2QCVA

Crystal structure of a putative 5-dehydro-2-deoxygluconokinase (iolc) from bacillus halodurans c-125 at 1.90 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
330
structure length
325
Chain Sequence
TYELSTDREFDLIAIGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIVIGSSKLGLKAGFIGKIADDQHGRFIESYMRGVGVDTSNLVVDQEGHKTGLAFTEIKSPEECSILMYRQDVADLYLSPEEVNEAYIRRSKLLLVSGTALSKSPSREAVLKAIRLAKRNDVKVVFELDYRPYSWETPEETAVYYSLVAEQSDIVIGTREEFDVLENRTEKGDNDETIRYLFKHSPELIVIKHGVEGSFAYTKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYALISGKGIETALKYGSASASIVVSKAMPSVEEIEALIEKDETITIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 5-dehydro-2-deoxygluconokinase (NP_243185.1) from Bacillus halodurans at 1.90 A resolution
rcsb
source organism Bacillus halodurans c-125
molecule tags Transferase
molecule keywords Putative 5-dehydro-2-deoxygluconokinase
total genus 119
structure length 325
sequence length 330
ec nomenclature ec 2.7.1.92: 5-dehydro-2-deoxygluconokinase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.150.10 Mainly Beta Single Sheet putative 5-dehydro-2- deoxygluconokinase like fold putative 5-dehydro-2- deoxygluconokinase 2qcvA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2qcvA01
3RQ8A 5C3ZA 2VARA 2YXUA 3RSSA 4PVVA 5C3YA 3BGKA 2AJRA 5F0ZA 1TZ3A 1LHPA 4K9IA 3QA2A 3KD6A 1RKAA 5TRWA 3RQHA 3RU3A 1C3QA 3BF5A 3B1OA 3B3LA 3RO4A 3NM3A 2A9ZA 1JXIA 3QAIA 3B1PA 4KANA 3W4SA 2HLZA 3LHXA 4K9CA 5EY7A 4C5KA 3ZS7A 1RFTA 3NCAA 3Q1YA 3RTEA 3DRWA 1V19A 1VM7A 3H49A 3LOOA 3IH0A 1TZ6A 3PZSA 3KZHA 3IN1A 4C5NA 2RBCA 4LCAA 1LHRA 1VK4A 3CQDA 3H74A 4XDAA 1BX4A 5CM5A 2YXTA 4KALA 5EYNA 2PKKA 2AFBA 3VASA 3I3YA 2PKNA 2XTBA 3IKHA 4JJPA 4E8ZA 3RY7A 5C40A 1TD2A 1L2LA 3VAQA 2AB8A 4LBXA 4E84A 4E69A 2QHPA 4UBEA 3UQEA 3RQXA 2DCNA 1YHJA 1TYYA 3GO6A 4K8TA 1EKQA 1ESJA 2PKMA 4S1IA 2JGVA 4JKUA 4K93A 3RRFA 2DDMA 3EWMA 3RSGA 2NWHA 3RRBA 4KADA 