2QCVA

Crystal structure of a putative 5-dehydro-2-deoxygluconokinase (iolc) from bacillus halodurans c-125 at 1.90 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
330
structure length
325
Chain Sequence
TYELSTDREFDLIAIGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIVIGSSKLGLKAGFIGKIADDQHGRFIESYMRGVGVDTSNLVVDQEGHKTGLAFTEIKSPEECSILMYRQDVADLYLSPEEVNEAYIRRSKLLLVSGTALSKSPSREAVLKAIRLAKRNDVKVVFELDYRPYSWETPEETAVYYSLVAEQSDIVIGTREEFDVLENRTEKGDNDETIRYLFKHSPELIVIKHGVEGSFAYTKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYALISGKGIETALKYGSASASIVVSKAMPSVEEIEALIEKDETITIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 5-dehydro-2-deoxygluconokinase (NP_243185.1) from Bacillus halodurans at 1.90 A resolution
rcsb
source organism Bacillus halodurans c-125
molecule tags Transferase
molecule keywords Putative 5-dehydro-2-deoxygluconokinase
total genus 119
structure length 325
sequence length 330
ec nomenclature ec 2.7.1.92: 5-dehydro-2-deoxygluconokinase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.150.10 Mainly Beta Single Sheet putative 5-dehydro-2- deoxygluconokinase like fold putative 5-dehydro-2- deoxygluconokinase 2qcvA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2qcvA01
1V19A 1TZ6A 3RSGA 2PKFA 2C49A 4K8TA 4K9CA 3VAQA 5BYFA 1LHPA 1TYYA 3K9EA 1JXHA 4JKUA 5TQIA 1JXIA 3IQ0A 5C41A 3RRBA 3RU3A 2JGVA 3PL2A 2FV7A 3GO6A 2I5BA 3KEUA 4K9IA 5TRWA 1RFVA 2V78A 3RTGA 3H74A 4XF7A 5CGAA 3UQ9A 3OTXA 3W4SA 2F02A 4C5LA 3KTNA 1LIKA 3KZHA 3NC9A 3IH0A 3NL6A 2PKNA 3BF5A 4LBXA 4N09A 3EWMA 3B1QA 4XF6A 3UBOA 1ESQA 1GQTA 3RRJA 4DC3A 2A9ZA 3HPDA 4GM6A 3NC2A 3RSFA 2QHPA 3RS9A 4LBGA 2AX3A 1VK4A 2PKMA 2DDMA 1YGKA 4EOHA 1YGJA 4KBEA 3RTCA 1RFTA 3DZVA 3N1CA 3B1RA 4JKSA 3BGKA 3ZS7A 5B6AA 2PKKA 3RQ6A 3LJSA 4KADA 3I3YA 2C4EA 5C3YA 3NM3A 3RM5A 1VM7A 2JG1A 4U7XA 4K8PA 1GC5A 3CQDA 3H49A 3VASA 1ESJA 3Q92A 4B8RA 1LIIA 1WYEA 4WJMA 