3CQDA

Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
304
Chain Sequence
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLLCSHDDTQKIYAYLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic structure of phosphofructokinase-2 from Escherichia coli in complex with two ATP molecules. Implications for substrate inhibition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-phosphofructokinase isozyme 2
total genus 98
structure length 304
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3cqdA00
4N09A 5F0ZA 2AX3A 3B1RA 3UQ6A 4DC3A 3BF5A 3HYOA 2JG1A 3RTCA 3FHYA 1TYYA 3RQ5A 3RRBA 2HQQA 3LKIA 4KALA 1LIKA 2A9ZA 2AFBA 1TZ6A 2YXUA 3H49A 3EWMA 3KTNA 5F11A 3FHXA 3MBHA 4XF7A 3H74A 5EY7A 3NL6A 3RO4A 4EN4A 4EUMA 1ESQA 2AWDA 5C41A 3RPHA 4B8SA 2HW1A 5BYFA 4LBGA 2PKNA 4C5NA 4UBEA 3N1CA 1GC5A 4K8CA 3GO7A 3KD6A 1YGJA 5CGAA 1LIIA 3RRJA 2C4EA 4E84A 2QCVA 3RM5A 2R3EA 1V19A 2F02A 4K9CA 3NC9A 3RT7A 2DDMA 2HLZA 1DGMA 3GO6A 3B1QA 3PZSA 2ABSA 4S1MA 4KADA 4YL5A 2F7KA 3IE7A 3RSGA 1RFVA 3NM1A 3NBVA 3RTBA 1TZ3A 3GBUA 3ZS7A 1V1SA 3RTAA 4WJMA 5C3YA 5COJA 1RKDA 3RU2A 4PVVA 3LOOA 4KBEA 3RPZA 4C5KA 1V1AA 4K8KA 2QHPA 3BGKA 2I6BA 4S1IA 3RQXA 3RS9A 3NM3A 3VAQA 2V78A 5BYEA 4KANA 2FV7A 4K9IA 3LHXA 4DU5A 3UMPA 2Q5RA 3K9EA 3RQ2A 3RREA 4E3AA 3UBOA 1KYHA 1LIOA 1VK4A 3DRWA 3HPDA 3Q92A 3RRFA 3RTDA 4E69A 4E8YA 1U2XA 5TRWA 2PKKA 4LC4A 1VM7A 5EYNA 3IBQA 3UQ9A 3RQHA 3RS8A 4JJPA 1LIJA 3IQ0A 4XCKA 1RKSA 3IKHA 1RFUA 3QA2A 3DZVA 4K8PA 3JULA 1YHJA 3RSFA 3NBWA 4KAHA 3OTXA 3RTGA 5C3ZA 1EKKA 1L2LA 4C5JA 2YXTA 3IH0A 3CQDA 3MBJA 1RK2A 2AJRA 2A9YA 5TQIA 2I5BA 4JKUA 3RQ8A 4E8WA 3NL2A 3RY7A 3NL3A 3RQQA 3KZHA 3UQEA 5BYDA 3NC2A 5C40A 2AJPA 4LBXA 5B6AA 3Q1YA 4N08A 2DDOA 3B1NA 5CM5A 1JXHA 3K5WA 3KEUA 1LHPA 4S1HA 5CGEA 2AB8A 4E8ZA 4EOHA 1UA4A 4O1LA 4K8TA 2ABQA 2AA0A 2PKMA 3VASA 4B8RA 1GQTA 1TD2A 3B1OA 4K93A 2JG5A 2DCNA 4XDAA 1BX4A 1UB0A 4S1IB 4JKSA 1RFTA 3RT9A 4U7XA 4GM6A 3LJSA 1JXIA 3RU3A 1C3QA 2JGVA 4O1GA 3RTEA 3UMOA 3RSSA 3W4SA 4C5LA 3I3YA 3HICA 3IN1A 3NL5A 1YGKA 2DDWA 3B1PA 1WYEA 2NWHA 2XTBA 3B3LA 4XF6A 5BYCA 3RSQA 1RKAA 2VARA 1ESJA 4YWRA 1LHRA 2C49A 3NCAA 2R3BA 2RBCA 2I6AA 1EKQA 4LCAA 4X8FA 1VI9A 3RQ6A 2PKFA 3QAIA 4C5MA 3PL2A 4EBUA 3UQDA 1V1BA