2C4EA 3UMOA 3GBUA 3HYOA 1LIOA 1LIIA 3NM1A 3UQDA 2AWDA 2Q5RA 3HICA 1RKSA 2AJPA 4S1MA 1V1AA 1GC5A 1RK2A 3RPZA 5COJA 2R3EA 2DDOA 4YWRA 1V1BA 2AX3A 3K9EA 4K8KA 2FV7A 1RFUA 1U2XA 2A9YA 3NL6A 3PL2A 4DU5A 2JG1A 4DC3A 4E8YA 3UQ6A 3NL2A 5CGAA 1YGKA 4S1HA 4E3AA 5C41A 1RKDA 3UBOA 4S1IB 3RSQA 2QCVA 3RPHA 3RTGA 2V78A 3RTBA 4U7XA 3RQ2A 3UQ9A 4C5LA 2ABSA 3Q92A 5F11A 1UA4A 3KEUA 3RRJA 2I6AA 4GM6A 4YL5A 3RTCA 4C5MA 3NC9A 3NL5A 1GQTA 4EN4A 4XF6A 3GO7A 3RSFA 4B8RA 4C5JA 4LBGA 4KAHA 4O1LA 3RQ5A 3JULA 5BYEA 2DDWA 1LIJA 3K5WA 4XF7A 5BYDA 4XCKA 1UB0A 3RT9A 4JKSA 1VI9A 1WYEA 4N08A 4K8PA 3B1QA 3LKIA 3MBHA 4WJMA 4LC4A 3RM5A 5CGEA 3RT7A 4N09A 3IQ0A 3MBJA 1JXHA 3UMPA 3NBWA 5BYFA 3RS8A 3RU2A 1V1SA 5BYCA 2PKFA 3B1RA 3FHXA 1LIKA 3NL3A 3NBVA 4X8FA 3RREA 3RTAA 3RTDA 4EUMA 3FHYA 5B6AA 2HQQA 2F02A 1YGJA 3NC2A 1DGMA 3DZVA 4O1GA 1RFVA 1EKKA 3IBQA 2JG5A 5TQIA 1KYHA 3LJSA 3RS9A 3N1CA 1ESQA 3OTXA 3RQQA 3KTNA 4B8SA 3HPDA 4EBUA 4E8WA 3IE7A 2I6BA 2C49A 2I5BA 2HW1A 4KBEA 4K8CA 4EOHA 2ABQA 3B1NA 2AA0A 2R3BA 2F7KA 3RQ6A
chains in the Genus database with same CATH superfamily
3QA2A 1C3QA 2JFGA 3NCAA 3RTEA 3DRWA 1VM7A 3LOOA 3IH0A 1TZ6A 3KZHA 3IN1A 4LCAA 1W78A 4XDAA 2Y1OA 2XTBA 1K28D 4K8TA 4UAGA 1EKQA 2PKMA 2GCBA 3EWMA 2VTEA 3UQDA 1RKSA 4C12A 4BUCA 1RK2A 5COJA 2AX3A 2FV7A 2Y67A 3NL2A 5C41A 4S1IB 2JFFA 2XPCA 4ZIYA 3LK7A 1UA4A 3KEUA 3NC9A 4LBGA 1WYEA 5CGEA 3NRSA 3EAGA 3QCZA 2PKFA 3FHXA 3FHYA 5B6AA 2F02A 1DGMA 3IBQA 3LJSA 1W7KA 3OTXA 3KTNA 4E8WA 3IE7A 2C49A 2JFHA 2AA0A 1V1SA 3N2AA 2F7KA 2VARA 4PVVA 3BGKA 2UAGA 1TZ3A 1LHPA 1RKAA 3RU3A 5A5FA 3B1OA 3B3LA 1P31A 4C5KA 3LHXA 1RFTA 3Q1YA 2AM1A 1VK4A 1E8CA 1BX4A 5EYNA 3ZL8A 1EEHA 2PKKA 2AFBA 2GCAA 1GQYA 3IKHA 4JJPA 4E69A 4UBEA 1UAGA 1TYYA 3ZM6A 2JGVA 3RRFA 4KADA 1LIOA 1LIIA 3NM1A 2Y66A 1GC5A 4CVLA 1WTHD 3K9EA 1U2XA 3NL6A 4DU5A 3PL2A 2XJAA 1YGKA 4S1HA 1RKDA 2WJPA 3RTBA 3RQ2A 4BUBA 2GC6A 4GM6A 4YL5A 4EN4A 3GO7A 4C5JA 3RQ5A 