3KD6A 4E84A 5F11A 2HLZA 1RK2A 3IN1A 3RQXA 2VARA 2QCVA 4KALA 3RO4A 1UB0A 3RTDA 3DRWA 3MBJA 3RSSA 5F0ZA 1RKSA 4EBUA 5BYDA 2DDOA 2DDWA 3QA2A 5BYCA 3JULA 1EKQA 2R3EA 3Q1YA 3RTEA 1RFUA 3UQEA 3RREA 3GBUA 1LIJA 2Q5RA 4O1LA 3RSQA 3UMPA 4S1IB 3RQQA 2AWDA 2YXTA 5C40A 4N08A 1VI9A 1DGMA 3RT7A 1LIOA 3RQHA 4PVVA 3UQ6A 3B1PA 3RU2A 2HW1A 5COJA 3RT9A 2AB8A 2F7KA 1EKKA 3RRFA 4XDAA 1RKAA 1KYHA 1RKDA 3NL5A 3HYOA 4K93A 3RY7A 1BX4A 2HQQA 3RPHA 2NWHA 3NL2A 3NCAA 4DU5A 5C3ZA 1YHJA 1C3QA 5CGEA 3LOOA 5CM5A 3GO7A 3UMOA 4EUMA 3B1NA 1V1SA 2A9YA 2XTBA 2ABQA 3IE7A 1TD2A 3B3LA 3RQ8A 4LCAA 3IBQA 4S1HA 4YL5A 5EYNA 4C5NA 4C5MA 4KANA 3LKIA 1TZ3A 4JJPA 3K5WA 3NM1A 3NBWA 4S1MA 3FHXA 3RPZA 1V1BA 4LC4A 3HICA 3LHXA 4O1GA 4S1IA 3RQ2A 3PZSA 3FHYA 1UA4A 4X8FA 2YXUA 1U2XA 4C5JA 4C5KA 1LHRA 1V1AA 2RBCA 4XCKA 2I6AA 4K8CA 4EN4A 3RQ5A 4E8YA 1L2LA 5EY7A 2R3BA 2AJRA 2ABSA 2DCNA 3RTBA 4E3AA 3RS8A 4KAHA 3B1OA 3QAIA 4E69A 2AJPA 3RTAA 3UQDA 2JG5A 4YWRA 4B8SA 3NBVA 2I6BA 3IKHA 4E8ZA 4K8KA 5BYEA 2AA0A 3NL3A 4UBEA 3MBHA 4E8WA 2AFBA
chains in the Genus database with same CATH superfamily
2AM1A 5A5FA 3RSGA 3VAQA 5BYFA 4CVKA 5TRWA 2VOSA 1P31A 3RTGA 1O5ZA 3W4SA 3KTNA 3KZHA 3NC9A 4HV4A 5C40A 4N09A 3QCZA 2GC6A 2UUPA 2Y1OA 2QHPA 2AX3A 4EOHA 1YGKA 4QF5A 4CVMA 1RFTA 1W7KA 5B6AA 3ZS7A 3BGKA 1UAGA 5C3YA 1GG4A 2JG1A 1GC5A 3VASA 1LIIA 3KD6A 1UB0A 4UAGA 1W78A 4EBUA 2DDWA 3JULA 2R3EA 3UQEA 3RREA 2Q5RA 3RT7A 3NL5A 4K93A 1WTHD 2NWHA 3NL2A 5CGEA 3UAGA 3GO7A 2Y66A 3B1NA 2XTBA 3B3LA 4LCAA 4S1HA 3K5WA 2XJAA 3NM1A 3NRSA 3HICA 2Y68A 3RQ2A 1U2XA 4C5JA 2JFFA 4E8YA 2AJRA 2DCNA 1EEHA 4CVLA 4BUBA 4KAHA 3B1OA 4E69A 2AJPA 2JG5A 2JFHA 3IKHA 2AA0A 1TZ6A 2C49A 4K8TA 4K9CA 1LHPA 1TYYA 3K9EA 3LK7A 5TQIA 3IQ0A 3RRBA 3RU3A 3PL2A 2FV7A 2I5BA 3KEUA 1RFVA 2X5OA 1E0DA 4C5LA 1LIKA 3EWMA 3UBOA 1GQTA 4DC3A 4LBGA 2VTDA 1YGJA 4JKSA 3N1CA 3B1RA 3EAGA 1P3DA 3I3YA 2C4EA 1JBWA 3H49A 4B8RA 4WJMA 4ZIYA 1JBVA 2VORA 3IN1A 