chains in the Genus database with same CATH superfamily
4N09A 1JBVA 5F0ZA 2AX3A 3B1RA 3UQ6A 4DC3A 3BF5A 3HYOA 2JG1A 3RTCA 1FGSA 3FHYA 1TYYA 2JFHA 3RQ5A 3RRBA 4CVMA 2HQQA 3NL5A 3LKIA 4KALA 1LIKA 2A9ZA 2AFBA 1TZ6A 2YXUA 3H49A 1W78A 3EWMA 4EUMA 3KTNA 5F11A 3FHXA 3MBHA 2X5OA 1P31A 3H74A 3NL6A 2JFGA 4XF7A 1UAGA 1ESQA 2AWDA 3RO4A 3UAGA 3ZM5A 4EN4A 3RPHA 4B8SA 2HW1A 5BYFA 2AM2A 4LBGA 2PKNA 4C5NA 4UBEA 3N1CA 1GC5A 4K8CA 3GO7A 3KD6A 1O5ZA 1YGJA 1LIIA 5CGAA 2Y1OA 2C4EA 3RRJA 4E84A 2QCVA 2VTDA 3LK7A 3RM5A 2R3EA 3EAGA 1V19A 2F02A 4K9CA 3NC9A 3RT7A 2DDMA 1DGMA 2HLZA 3GO6A 4QF5A 3B1QA 3HJ6A 3PZSA 2ABSA 4S1MA 4KADA 2AM1A 2GCAA 2F7KA 3IE7A 4YL5A 1RFVA 3NM1A 3NBVA 3IN1A 1TZ3A 3GBUA 3RSGA 1V1SA 3RTAA 4WJMA 4BUCA 5C3YA 1GQQA 5COJA 1RKDA 3RU2A 2VTEA 3HN7A 4PVVA 3LOOA 4KBEA 3RPZA 4C5KA 1V1AA 4BUBA 4K8KA 4CVKA 2QHPA 5C41A 3BGKA 2I6BA 2WTZA 4S1IA 3RQXA 3RS9A 3NM3A 1E0DA 1P3DA 2XJAA 3VAQA 2V78A 5BYEA 4KANA 2FV7A 4K9IA 3ZS7A 3LHXA 4DU5A 3QCZA 3UMPA 1W7KA 2Q5RA 3K9EA 3RQ2A 3RREA 2UUOA 4E3AA 3UBOA 1KYHA 1LIOA 1VK4A 3DRWA 3HPDA 3Q92A 3RRFA 3RTDA 4E69A 4E8YA 3UQDA 1U2XA 5TRWA 2Y66A 2PKKA 3N2AA 1VM7A 4LC4A 2UAGA 3IBQA 5EYNA 3RQHA 3RS8A 4JJPA 1LIJA 1GQYA 1J6UA 3IQ0A 4XCKA 1RKSA 3IKHA 1RFUA 3QA2A 3DZVA 4K8PA 3JULA 1YHJA 1JBWA 3RSFA 3NBWA 4KAHA 3OTXA 3RTGA 5C3ZA 1EKKA 1L2LA 4C5JA 2YXTA 3IH0A 3CQDA 5EY7A 3MBJA 1RK2A 2AJRA 2A9YA 5TQIA 2I5BA 4JKUA 3RQ8A 4E8WA 3NL2A 2XPCA 3NL3A 3RQQA 3KZHA 3RY7A 3UQEA 3NC2A 5A5FA 5BYDA 2AJPA 2GC6A 4LBXA 5A5EA 3Q1YA 2JFFA 4N08A 5B6AA 4CVLA 2DDOA 3B1NA 4C13A 1E8CA 5CM5A 1JXHA 3K5WA 3KEUA 1LHPA 4S1HA 4QDIA 5CGEA 2AB8A 4E8ZA 4EOHA 1UA4A 4O1LA 4K8TA 4C12A 2ABQA 2AA0A 2PKMA 3PYZA 3VASA 4B8RA 1GQTA 1TD2A 3B1OA 2VOSA 2JG5A 4K93A 2DCNA 4XDAA 3ZL8A 1BX4A 1UB0A 2Y68A 4JKSA 1RFTA 4S1IB 3RT9A 1GG4A 4U7XA 4GM6A 3LJSA 1JXIA 3RU3A 1C3QA 2JGVA 4O1GA 3RTEA 3ZM6A 3UMOA 3RSSA 2GCBA 3W4SA 4HV4A 2UUPA 4C5LA 3I3YA 3HICA 2WJPA 2Y67A 1YGKA 2DDWA 2F00A 1WYEA 3B1PA 2NWHA 2GC5A 2XTBA 3B3LA 4XF6A 3RTBA 3RSQA 1RKAA 2VARA 2VORA 5BYCA 5C40A 1ESJA 4YWRA 4ZIYA 1LHRA 2C49A 4UAGA 3NCAA 2R3BA 2RBCA 3UQ9A 2I6AA 1EKQA 4LCAA 4X8FA 1VI9A 3RQ6A 2PKFA 3QAIA 4C5MA 3PL2A 4EBUA 3NRSA 1EEHA 1V1BA