2DDWA 4XCKA 3RT9A 1GQQA 4QDIA 3LKIA 3MBHA 1JXHA 3UMPA 3RS8A 3UAGA 2Y68A 1LIKA 3RREA 2VORA 3RTAA 4EUMA 2HQQA 1YGJA 3NC2A 5TQIA 3N1CA 3RQQA 3HPDA 2AM2A 2HW1A 4K8CA 4EOHA 1GG4A 2ABQA 3B1NA 5C3ZA 2YXUA 5C3YA 2AJRA 5F0ZA 3RQHA 3NM3A 1JXIA 3B1PA 4KANA 3W4SA 4QF5A 3PZSA 2RBCA 1LHRA 3CQDA 3H74A 4HV4A 2YXTA 3I3YA 2PKNA 4E8ZA 5C40A 3RY7A 1TD2A 2AB8A 1YHJA 1ESJA 4JKUA 4K93A 2DDMA 3RSGA 2C4EA 1J6UA 2F00A 3GBUA 3HYOA 2AWDA 2Q5RA 3HICA 4S1MA 2R3EA 2DDOA 4YWRA 4K8KA 4CVMA 2JG1A 3UQ6A 3HN7A 3UBOA 2ABSA 5F11A 3RRJA 2I6AA 3RTCA 4C5MA 3NL5A 1E0DA 4XF6A 4B8RA 4O1LA 2GC5A 3JULA 1LIJA 3K5WA 1VI9A 3PYZA 3ZM5A 4WJMA 3RM5A 4LC4A 3MBJA 1JBWA 5BYCA 3NL3A 4X8FA 3RTDA 2VTDA 4O1GA 1EKKA 2JG5A 1KYHA 4B8SA 4EBUA 2I6BA 4KBEA 2R3BA 3RQ8A 3RSSA 4K9IA 3KD6A 5TRWA 1JBVA 3BF5A 3RO4A 2WTZA 2A9ZA 3QAIA 2HLZA 4K9CA 5EY7A 3ZS7A 1V19A 3H49A 4C5NA 5CM5A 2Z6BD 4KALA 3VASA 2X5OA 3VAQA 1L2LA 4LBXA 4E84A 2QHPA 3UQEA 2UUOA 3RQXA 2DCNA 5A5EA 3GO6A 4CVKA 4S1IA 2NWHA 3RRBA 3UMOA 2AJPA 3RPZA 1V1AA 1V1BA 1RFUA 2A9YA 4DC3A 4E8YA 5CGAA 4E3AA 1P3DA 1FGSA 3RSQA 1O5ZA 2QCVA 3RPHA 2UUPA 2V78A 3RTGA 4U7XA 3UQ9A 4C5LA 3Q92A 2VOSA 1GQTA 3RSFA 4KAHA 5BYEA 3HJ6A 4XF7A 5BYDA 1UB0A 4JKSA 4N08A 4K8PA 3B1QA 3RT7A 4N09A 3IQ0A 4C13A 3NBWA 5BYFA 3RU2A 3B1RA 3NBVA 3DZVA 1RFVA 3RS9A 1ESQA 2I5BA 3RQ6A
chains in the Genus database with same CATH topology
3RQ8A 5C3ZA 2VARA 2YXUA 3RSSA 4PVVA 5C3YA 3BGKA 2AJRA 5F0ZA 1TZ3A 1LHPA 4K9IA 3QA2A 3KD6A 1RKAA 5TRWA 3RQHA 3RU3A 1C3QA 3BF5A 3B1OA 3B3LA 3RO4A 3NM3A 2A9ZA 1JXIA 3QAIA 3B1PA 4KANA 3W4SA 2HLZA 3LHXA 4K9CA 5EY7A 4C5KA 3ZS7A 1RFTA 3NCAA 3Q1YA 3RTEA 3DRWA 1V19A 1VM7A 3H49A 3LOOA 3IH0A 1TZ6A 3PZSA 3KZHA 3IN1A 4C5NA 2RBCA 4LCAA 1LHRA 1VK4A 3CQDA 3H74A 4XDAA 1BX4A 5CM5A 2YXTA 4KALA 5EYNA 2PKKA 2AFBA 3VASA 3I3YA 2PKNA 2XTBA 3IKHA 4JJPA 4E8ZA 3RY7A 5C40A 1TD2A 1L2LA 3VAQA 2AB8A 4LBXA 4E84A 4E69A 2QHPA 4UBEA 3UQEA 3RQXA 2DCNA 1YHJA 1TYYA 3GO6A 4K8TA 