4KALA 3ZL8A 3DRWA 3MBJA 3RSSA 3ZM6A 2GC5A 2DDOA 5BYCA 3Q1YA 1EKQA 4O1LA 3RSQA 3RQQA 2AWDA 2YXTA 1VI9A 1LIOA 3UQ6A 2AM2A 3RT9A 3RRFA 1RKDA 2WTZA 3NCAA 5C3ZA 1YHJA 5CM5A 3UMOA 1V1SA 1TD2A 4C5NA 4C5MA 4KANA 3LKIA 3FHXA 1V1BA 4LC4A 3LHXA 2JFGA 2YXUA 4C5KA 2UAGA 2F00A 4K8CA 4EN4A 4E3AA 2VTEA 3RTAA 2GCBA 2I6BA 3NL3A 4UBEA 1V19A 4JKUA 3GO6A 4K9IA 4QDIA 5CGAA 3OTXA 3ZM5A 2F02A 2XPCA 3NL6A 3RTEA 3IH0A 1GQYA 3B1QA 4XF6A 3RRJA 2A9ZA 3NC2A 3RSFA 2DDMA 3RTCA 4KBEA 3HN7A 3LJSA 4KADA 3NM3A 3RM5A 3CQDA 1WYEA 4E84A 5F11A 1RK2A 3RO4A 3RTDA 1RKSA 5BYDA 3GBUA 4S1IB 4N08A 4BUCA 3RQHA 3B1PA 3RU2A 5COJA 2AB8A 1KYHA 2HQQA 3RPHA 4EUMA 3IBQA 1TZ3A 4JJPA 3NBWA 4S1MA 4O1GA 3PYZA 1UA4A 4C13A 1LHRA 2RBCA 2Y67A 3RQ5A 5EY7A 2ABSA 2UUOA 3RS8A 3UQDA 4YWRA 4E8ZA 4B8SA 3NBVA 3MBHA 4E8WA 2AFBA 2PKFA 1JXHA 1JXIA 5C41A 2JGVA 2V78A 3H74A 4XF7A 3UQ9A 1J6UA 4LBXA 3BF5A 2PKNA 4C12A 5A5EA 1ESQA 3HPDA 4GM6A 3RS9A 1VK4A 2PKMA 3DZVA 2PKKA 3RQ6A 1VM7A 4U7XA 4K8PA 1ESJA 3Q92A 2HLZA 3RQXA 2VARA 2QCVA 5F0ZA 3QA2A 1FGSA 1E8CA 1RFUA 3N2AA 1LIJA 3UMPA 1DGMA 1GQQA 4PVVA 2WJPA 3HJ6A 2HW1A 2Z6BD 2F7KA 1EKKA 4XDAA 1RKAA 3HYOA 3RY7A 1BX4A 1K28D 4DU5A 1C3QA 3LOOA 2A9YA 2ABQA 3IE7A 3RQ8A 4YL5A 5EYNA 3RPZA 4S1IA 3PZSA 3FHYA 4X8FA 1V1AA 4XCKA 2I6AA 1L2LA 2R3BA 3RTBA 3QAIA 2GCAA 4K8KA 5BYEA
chains in the Genus database with same CATH topology
1V19A 1TZ6A 3RSGA 2PKFA 2C49A 4K8TA 4K9CA 3VAQA 5BYFA 1LHPA 1TYYA 3K9EA 1JXHA 4JKUA 5TQIA 1JXIA 3IQ0A 5C41A 3RRBA 3RU3A 2JGVA 3PL2A 2FV7A 3GO6A 2I5BA 3KEUA 4K9IA 5TRWA 1RFVA 2V78A 3RTGA 3H74A 4XF7A 5CGAA 3UQ9A 3OTXA 3W4SA 2F02A 4C5LA 3KTNA 1LIKA 3KZHA 3NC9A 3IH0A 3NL6A 2PKNA 3BF5A 4LBXA 4N09A 3EWMA 3B1QA 4XF6A 3UBOA 1ESQA 1GQTA 3RRJA 4DC3A 2A9ZA 3HPDA 4GM6A 3NC2A 3RSFA 2QHPA 3RS9A 4LBGA 2AX3A 1VK4A 2PKMA 2DDMA 1YGKA 4EOHA 1YGJA 4KBEA 3RTCA 1RFTA 3DZVA 3N1CA 3B1RA 4JKSA 3BGKA 3ZS7A 5B6AA 2PKKA 3RQ6A 3LJSA 4KADA 3I3YA 2C4EA 5C3YA 3NM3A 3RM5A 