chains in the Genus database with same CATH topology
4N09A 5F0ZA 2AX3A 3B1RA 3UQ6A 4DC3A 3BF5A 3HYOA 2JG1A 3RTCA 3FHYA 1TYYA 3RQ5A 3RRBA 2HQQA 3LKIA 4KALA 1LIKA 2A9ZA 2AFBA 1TZ6A 2YXUA 3H49A 3EWMA 3KTNA 5F11A 3FHXA 3MBHA 4XF7A 3H74A 5EY7A 3NL6A 3RO4A 4EN4A 4EUMA 1ESQA 2AWDA 5C41A 3RPHA 4B8SA 2HW1A 5BYFA 4LBGA 2PKNA 4C5NA 4UBEA 3N1CA 1GC5A 4K8CA 3GO7A 3KD6A 1YGJA 5CGAA 1LIIA 3RRJA 2C4EA 4E84A 2QCVA 3RM5A 2R3EA 1V19A 2F02A 4K9CA 3NC9A 3RT7A 2DDMA 2HLZA 1DGMA 3GO6A 3B1QA 3HJ6A 3PZSA 2ABSA 4S1MA 4KADA 4YL5A 2F7KA 3IE7A 3RSGA 1RFVA 3NM1A 3NBVA 3RTBA 1TZ3A 3GBUA 3ZS7A 1V1SA 3RTAA 4WJMA 5C3YA 5COJA 1RKDA 3RU2A 4PVVA 3LOOA 4KBEA 3RPZA 4C5KA 1V1AA 4K8KA 2QHPA 3BGKA 2I6BA 4S1IA 3RQXA 3RS9A 3NM3A 3VAQA 2V78A 5BYEA 4KANA 2FV7A 4K9IA 3LHXA 4DU5A 3UMPA 2Q5RA 3K9EA 3RQ2A 3RREA 4E3AA 3UBOA 1KYHA 1LIOA 1VK4A 3DRWA 3HPDA 3Q92A 3RRFA 3RTDA 4E69A 4E8YA 1U2XA 5TRWA 2PKKA 4LC4A 1VM7A 5EYNA 3IBQA 3UQ9A 3RQHA 3RS8A 4JJPA 1LIJA 3IQ0A 4XCKA 1RKSA 3IKHA 1RFUA 3QA2A 3DZVA 4K8PA 3JULA 1YHJA 3RSFA 3NBWA 4KAHA 3OTXA 3RTGA 5C3ZA 1EKKA 1L2LA 4C5JA 2YXTA 3IH0A 3CQDA 3MBJA 1RK2A 2AJRA 2A9YA 5TQIA 2I5BA 4JKUA 3RQ8A 4E8WA 3NL2A 3RY7A 3NL3A 3RQQA 3KZHA 3UQEA 5BYDA 3NC2A 5C40A 2AJPA 4LBXA 5B6AA 3Q1YA 4N08A 2DDOA 3B1NA 5CM5A 1JXHA 3K5WA 3KEUA 1LHPA 4S1HA 5CGEA 2AB8A 4E8ZA 4EOHA 1UA4A 4O1LA 4K8TA 2ABQA 2AA0A 2PKMA 3VASA 4B8RA 1GQTA 1TD2A 3B1OA 4K93A 2JG5A 2DCNA 4XDAA 1BX4A 1UB0A 4S1IB 4JKSA 1RFTA 3RT9A 4U7XA 4GM6A 3LJSA 1JXIA 3RU3A 1C3QA 2JGVA 4O1GA 3RTEA 3UMOA 3RSSA 3W4SA 4C5LA 3I3YA 3HICA 3IN1A 3NL5A 1YGKA 2DDWA 3B1PA 1WYEA 2NWHA 2XTBA 3B3LA 4XF6A 5BYCA 3RSQA 1RKAA 2VARA 1ESJA 4YWRA 1LHRA 2C49A 3NCAA 2R3BA 2RBCA 2I6AA 1EKQA 4LCAA 4X8FA 1VI9A 3RQ6A 2PKFA 3QAIA 4C5MA 3PL2A 4EBUA 3UQDA 1V1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N09 A;  5F0Z A;  2AX3 A;  3B1R A;  3UQ6 A;  4DC3 A;  3BF5 A;  