJ A;  3UQ9 A;  4B8S A;  1LIK A;  2DDM A;  2C49 A;  3RT9 A;  1EKK A;  2PKK A;  2JG5 A;  4JKU A;  4KAD A;  3W4S A;  3NM3 A;  3RRJ A;  1RKD A;  1V1S A;  4DC3 A;  5F11 A;  2C4E A;  3KEU A;  1KYH A;  3UQD A;  1GC5 A;  1V19 A;  2AJR A;  3LJS A;  5BYE A;  3RY7 A;  2QCV A;  1GQT A;  3UBO A;  4LC4 A;  3HYO A;  1V1A A;  3IN1 A;  4K8P A;  4S1I A;  3VAS A;  1LHR A;  3IE7 A;  2R3E A;  3RU3 A;  1JXH A;  3RQ8 A;  1RFV A;  1EKQ A;  5EY7 A;  1TD2 A;  1LHP A;  3BF5 A;  4O1L A;  5BYF A;  5C41 A;  2AX3 A;  4EBU A;  1YGJ A;  3IKH A;  3VAQ A;  3HIC A;  3RT7 A;  1RK2 A;  5B6A A;  3KZH A;  5C3Y A;  3PL2 A;  2HQQ A;  3RQH A;  3RQ6 A;  3RQQ A;  2AJP A;  5TQI A;  2F7K A;  3I3Y A;  3NBV A;  4YL5 A;  4C5L A;  4E3A A;  4JKS A;  4EN4 A;  5F0Z A;  1RFT A;  2PKF A;  3UMO A;  3DZV A;  4K9C A;  4PVV A;  4XDA A;  3KTN A;  3LHX A;  3Q92 A;  4S1M A;  3B1O A;  3IQ0 A;  3JUL A;  3LKI A;  4K9I A;  4N09 A;  4XF7 A;  3RTA A;  5EYN A;  4GM6 A;  3UQ6 A;  1LIO A;  3DRW A;  2FV7 A;  3RSG A;  3GO7 A;  3B1R A;  4C5J A;  3GO6 A;  3K9E A;  3RRE A;  1TYY A;  5BYC A;  5C40 A;  4WJM A;  3RU2 A;  4K8C A;  4KAH A;  4O1G A;  3NBW A;  1RKS A;  3RS9 A;  2RBC A;  3B1N A;  2JG1 A;  1BX4 A;  3RSQ A;  3RTC A;  4E8W A;  3NL2 A;  4XCK A;  2PKN A;  3NCA A;  2A9Z A;  2HW1 A;  1RFU A;  4LCA A;  2I5B A;  4E8Y A;  4K8K A;  3RSF A;  5CM5 A;  1JXI A;  2ABS A;  1ESJ A;  4LBG A;  3UQE A;  4YWR A;  3RQ2 A;  4C5K A;  3MBH A;  3QA2 A;  1TZ3 A;  3HJ6 A;  3NC9 A;  3UMP A;  4JJP A;  3NC2 A;  4X8F A;  3RRF A;  3RO4 A;  3BGK A;  2DCN A;  4C5N A;  4EUM A;  2F02 A;  3MBJ A;  2R3B A;  2I6A A;  2AA0 A;  1LII A;  1RKA A;  4XF6 A;  3NM1 A;  1DGM A;  3RTB A;  3Q1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...