1EKQA 1ESJA 2PKMA 4S1IA 2JGVA 4JKUA 4K93A 3RRFA 2DDMA 3EWMA 3RSGA 2NWHA 3RRBA 4KADA 2C4EA 3UMOA 3GBUA 3HYOA 1LIOA 1LIIA 3NM1A 3UQDA 2AWDA 2Q5RA 3HICA 1RKSA 2AJPA 4S1MA 1V1AA 1GC5A 1RK2A 3RPZA 5COJA 2R3EA 2DDOA 4YWRA 1V1BA 2AX3A 3K9EA 4K8KA 2FV7A 1RFUA 1U2XA 2A9YA 3NL6A 3PL2A 4DU5A 2JG1A 4DC3A 4E8YA 3UQ6A 3NL2A 5CGAA 1YGKA 4S1HA 4E3AA 5C41A 1RKDA 3UBOA 4S1IB 3RSQA 2QCVA 3RPHA 3RTGA 2V78A 3RTBA 4U7XA 3RQ2A 3UQ9A 4C5LA 2ABSA 3Q92A 5F11A 1UA4A 3KEUA 3RRJA 2I6AA 4GM6A 4YL5A 3RTCA 4C5MA 3NC9A 3NL5A 1GQTA 4EN4A 4XF6A 3GO7A 3RSFA 4B8RA 4C5JA 4LBGA 4KAHA 4O1LA 3RQ5A 3JULA 5BYEA 2DDWA 1LIJA 3HJ6A 3K5WA 4XF7A 4XCKA 1UB0A 3RT9A 5BYDA 4JKSA 1VI9A 1WYEA 4N08A 4K8PA 3B1QA 3LKIA 3MBHA 4WJMA 4LC4A 3RM5A 5CGEA 3RT7A 4N09A 3IQ0A 3MBJA 1JXHA 3UMPA 3NBWA 5BYFA 3RS8A 3RU2A 1V1SA 5BYCA 2PKFA 3B1RA 3FHXA 1LIKA 3NL3A 3NBVA 4X8FA 3RREA 3RTAA 3RTDA 4EUMA 3FHYA 5B6AA 2HQQA 2F02A 1YGJA 3NC2A 1DGMA 3DZVA 4O1GA 1RFVA 1EKKA 3IBQA 2JG5A 5TQIA 1KYHA 3LJSA 3RS9A 3N1CA 1ESQA 3OTXA 3RQQA 3KTNA 4B8SA 3HPDA 4EBUA 4E8WA 3IE7A 2I6BA 2C49A 2I5BA 2HW1A 4KBEA 4K8CA 4EOHA 2ABQA 3B1NA 2AA0A 2R3BA 2F7KA 3RQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQ8 A;  5C3Z A;  2VAR A;  2YXU A;  3RSS A;  4PVV A;  5C3Y A;  3BGK A;  2AJR A;  5F0Z A;  1TZ3 A;  1LHP A;  4K9I A;  3QA2 A;  3KD6 A;  1RKA A;  5TRW A;  3RQH A;  3RU3 A;  1C3Q A;  3BF5 A;  3B1O A;  3B3L A;  3RO4 A;  3NM3 A;  2A9Z A;  1JXI A;  3QAI A;  3B1P A;  4KAN A;  3W4S A;  2HLZ A;  3LHX A;  4K9C A;  5EY7 A;  4C5K A;  3ZS7 A;  1RFT A;  3NCA A;  3Q1Y A;  3RTE A;  3DRW A;  1V19 A;  1VM7 A;  3H49 A;  3LOO A;  3IH0 A;  1TZ6 A;  3PZS A;  3KZH A;  3IN1 A;  4C5N A;  2RBC A;  4LCA A;  1LHR A;  1VK4 A;  3CQD A;  3H74 A;  4XDA A;  1BX4 A;  5CM5 A;  2YXT A;  4KAL A;  5EYN A;  2PKK A;  2AFB A;  3VAS A;  3I3Y A;  2PKN A;  2XTB A;  3IKH A;  4JJP A;  4E8Z A;  3RY7 A;  5C40 A;  1TD2 A;  1L2L A;  3VAQ A;  2AB8 A;  4LBX