3HYO A;  2JG1 A;  3RTC A;  3FHY A;  1TYY A;  3RQ5 A;  3RRB A;  2HQQ A;  3LKI A;  4KAL A;  1LIK A;  2A9Z A;  2AFB A;  1TZ6 A;  2YXU A;  3H49 A;  3EWM A;  3KTN A;  5F11 A;  3FHX A;  3MBH A;  4XF7 A;  3H74 A;  5EY7 A;  3NL6 A;  3RO4 A;  4EN4 A;  4EUM A;  1ESQ A;  2AWD A;  5C41 A;  3RPH A;  4B8S A;  2HW1 A;  5BYF A;  4LBG A;  2PKN A;  4C5N A;  4UBE A;  3N1C A;  1GC5 A;  4K8C A;  3GO7 A;  3KD6 A;  1YGJ A;  5CGA A;  1LII A;  3RRJ A;  2C4E A;  4E84 A;  2QCV A;  3RM5 A;  2R3E A;  1V19 A;  2F02 A;  4K9C A;  3NC9 A;  3RT7 A;  2DDM A;  2HLZ A;  1DGM A;  3GO6 A;  3B1Q A;  3PZS A;  2ABS A;  4S1M A;  4KAD A;  4YL5 A;  2F7K A;  3IE7 A;  3RSG A;  1RFV A;  3NM1 A;  3NBV A;  3RTB A;  1TZ3 A;  3GBU A;  3ZS7 A;  1V1S A;  3RTA A;  4WJM A;  5C3Y A;  5COJ A;  1RKD A;  3RU2 A;  4PVV A;  3LOO A;  4KBE A;  3RPZ A;  4C5K A;  1V1A A;  4K8K A;  2QHP A;  3BGK A;  2I6B A;  4S1I A;  3RQX A;  3RS9 A;  3NM3 A;  3VAQ A;  2V78 A;  5BYE A;  4KAN A;  2FV7 A;  4K9I A;  3LHX A;  4DU5 A;  3UMP A;  2Q5R A;  3K9E A;  3RQ2 A;  3RRE A;  4E3A A;  3UBO A;  1KYH A;  1LIO A;  1VK4 A;  3DRW A;  3HPD A;  3Q92 A;  3RRF A;  3RTD A;  4E69 A;  4E8Y A;  1U2X A;  5TRW A;  2PKK A;  4LC4 A;  1VM7 A;  5EYN A;  3IBQ A;  3UQ9 A;  3RQH A;  3RS8 A;  4JJP A;  1LIJ A;  3IQ0 A;  4XCK A;  1RKS A;  3IKH A;  1RFU A;  3QA2 A;  3DZV A;  4K8P A;  3JUL A;  1YHJ A;  3RSF A;  3NBW A;  4KAH A;  3OTX A;  3RTG A;  5C3Z A;  1EKK A;  1L2L A;  4C5J A;  2YXT A;  3IH0 A;  3CQD A;  3MBJ A;  1RK2 A;  2AJR A;  2A9Y A;  5TQI A;  2I5B A;  4JKU A;  3RQ8 A;  4E8W A;  3NL2 A;  3RY7 A;  3NL3 A;  3RQQ A;  3KZH A;  3UQE A;  5BYD A;  3NC2 A;  5C40 A;  2AJP A;  4LBX A;  5B6A A;  3Q1Y A;  4N08 A;  2DDO A;  3B1N A;  5CM5 A;  1JXH A;  3K5W A;  3KEU A;  1LHP A;  4S1H A;  5CGE A;  2AB8 A;  4E8Z A;  4EOH A;  1UA4 A;  4O1L A;  4K8T A;  2ABQ A;  2AA0 A;  2PKM A;  3VAS A;  4B8R A;  1GQT A;  1TD2 A;  3B1O A;  4K93 A;  2JG5 A;  2DCN A;  4XDA A;  1BX4 A;  1UB0 A;  4S1I B;  4JKS A;  1RFT A;  3RT9 A;  4U7X A;  4GM6 A;  3LJS A;  1JXI A;  3RU3 A;  1C3Q A;  2JGV A;  4O1G A;  3RTE