1VM7A 2JG1A 4U7XA 4K8PA 1GC5A 3CQDA 3H49A 3VASA 1ESJA 3Q92A 4B8RA 1LIIA 1WYEA 4WJMA 3KD6A 4E84A 5F11A 2HLZA 1RK2A 3IN1A 3RQXA 2VARA 2QCVA 4KALA 3RO4A 1UB0A 3RTDA 3DRWA 3MBJA 3RSSA 5F0ZA 1RKSA 4EBUA 5BYDA 2DDOA 2DDWA 3QA2A 5BYCA 3JULA 1EKQA 2R3EA 3Q1YA 3RTEA 1RFUA 3UQEA 3RREA 3GBUA 1LIJA 2Q5RA 4O1LA 3RSQA 3UMPA 4S1IB 3RQQA 2AWDA 2YXTA 5C40A 4N08A 1VI9A 1DGMA 3RT7A 1LIOA 3RQHA 4PVVA 3UQ6A 3B1PA 3RU2A 3HJ6A 2HW1A 5COJA 3RT9A 2AB8A 2F7KA 1EKKA 3RRFA 4XDAA 1RKAA 1KYHA 1RKDA 3NL5A 3HYOA 4K93A 3RY7A 1BX4A 2HQQA 3RPHA 2NWHA 3NL2A 3NCAA 4DU5A 5C3ZA 1YHJA 1C3QA 5CGEA 3LOOA 5CM5A 3GO7A 3UMOA 4EUMA 3B1NA 1V1SA 2A9YA 2XTBA 2ABQA 3IE7A 1TD2A 3B3LA 3RQ8A 4LCAA 3IBQA 4S1HA 4YL5A 5EYNA 4C5NA 4C5MA 4KANA 3LKIA 1TZ3A 4JJPA 3K5WA 3NM1A 3NBWA 4S1MA 3FHXA 3RPZA 1V1BA 4LC4A 3HICA 3LHXA 4O1GA 4S1IA 3RQ2A 3PZSA 3FHYA 1UA4A 4X8FA 2YXUA 1U2XA 4C5JA 4C5KA 1LHRA 1V1AA 2RBCA 4XCKA 2I6AA 4K8CA 4EN4A 3RQ5A 4E8YA 1L2LA 5EY7A 2R3BA 2AJRA 2ABSA 2DCNA 3RTBA 4E3AA 3RS8A 4KAHA 3B1OA 3QAIA 4E69A 2AJPA 3RTAA 3UQDA 2JG5A 4YWRA 4B8SA 3NBVA 2I6BA 3IKHA 4E8ZA 4K8KA 5BYEA 2AA0A 3NL3A 4UBEA 3MBHA 4E8WA 2AFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V19 A;  1TZ6 A;  3RSG A;  2PKF A;  2C49 A;  4K8T A;  4K9C A;  3VAQ A;  5BYF A;  1LHP A;  1TYY A;  3K9E A;  1JXH A;  4JKU A;  5TQI A;  1JXI A;  3IQ0 A;  5C41 A;  3RRB A;  3RU3 A;  2JGV A;  3PL2 A;  2FV7 A;  3GO6 A;  2I5B A;  3KEU A;  4K9I A;  5TRW A;  1RFV A;  2V78 A;  3RTG A;  3H74 A;  4XF7 A;  5CGA A;  3UQ9 A;  3OTX A;  3W4S A;  2F02 A;  4C5L A;  3KTN A;  1LIK A;  3KZH A;  3NC9 A;  3IH0 A;  3NL6 A;  2PKN A;  3BF5 A;  4LBX A;  4N09 A;  3EWM A;  3B1Q A;  4XF6 A;  3UBO A;  1ESQ A;  1GQT A;  3RRJ A;  4DC3 A;  2A9Z A;  3HPD A;  4GM6 A;  3NC2 A;  3RSF A;  2QHP A;  3RS9 A;  4LBG A;  2AX3 A;  1VK4 A;  2PKM A;  2DDM A;  1YGK A;  4EOH A;  1YGJ A;  4KBE A;  3RTC A;  1RFT A;  3DZV A;  3N1C A;  3B1R A;  4JKS A;  3BGK