A;  4E84 A;  4E69 A;  2QHP A;  4UBE A;  3UQE A;  3RQX A;  2DCN A;  1YHJ A;  1TYY A;  3GO6 A;  4K8T A;  1EKQ A;  1ESJ A;  2PKM A;  4S1I A;  2JGV A;  4JKU A;  4K93 A;  3RRF A;  2DDM A;  3EWM A;  3RSG A;  2NWH A;  3RRB A;  4KAD A;  2C4E A;  3UMO A;  3GBU A;  3HYO A;  1LIO A;  1LII A;  3NM1 A;  3UQD A;  2AWD A;  2Q5R A;  3HIC A;  1RKS A;  2AJP A;  4S1M A;  1V1A A;  1GC5 A;  1RK2 A;  3RPZ A;  5COJ A;  2R3E A;  2DDO A;  4YWR A;  1V1B A;  2AX3 A;  3K9E A;  4K8K A;  2FV7 A;  1RFU A;  1U2X A;  2A9Y A;  3NL6 A;  3PL2 A;  4DU5 A;  2JG1 A;  4DC3 A;  4E8Y A;  3UQ6 A;  3NL2 A;  5CGA A;  1YGK A;  4S1H A;  4E3A A;  5C41 A;  1RKD A;  3UBO A;  4S1I B;  3RSQ A;  2QCV A;  3RPH A;  3RTG A;  2V78 A;  3RTB A;  4U7X A;  3RQ2 A;  3UQ9 A;  4C5L A;  2ABS A;  3Q92 A;  5F11 A;  1UA4 A;  3KEU A;  3RRJ A;  2I6A A;  4GM6 A;  4YL5 A;  3RTC A;  4C5M A;  3NC9 A;  3NL5 A;  1GQT A;  4EN4 A;  4XF6 A;  3GO7 A;  3RSF A;  4B8R A;  4C5J A;  4LBG A;  4KAH A;  4O1L A;  3RQ5 A;  3JUL A;  5BYE A;  2DDW A;  1LIJ A;  3K5W A;  4XF7 A;  5BYD A;  4XCK A;  1UB0 A;  3RT9 A;  4JKS A;  1VI9 A;  1WYE A;  4N08 A;  4K8P A;  3B1Q A;  3LKI A;  3MBH A;  4WJM A;  4LC4 A;  3RM5 A;  5CGE A;  3RT7 A;  4N09 A;  3IQ0 A;  3MBJ A;  1JXH A;  3UMP A;  3NBW A;  5BYF A;  3RS8 A;  3RU2 A;  1V1S A;  5BYC A;  2PKF A;  3B1R A;  3FHX A;  1LIK A;  3NL3 A;  3NBV A;  4X8F A;  3RRE A;  3RTA A;  3RTD A;  4EUM A;  3FHY A;  5B6A A;  2HQQ A;  2F02 A;  1YGJ A;  3NC2 A;  1DGM A;  3DZV A;  4O1G A;  1RFV A;  1EKK A;  3IBQ A;  2JG5 A;  5TQI A;  1KYH A;  3LJS A;  3RS9 A;  3N1C A;  1ESQ A;  3OTX A;  3RQQ A;  3KTN A;  4B8S A;  3HPD A;  4EBU A;  4E8W A;  3IE7 A;  2I6B A;  2C49 A;  2I5B A;  2HW1 A;  4KBE A;  4K8C A;  4EOH A;  2ABQ A;  3B1N A;  2AA0 A;  2R3B A;  2F7K A;  3RQ6 A; 
#chains in the Genus database with same CATH topology