A;  3UMO A;  3RSS A;  3W4S A;  4C5L A;  3I3Y A;  3HIC A;  3IN1 A;  3NL5 A;  1YGK A;  2DDW A;  3B1P A;  1WYE A;  2NWH A;  2XTB A;  3B3L A;  4XF6 A;  5BYC A;  3RSQ A;  1RKA A;  2VAR A;  1ESJ A;  4YWR A;  1LHR A;  2C49 A;  3NCA A;  2R3B A;  2RBC A;  2I6A A;  1EKQ A;  4LCA A;  4X8F A;  1VI9 A;  3RQ6 A;  2PKF A;  3QAI A;  4C5M A;  3PL2 A;  4EBU A;  3UQD A;  1V1B A; 
#chains in the Genus database with same CATH topology
 4N09 A;  1JBV A;  5F0Z A;  2AX3 A;  3B1R A;  3UQ6 A;  4DC3 A;  3BF5 A;  3HYO A;  2JG1 A;  3RTC A;  1FGS A;  3FHY A;  1TYY A;  2JFH A;  3RQ5 A;  3RRB A;  4CVM A;  2HQQ A;  3NL5 A;  3LKI A;  4KAL A;  1LIK A;  2A9Z A;  2AFB A;  1TZ6 A;  2YXU A;  3H49 A;  1W78 A;  3EWM A;  4EUM A;  3KTN A;  5F11 A;  3FHX A;  3MBH A;  2X5O A;  1P31 A;  3H74 A;  3NL6 A;  2JFG A;  4XF7 A;  1UAG A;  1ESQ A;  2AWD A;  3RO4 A;  3UAG A;  3ZM5 A;  4EN4 A;  3RPH A;  4B8S A;  2HW1 A;  5BYF A;  2AM2 A;  4LBG A;  2PKN A;  4C5N A;  4UBE A;  3N1C A;  1GC5 A;  4K8C A;  3GO7 A;  3KD6 A;  1O5Z A;  1YGJ A;  1LII A;  5CGA A;  2Y1O A;  2C4E A;  3RRJ A;  4E84 A;  2QCV A;  2VTD A;  3LK7 A;  3RM5 A;  2R3E A;  3EAG A;  1V19 A;  2F02 A;  4K9C A;  3NC9 A;  3RT7 A;  2DDM A;  1DGM A;  2HLZ A;  3GO6 A;  4QF5 A;  3B1Q A;  3HJ6 A;  3PZS A;  2ABS A;  4S1M A;  4KAD A;  2AM1 A;  2GCA A;  2F7K A;  3IE7 A;  4YL5 A;  1RFV A;  3NM1 A;  3NBV A;  3IN1 A;  1TZ3 A;  3GBU A;  3RSG A;  1V1S A;  3RTA A;  4WJM A;  4BUC A;  5C3Y A;  1GQQ A;  5COJ A;  1RKD A;  3RU2 A;  2VTE A;  3HN7 A;  4PVV A;  3LOO A;  4KBE A;  3RPZ A;  4C5K A;  1V1A A;  4BUB A;  4K8K A;  4CVK A;  2QHP A;  5C41 A;  3BGK A;  2I6B A;  2WTZ A;  4S1I A;  3RQX A;  3RS9 A;  3NM3 A;  1E0D A;  1P3D A;  2XJA A;  3VAQ A;  2V78 A;  5BYE A;  4KAN A;  2FV7 A;  4K9I A;  3ZS7 A;  3LHX A;  4DU5 A;  3QCZ A;  3UMP A;  1W7K A;  2Q5R A;  3K9E A;  3RQ2 A;  3RRE A;  2UUO A;  4E3A A;  3UBO A;  1KYH A;  1LIO A;  1VK4 A;  3DRW A;  3HPD A;  3Q92 A;  3RRF A;  3RTD A;  4E69 A;  4E8Y A;  3UQD A;  1U2X A;  5TRW A;  2Y66 A;  2PKK A;  3N2A A;  1VM7 A;  4LC4 A;  2UAG A;  3IBQ A;  5EYN