A;  3ZS7 A;  5B6A A;  2PKK A;  3RQ6 A;  3LJS A;  4KAD A;  3I3Y A;  2C4E A;  5C3Y A;  3NM3 A;  3RM5 A;  1VM7 A;  2JG1 A;  4U7X A;  4K8P A;  1GC5 A;  3CQD A;  3H49 A;  3VAS A;  1ESJ A;  3Q92 A;  4B8R A;  1LII A;  1WYE A;  4WJM A;  3KD6 A;  4E84 A;  5F11 A;  2HLZ A;  1RK2 A;  3IN1 A;  3RQX A;  2VAR A;  2QCV A;  4KAL A;  3RO4 A;  1UB0 A;  3RTD A;  3DRW A;  3MBJ A;  3RSS A;  5F0Z A;  1RKS A;  4EBU A;  5BYD A;  2DDO A;  2DDW A;  3QA2 A;  5BYC A;  3JUL A;  1EKQ A;  2R3E A;  3Q1Y A;  3RTE A;  1RFU A;  3UQE A;  3RRE A;  3GBU A;  1LIJ A;  2Q5R A;  4O1L A;  3RSQ A;  3UMP A;  4S1I B;  3RQQ A;  2AWD A;  2YXT A;  5C40 A;  4N08 A;  1VI9 A;  1DGM A;  3RT7 A;  1LIO A;  3RQH A;  4PVV A;  3UQ6 A;  3B1P A;  3RU2 A;  2HW1 A;  5COJ A;  3RT9 A;  2AB8 A;  2F7K A;  1EKK A;  3RRF A;  4XDA A;  1RKA A;  1KYH A;  1RKD A;  3NL5 A;  3HYO A;  4K93 A;  3RY7 A;  1BX4 A;  2HQQ A;  3RPH A;  2NWH A;  3NL2 A;  3NCA A;  4DU5 A;  5C3Z A;  1YHJ A;  1C3Q A;  5CGE A;  3LOO A;  5CM5 A;  3GO7 A;  3UMO A;  4EUM A;  3B1N A;  1V1S A;  2A9Y A;  2XTB A;  2ABQ A;  3IE7 A;  1TD2 A;  3B3L A;  3RQ8 A;  4LCA A;  3IBQ A;  4S1H A;  4YL5 A;  5EYN A;  4C5N A;  4C5M A;  4KAN A;  3LKI A;  1TZ3 A;  4JJP A;  3K5W A;  3NM1 A;  3NBW A;  4S1M A;  3FHX A;  3RPZ A;  1V1B A;  4LC4 A;  3HIC A;  3LHX A;  4O1G A;  4S1I A;  3RQ2 A;  3PZS A;  3FHY A;  1UA4 A;  4X8F A;  2YXU A;  1U2X A;  4C5J A;  4C5K A;  1LHR A;  1V1A A;  2RBC A;  4XCK A;  2I6A A;  4K8C A;  4EN4 A;  3RQ5 A;  4E8Y A;  1L2L A;  5EY7 A;  2R3B A;  2AJR A;  2ABS A;  2DCN A;  3RTB A;  4E3A A;  3RS8 A;  4KAH A;  3B1O A;  3QAI A;  4E69 A;  2AJP A;  3RTA A;  3UQD A;  2JG5 A;  4YWR A;  4B8S A;  3NBV A;  2I6B A;  3IKH A;  4E8Z A;  4K8K A;  5BYE A;  2AA0 A;  3NL3 A;  4UBE A;  3MBH A;  4E8W A;  2AFB A; 
#chains in the Genus database with same CATH topology