 3QA2 A;  1C3Q A;  2JFG A;  3NCA A;  3RTE A;  3DRW A;  1VM7 A;  3LOO A;  3IH0 A;  1TZ6 A;  3KZH A;  3IN1 A;  4LCA A;  1W78 A;  4XDA A;  2Y1O A;  2XTB A;  1K28 D;  4K8T A;  4UAG A;  1EKQ A;  2PKM A;  2GCB A;  3EWM A;  2VTE A;  3UQD A;  1RKS A;  4C12 A;  4BUC A;  1RK2 A;  5COJ A;  2AX3 A;  2FV7 A;  2Y67 A;  3NL2 A;  5C41 A;  4S1I B;  2JFF A;  2XPC A;  4ZIY A;  3LK7 A;  1UA4 A;  3KEU A;  3NC9 A;  4LBG A;  1WYE A;  5CGE A;  3NRS A;  3EAG A;  3QCZ A;  2PKF A;  3FHX A;  3FHY A;  5B6A A;  2F02 A;  1DGM A;  3IBQ A;  3LJS A;  1W7K A;  3OTX A;  3KTN A;  4E8W A;  3IE7 A;  2C49 A;  2JFH A;  2AA0 A;  1V1S A;  3N2A A;  2F7K A;  2VAR A;  4PVV A;  3BGK A;  2UAG A;  1TZ3 A;  1LHP A;  1RKA A;  3RU3 A;  5A5F A;  3B1O A;  3B3L A;  1P31 A;  4C5K A;  3LHX A;  1RFT A;  3Q1Y A;  2AM1 A;  1VK4 A;  1E8C A;  1BX4 A;  5EYN A;  3ZL8 A;  1EEH A;  2PKK A;  2AFB A;  2GCA A;  1GQY A;  3IKH A;  4JJP A;  4E69 A;  4UBE A;  1UAG A;  1TYY A;  3ZM6 A;  2JGV A;  3RRF A;  4KAD A;  1LIO A;  1LII A;  3NM1 A;  2Y66 A;  1GC5 A;  4CVL A;  1WTH D;  3K9E A;  1U2X A;  3NL6 A;  4DU5 A;  3PL2 A;  2XJA A;  1YGK A;  4S1H A;  1RKD A;  2WJP A;  3RTB A;  3RQ2 A;  4BUB A;  2GC6 A;  4GM6 A;  4YL5 A;  4EN4 A;  3GO7 A;  4C5J A;  3RQ5 A;  2DDW A;  4XCK A;  3RT9 A;  1GQQ A;  4QDI A;  3LKI A;  3MBH A;  1JXH A;  3UMP A;  3RS8 A;  3UAG A;  2Y68 A;  1LIK A;  3RRE A;  2VOR A;  3RTA A;  4EUM A;  2HQQ A;  1YGJ A;  3NC2 A;  5TQI A;  3N1C A;  3RQQ A;  3HPD A;  2AM2 A;  2HW1 A;  4K8C A;  4EOH A;  1GG4 A;  2ABQ A;  3B1N A;  5C3Z A;  2YXU A;  5C3Y A;  2AJR A;  5F0Z A;  3RQH A;  3NM3 A;  1JXI A;  3B1P A;  4KAN A;  3W4S A;  4QF5 A;  3PZS A;  2RBC A;  1LHR A;  3CQD A;  3H74 A;  4HV4 A;  2YXT A;  3I3Y A;  2PKN A;  4E8Z A;  5C40 A;  3RY7 A;  1TD2 A;  2AB8 A;  1YHJ A;  1ESJ A;  4JKU A;  4K93 A;  2DDM A;  3RSG A;  2C4E A;  1J6U A;  2F00 A;  3GBU A;  3HYO A;  2AWD A;  2Q5R A;  3HIC A;  4S1M A;  2R3E A;  2DDO A;  4YWR A;  4K8K A;  4CVM A;  2JG1 A;  3UQ6 A;  3HN7 A;  3UBO A;  2ABS A;  5F11 A;  3RRJ A;  2I6A A;  3RTC A;  4C5M A;  3NL5 A;  1E0D A;  4XF6 A;  4B8R A;  4O1L A;  2GC5 A;  3JUL A;  1LIJ A;  3K5W A;  1VI9 A;  3PYZ A;  3ZM5 A;  4WJM A;  3RM5 A;  4LC4 A;  3MBJ A;  1JBW A;  5BYC A;  3NL3 A;  4X8F A;  3RTD A;  2VTD A;  4O1G A;  1EKK A;  2JG5 A;  1KYH A;  4B8S A;  4EBU A;  2I6B A;  4KBE A;  2R3B A;  3RQ8 A;  3RSS A;  4K9I A;  3KD6 A;  5TRW A;  1JBV A;  3BF5 A;  3RO4 A;  2WTZ A;  2A9Z A;  3QAI A;  2HLZ A;  4K9C A;  5EY7 A;  3ZS7 A;  1V19 A;  3H49 A;  4C5N A;  5CM5 A;  2Z6B D;  4KAL A;  3VAS A;  2X5O A;  3VAQ A;  1L2L A;  4LBX A;  4E84 A;  2QHP A;  3UQE A;  2UUO A;  3RQX A;  2DCN A;  5A5E A;  3GO6 A;  4CVK A;  4S1I A;  2NWH A;  3RRB A;  3UMO A;  2AJP A;  3RPZ A;  1V1A A;  1V1B A;  1RFU A;  2A9Y A;  4DC3 A;  4E8Y A;  5CGA A;  4E3A A;  1P3D A;  1FGS A;  3RSQ A;  1O5Z A;  2QCV A;  3RPH A;  2UUP A;  2V78 A;  3RTG A;  4U7X A;  3UQ9 A;  4C5L A;  3Q92 A;  2VOS A;  1GQT A;  3RSF A;  4KAH A;  5BYE A;  3HJ6 A;  4XF7 A;  5BYD A;  1UB0 A;  4JKS A;  4N08 A;  4K8P A;  3B1Q A;  3RT7 A;  4N09 A;  3IQ0 A;  4C13 A;  3NBW A;  5BYF A;  3RU2 A;  3B1R A;  3NBV A;  3DZV A;  1RFV A;  3RS9 A;  1ESQ A;  2I5B A;  3RQ6 A; 
#chains in the Genus database with same CATH homology
 3RQ8 A;  5C3Z A;  2VAR A;  2YXU A;  3RSS A;  4PVV A;  5C3Y A;  3BGK A;  2AJR A;  5F0Z A;  1TZ3 A;  1LHP A;  4K9I A;  3QA2 A;  3KD6 A;  1RKA A;  5TRW A;  3RQH A;  3RU3 A;  1C3Q A;  3BF5 A;  3B1O A;  3B3L A;  3RO4 A;  3NM3 A;  2A9Z A;  1JXI A;  3QAI A;  3B1P A;  4KAN A;  3W4S A;  2HLZ A;  3LHX A;  4K9C A;  5EY7 A;  4C5K A;  3ZS7 A;  1RFT A;  3NCA A;  3Q1Y A;  3RTE A;  3DRW A;  1V19 A;  1VM7 A;  3H49 A;  3LOO A;  3IH0 A;  1TZ6 A;  3PZS A;  3KZH A;  3IN1 A;  4C5N A;  2RBC A;  4LCA A;  1LHR A;  1VK4 A;  3CQD A;  3H74 A;  4XDA A;  1BX4 A;  5CM5 A;  2YXT A;  4KAL A;  5EYN A;  2PKK A;  2AFB A;  3VAS A;  3I3Y A;  2PKN A;  2XTB A;  3IKH A;  4JJP