A;  3RQH A;  3RS8 A;  4JJP A;  1LIJ A;  1GQY A;  1J6U A;  3IQ0 A;  4XCK A;  1RKS A;  3IKH A;  1RFU A;  3QA2 A;  3DZV A;  4K8P A;  3JUL A;  1YHJ A;  1JBW A;  3RSF A;  3NBW A;  4KAH A;  3OTX A;  3RTG A;  5C3Z A;  1EKK A;  1L2L A;  4C5J A;  2YXT A;  3IH0 A;  3CQD A;  5EY7 A;  3MBJ A;  1RK2 A;  2AJR A;  2A9Y A;  5TQI A;  2I5B A;  4JKU A;  3RQ8 A;  4E8W A;  3NL2 A;  2XPC A;  3NL3 A;  3RQQ A;  3KZH A;  3RY7 A;  3UQE A;  3NC2 A;  5A5F A;  5BYD A;  2AJP A;  2GC6 A;  4LBX A;  5A5E A;  3Q1Y A;  2JFF A;  4N08 A;  5B6A A;  4CVL A;  2DDO A;  3B1N A;  4C13 A;  1E8C A;  5CM5 A;  1JXH A;  3K5W A;  3KEU A;  1LHP A;  4S1H A;  4QDI A;  5CGE A;  2AB8 A;  4E8Z A;  4EOH A;  1UA4 A;  4O1L A;  4K8T A;  4C12 A;  2ABQ A;  2AA0 A;  2PKM A;  3PYZ A;  3VAS A;  4B8R A;  1GQT A;  1TD2 A;  3B1O A;  2VOS A;  2JG5 A;  4K93 A;  2DCN A;  4XDA A;  3ZL8 A;  1BX4 A;  1UB0 A;  2Y68 A;  4JKS A;  1RFT A;  4S1I B;  3RT9 A;  1GG4 A;  4U7X A;  4GM6 A;  3LJS A;  1JXI A;  3RU3 A;  1C3Q A;  2JGV A;  4O1G A;  3RTE A;  3ZM6 A;  3UMO A;  3RSS A;  2GCB A;  3W4S A;  4HV4 A;  2UUP A;  4C5L A;  3I3Y A;  3HIC A;  2WJP A;  2Y67 A;  1YGK A;  2DDW A;  2F00 A;  1WYE A;  3B1P A;  2NWH A;  2GC5 A;  2XTB A;  3B3L A;  4XF6 A;  3RTB A;  3RSQ A;  1RKA A;  2VAR A;  2VOR A;  5BYC A;  5C40 A;  1ESJ A;  4YWR A;  4ZIY A;  1LHR A;  2C49 A;  4UAG A;  3NCA A;  2R3B A;  2RBC A;  3UQ9 A;  2I6A A;  1EKQ A;  4LCA A;  4X8F A;  1VI9 A;  3RQ6 A;  2PKF A;  3QAI A;  4C5M A;  3PL2 A;  4EBU A;  3NRS A;  1EEH A;  1V1B A; 
#chains in the Genus database with same CATH homology
 4N09 A;  5F0Z A;  2AX3 A;  3B1R A;  3UQ6 A;  4DC3 A;  3BF5 A;  3HYO A;  2JG1 A;  3RTC A;  3FHY A;  1TYY A;  3RQ5 A;  3RRB A;  2HQQ A;  3LKI A;  4KAL A;  1LIK A;  2A9Z A;  2AFB A;  1TZ6 A;  2YXU A;  3H49 A;  3EWM A;  3KTN A;  5F11 A;  3FHX A;  3MBH A;  4XF7 A;  3H74 A;  5EY7 A;  3NL6 A;  3RO4 A;  4EN4 A;  4EUM A;  1ESQ A;  2AWD A;  5C41 A;  3RPH A;  4B8S A;  2HW1 A;  5BYF A;  4LBG A;  2PKN A;  4C5N A;  4UBE A;  3N1C A;  1GC5 A;  4K8C A;  3GO7 A;  3KD6 A;  1YGJ A;  5CGA A;  1LII A;  