 2AM1 A;  5A5F A;  3RSG A;  3VAQ A;  5BYF A;  4CVK A;  5TRW A;  2VOS A;  1P31 A;  3RTG A;  1O5Z A;  3W4S A;  3KTN A;  3KZH A;  3NC9 A;  4HV4 A;  5C40 A;  4N09 A;  3QCZ A;  2GC6 A;  2UUP A;  2Y1O A;  2QHP A;  2AX3 A;  4EOH A;  1YGK A;  4QF5 A;  4CVM A;  1RFT A;  1W7K A;  5B6A A;  3ZS7 A;  3BGK A;  1UAG A;  5C3Y A;  1GG4 A;  2JG1 A;  1GC5 A;  3VAS A;  1LII A;  3KD6 A;  1UB0 A;  4UAG A;  1W78 A;  4EBU A;  2DDW A;  3JUL A;  2R3E A;  3UQE A;  3RRE A;  2Q5R A;  3RT7 A;  3NL5 A;  4K93 A;  1WTH D;  2NWH A;  3NL2 A;  5CGE A;  3UAG A;  3GO7 A;  2Y66 A;  3B1N A;  2XTB A;  3B3L A;  4LCA A;  4S1H A;  3K5W A;  2XJA A;  3NM1 A;  3NRS A;  3HIC A;  2Y68 A;  3RQ2 A;  1U2X A;  4C5J A;  2JFF A;  4E8Y A;  2AJR A;  2DCN A;  1EEH A;  4CVL A;  4BUB A;  4KAH A;  3B1O A;  4E69 A;  2AJP A;  2JG5 A;  2JFH A;  3IKH A;  2AA0 A;  1TZ6 A;  2C49 A;  4K8T A;  4K9C A;  1LHP A;  1TYY A;  3K9E A;  3LK7 A;  5TQI A;  3IQ0 A;  3RRB A;  3RU3 A;  3PL2 A;  2FV7 A;  2I5B A;  3KEU A;  1RFV A;  2X5O A;  1E0D A;  4C5L A;  1LIK A;  3EWM A;  3UBO A;  1GQT A;  4DC3 A;  4LBG A;  2VTD A;  1YGJ A;  4JKS A;  3N1C A;  3B1R A;  3EAG A;  1P3D A;  3I3Y A;  2C4E A;  1JBW A;  3H49 A;  4B8R A;  4WJM A;  4ZIY A;  1JBV A;  2VOR A;  3IN1 A;  4KAL A;  3ZL8 A;  3DRW A;  3MBJ A;  3RSS A;  3ZM6 A;  2GC5 A;  2DDO A;  5BYC A;  3Q1Y A;  1EKQ A;  4O1L A;  3RSQ A;  3RQQ A;  2AWD A;  2YXT A;  1VI9 A;  1LIO A;  3UQ6 A;  2AM2 A;  3RT9 A;  3RRF A;  1RKD A;  2WTZ A;  3NCA A;  5C3Z A;  1YHJ A;  5CM5 A;  3UMO A;  1V1S A;  1TD2 A;  4C5N A;  4C5M A;  4KAN A;  3LKI A;  3FHX A;  1V1B A;  4LC4 A;  3LHX A;  2JFG A;  2YXU A;  4C5K A;  2UAG A;  2F00 A;  4K8C A;  4EN4 A;  4E3A A;  2VTE A;  3RTA A;  2GCB A;  2I6B A;  3NL3 A;  4UBE A;  1V19 A;  4JKU A;  3GO6 A;  4K9I A;  4QDI A;  5CGA A;  3OTX A;  3ZM5 A;  2F02 A;  2XPC A;  3NL6 A;  3RTE A;  3IH0 A;  1GQY A;  3B1Q A;  4XF6 A;  3RRJ A;  2A9Z A;  3NC2 A;  3RSF A;  2DDM A;  3RTC A;  4KBE A;  3HN7 A;  3LJS A;  4KAD A;  3NM3 A;  3RM5 