A;  4E8Z A;  3RY7 A;  5C40 A;  1TD2 A;  1L2L A;  3VAQ A;  2AB8 A;  4LBX A;  4E84 A;  4E69 A;  2QHP A;  4UBE A;  3UQE A;  3RQX A;  2DCN A;  1YHJ A;  1TYY A;  3GO6 A;  4K8T A;  1EKQ A;  1ESJ A;  2PKM A;  4S1I A;  2JGV A;  4JKU A;  4K93 A;  3RRF A;  2DDM A;  3EWM A;  3RSG A;  2NWH A;  3RRB A;  4KAD A;  2C4E A;  3UMO A;  3GBU A;  3HYO A;  1LIO A;  1LII A;  3NM1 A;  3UQD A;  2AWD A;  2Q5R A;  3HIC A;  1RKS A;  2AJP A;  4S1M A;  1V1A A;  1GC5 A;  1RK2 A;  3RPZ A;  5COJ A;  2R3E A;  2DDO A;  4YWR A;  1V1B A;  2AX3 A;  3K9E A;  4K8K A;  2FV7 A;  1RFU A;  1U2X A;  2A9Y A;  3NL6 A;  3PL2 A;  4DU5 A;  2JG1 A;  4DC3 A;  4E8Y A;  3UQ6 A;  3NL2 A;  5CGA A;  1YGK A;  4S1H A;  4E3A A;  5C41 A;  1RKD A;  3UBO A;  4S1I B;  3RSQ A;  2QCV A;  3RPH A;  3RTG A;  2V78 A;  3RTB A;  4U7X A;  3RQ2 A;  3UQ9 A;  4C5L A;  2ABS A;  3Q92 A;  5F11 A;  1UA4 A;  3KEU A;  3RRJ A;  2I6A A;  4GM6 A;  4YL5 A;  3RTC A;  4C5M A;  3NC9 A;  3NL5 A;  1GQT A;  4EN4 A;  4XF6 A;  3GO7 A;  3RSF A;  4B8R A;  4C5J A;  4LBG A;  4KAH A;  4O1L A;  3RQ5 A;  3JUL A;  5BYE A;  2DDW A;  1LIJ A;  3HJ6 A;  3K5W A;  4XF7 A;  4XCK A;  1UB0 A;  3RT9 A;  5BYD A;  4JKS A;  1VI9 A;  1WYE A;  4N08 A;  4K8P A;  3B1Q A;  3LKI A;  3MBH A;  4WJM A;  4LC4 A;  3RM5 A;  5CGE A;  3RT7 A;  4N09 A;  3IQ0 A;  3MBJ A;  1JXH A;  3UMP A;  3NBW A;  5BYF A;  3RS8 A;  3RU2 A;  1V1S A;  5BYC A;  2PKF A;  3B1R A;  3FHX A;  1LIK A;  3NL3 A;  3NBV A;  4X8F A;  3RRE A;  3RTA A;  3RTD A;  4EUM A;  3FHY A;  5B6A A;  2HQQ A;  2F02 A;  1YGJ A;  3NC2 A;  1DGM A;  3DZV A;  4O1G A;  1RFV A;  1EKK A;  3IBQ A;  2JG5 A;  5TQI A;  1KYH A;  3LJS A;  3RS9 A;  3N1C A;  1ESQ A;  3OTX A;  3RQQ A;  3KTN A;  4B8S A;  3HPD A;  4EBU A;  4E8W A;  3IE7 A;  2I6B A;  2C49 A;  2I5B A;  2HW1 A;  4KBE A;  4K8C A;  4EOH A;  2ABQ A;  3B1N A;  2AA0 A;  2R3B A;  2F7K A;  3RQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...