3RRJ A;  2C4E A;  4E84 A;  2QCV A;  3RM5 A;  2R3E A;  1V19 A;  2F02 A;  4K9C A;  3NC9 A;  3RT7 A;  2DDM A;  2HLZ A;  1DGM A;  3GO6 A;  3B1Q A;  3HJ6 A;  3PZS A;  2ABS A;  4S1M A;  4KAD A;  4YL5 A;  2F7K A;  3IE7 A;  3RSG A;  1RFV A;  3NM1 A;  3NBV A;  3RTB A;  1TZ3 A;  3GBU A;  3ZS7 A;  1V1S A;  3RTA A;  4WJM A;  5C3Y A;  5COJ A;  1RKD A;  3RU2 A;  4PVV A;  3LOO A;  4KBE A;  3RPZ A;  4C5K A;  1V1A A;  4K8K A;  2QHP A;  3BGK A;  2I6B A;  4S1I A;  3RQX A;  3RS9 A;  3NM3 A;  3VAQ A;  2V78 A;  5BYE A;  4KAN A;  2FV7 A;  4K9I A;  3LHX A;  4DU5 A;  3UMP A;  2Q5R A;  3K9E A;  3RQ2 A;  3RRE A;  4E3A A;  3UBO A;  1KYH A;  1LIO A;  1VK4 A;  3DRW A;  3HPD A;  3Q92 A;  3RRF A;  3RTD A;  4E69 A;  4E8Y A;  1U2X A;  5TRW A;  2PKK A;  4LC4 A;  1VM7 A;  5EYN A;  3IBQ A;  3UQ9 A;  3RQH A;  3RS8 A;  4JJP A;  1LIJ A;  3IQ0 A;  4XCK A;  1RKS A;  3IKH A;  1RFU A;  3QA2 A;  3DZV A;  4K8P A;  3JUL A;  1YHJ A;  3RSF A;  3NBW A;  4KAH A;  3OTX A;  3RTG A;  5C3Z A;  1EKK A;  1L2L A;  4C5J A;  2YXT A;  3IH0 A;  3CQD A;  3MBJ A;  1RK2 A;  2AJR A;  2A9Y A;  5TQI A;  2I5B A;  4JKU A;  3RQ8 A;  4E8W A;  3NL2 A;  3RY7 A;  3NL3 A;  3RQQ A;  3KZH A;  3UQE A;  5BYD A;  3NC2 A;  5C40 A;  2AJP A;  4LBX A;  5B6A A;  3Q1Y A;  4N08 A;  2DDO A;  3B1N A;  5CM5 A;  1JXH A;  3K5W A;  3KEU A;  1LHP A;  4S1H A;  5CGE A;  2AB8 A;  4E8Z A;  4EOH A;  1UA4 A;  4O1L A;  4K8T A;  2ABQ A;  2AA0 A;  2PKM A;  3VAS A;  4B8R A;  1GQT A;  1TD2 A;  3B1O A;  4K93 A;  2JG5 A;  2DCN A;  4XDA A;  1BX4 A;  1UB0 A;  4S1I B;  4JKS A;  1RFT A;  3RT9 A;  4U7X A;  4GM6 A;  3LJS A;  1JXI A;  3RU3 A;  1C3Q A;  2JGV A;  4O1G A;  3RTE A;  3UMO A;  3RSS A;  3W4S A;  4C5L A;  3I3Y A;  3HIC A;  3IN1 A;  3NL5 A;  1YGK A;  2DDW A;  3B1P A;  1WYE A;  2NWH A;  2XTB A;  3B3L A;  4XF6 A;  5BYC A;  3RSQ A;  1RKA A;  2VAR A;  1ESJ A;  4YWR A;  1LHR A;  2C49 A;  3NCA A;  2R3B A;  2RBC A;  2I6A A;  1EKQ A;  4LCA A;  4X8F A;  1VI9 A;  3RQ6 A;  2PKF A;  3QAI A;  4C5M A;  3PL2 A;  4EBU A;  3UQD A;  1V1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...