A;  3CQD A;  1WYE A;  4E84 A;  5F11 A;  1RK2 A;  3RO4 A;  3RTD A;  1RKS A;  5BYD A;  3GBU A;  4S1I B;  4N08 A;  4BUC A;  3RQH A;  3B1P A;  3RU2 A;  5COJ A;  2AB8 A;  1KYH A;  2HQQ A;  3RPH A;  4EUM A;  3IBQ A;  1TZ3 A;  4JJP A;  3NBW A;  4S1M A;  4O1G A;  3PYZ A;  1UA4 A;  4C13 A;  1LHR A;  2RBC A;  2Y67 A;  3RQ5 A;  5EY7 A;  2ABS A;  2UUO A;  3RS8 A;  3UQD A;  4YWR A;  4E8Z A;  4B8S A;  3NBV A;  3MBH A;  4E8W A;  2AFB A;  2PKF A;  1JXH A;  1JXI A;  5C41 A;  2JGV A;  2V78 A;  3H74 A;  4XF7 A;  3UQ9 A;  1J6U A;  4LBX A;  3BF5 A;  2PKN A;  4C12 A;  5A5E A;  1ESQ A;  3HPD A;  4GM6 A;  3RS9 A;  1VK4 A;  2PKM A;  3DZV A;  2PKK A;  3RQ6 A;  1VM7 A;  4U7X A;  4K8P A;  1ESJ A;  3Q92 A;  2HLZ A;  3RQX A;  2VAR A;  2QCV A;  5F0Z A;  3QA2 A;  1FGS A;  1E8C A;  1RFU A;  3N2A A;  1LIJ A;  3UMP A;  1DGM A;  1GQQ A;  4PVV A;  2WJP A;  3HJ6 A;  2HW1 A;  2Z6B D;  2F7K A;  1EKK A;  4XDA A;  1RKA A;  3HYO A;  3RY7 A;  1BX4 A;  1K28 D;  4DU5 A;  1C3Q A;  3LOO A;  2A9Y A;  2ABQ A;  3IE7 A;  3RQ8 A;  4YL5 A;  5EYN A;  3RPZ A;  4S1I A;  3PZS A;  3FHY A;  4X8F A;  1V1A A;  4XCK A;  2I6A A;  1L2L A;  2R3B A;  3RTB A;  3QAI A;  2GCA A;  4K8K A;  5BYE A; 
#chains in the Genus database with same CATH homology
 1V19 A;  1TZ6 A;  3RSG A;  2PKF A;  2C49 A;  4K8T A;  4K9C A;  3VAQ A;  5BYF A;  1LHP A;  1TYY A;  3K9E A;  1JXH A;  4JKU A;  5TQI A;  1JXI A;  3IQ0 A;  5C41 A;  3RRB A;  3RU3 A;  2JGV A;  3PL2 A;  2FV7 A;  3GO6 A;  2I5B A;  3KEU A;  4K9I A;  5TRW A;  1RFV A;  2V78 A;  3RTG A;  3H74 A;  4XF7 A;  5CGA A;  3UQ9 A;  3OTX A;  3W4S A;  2F02 A;  4C5L A;  3KTN A;  1LIK A;  3KZH A;  3NC9 A;  3IH0 A;  3NL6 A;  2PKN A;  3BF5 A;  4LBX A;  4N09 A;  3EWM A;  3B1Q A;  4XF6 A;  3UBO A;  1ESQ A;  1GQT A;  3RRJ A;  4DC3 A;  2A9Z A;  3HPD A;  4GM6 A;  3NC2 A;  3RSF A;  2QHP A;  3RS9 A;  4LBG A;  2AX3 A;  1VK4 A;  2PKM A;  2DDM A;  1YGK A;  4EOH A;  1YGJ A;  4KBE A;  3RTC A;  1RFT A;  3DZV A;  3N1C A;  3B1R A;  4JKS A;  3BGK A;  3ZS7 A;  5B6A A;  2PKK A;  3RQ6 A;  3LJS A;  4KAD A;  3I3Y A;  2C4E A;  5C3Y A;  3NM3 A;  3RM5 A;  1VM7 A;  2JG1 A;  4U7X A;  4K8P A;  1GC5 A;  3CQD A;  3H49 A;  3VAS A;  1ESJ A;  3Q92 A;  4B8R A;  1LII A;  1WYE A;  4WJM A;  3KD6 A;  4E84 A;  5F11 A;  2HLZ A;  1RK2 A;  3IN1 A;  3RQX A;  2VAR A;  2QCV A;  4KAL A;  3RO4 A;  1UB0 A;  3RTD A;  3DRW A;  3MBJ A;  3RSS A;  5F0Z A;  1RKS A;  4EBU A;  5BYD A;  2DDO A;  2DDW A;  3QA2 A;  5BYC A;  3JUL A;  1EKQ A;  2R3E A;  3Q1Y A;  3RTE A;  1RFU A;  3UQE A;  3RRE A;  3GBU A;  1LIJ A;  2Q5R A;  4O1L A;  3RSQ A;  3UMP A;  4S1I B;  3RQQ A;  2AWD A;  2YXT A;  5C40 A;  4N08 A;  1VI9 A;  1DGM A;  3RT7 A;  1LIO A;  3RQH A;  4PVV A;  3UQ6 A;  3B1P A;  3RU2 A;  3HJ6 A;  2HW1 A;  5COJ A;  3RT9 A;  2AB8 A;  2F7K A;  1EKK A;  3RRF A;  4XDA A;  1RKA A;  1KYH A;  1RKD A;  3NL5 A;  3HYO A;  4K93 A;  3RY7 A;  1BX4 A;  2HQQ A;  3RPH A;  2NWH A;  3NL2 A;  3NCA A;  4DU5 A;  5C3Z A;  1YHJ A;  1C3Q A;  5CGE A;  3LOO A;  5CM5 A;  3GO7 A;  3UMO A;  4EUM A;  3B1N A;  1V1S A;  2A9Y A;  2XTB A;  2ABQ A;  3IE7 A;  1TD2 A;  3B3L A;  3RQ8 A;  4LCA A;  3IBQ A;  4S1H A;  4YL5 A;  5EYN A;  4C5N A;  4C5M A;  4KAN A;  3LKI A;  1TZ3 A;  4JJP A;  3K5W A;  3NM1 A;  3NBW A;  4S1M A;  3FHX A;  3RPZ A;  1V1B A;  4LC4 A;  3HIC A;  3LHX A;  4O1G A;  4S1I A;  3RQ2 A;  3PZS A;  3FHY A;  1UA4 A;  4X8F A;  2YXU A;  1U2X A;  4C5J A;  4C5K A;  1LHR A;  1V1A A;  2RBC A;  4XCK A;  2I6A A;  4K8C A;  4EN4 A;  3RQ5 A;  4E8Y A;  1L2L A;  5EY7 A;  2R3B A;  2AJR A;  2ABS A;  2DCN A;  3RTB A;  4E3A A;  3RS8 A;  4KAH A;  3B1O A;  3QAI A;  4E69 A;  2AJP A;  3RTA A;  3UQD A;  2JG5 A;  4YWR A;  4B8S A;  3NBV A;  2I6B A;  3IKH A;  4E8Z A;  4K8K A;  5BYE A;  2AA0 A;  3NL3 A;  4UBE A;  3MBH A;  4E8W A;  2AFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...