3CQDA

Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
304
Chain Sequence
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLLCSHDDTQKIYAYLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic structure of phosphofructokinase-2 from Escherichia coli in complex with two ATP molecules. Implications for substrate inhibition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-phosphofructokinase isozyme 2
total genus 98
structure length 304
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3cqdA00
3VAQA 4K93A 3RU2A 4K8TA 3NBVA 5TQIA 3H74A 3RS9A 3RTEA 3EWMA 3CQDA 1VK4A 4S1MA 1RKSA 3VASA 1V19A 4E8YA 4KADA 1LIOA 2FV7A 3LOOA 3Q92A 4JKSA 2I5BA 3RQ6A 3B1NA 2HLZA 3GO6A 3Q1YA 2C4EA 3IKHA 4DC3A 4LC4A 2ABSA 3RO4A 5BYCA 3W4SA 5C3ZA 2V78A 3LKIA 3B1RA 3PZSA 1RFVA 3RTGA 3NC9A 4WJMA 1WYEA 1RKDA 4EUMA 2HW1A 3FHYA 2I6AA 3RU3A 3KD6A 2AX3A 4GM6A 1TZ3A 1EKQA 2PKNA 2VARA 3RRBA 1GC5A 3RQQA 3DRWA 1ESQA 4YWRA 3NL2A 4K8KA 2I6BA 3RQ2A 4PVVA 1TYYA 3RSQA 4N09A 1DGMA 1U2XA 1V1BA 3RPHA 5C40A 1JXIA 3HPDA 1VI9A 3ZS7A 1RKAA 3QA2A 4XF7A 2DDWA 3RREA 5BYDA 3UQDA 3QAIA 3RQ8A 3RRFA 3RTCA 3NL5A 3NM1A 2A9YA 4DU5A 3RSSA 1VM7A 4C5KA 5B6AA 1LHPA 4X8FA 4EN4A 3KTNA 3NCAA 5BYFA 3HYOA 3FHXA 4KBEA 2PKMA 3RPZA 2AB8A 1LHRA 3RQXA 5BYEA 4LBGA 1V1AA 3K9EA 4KANA 2DCNA 4KALA 2JG1A 1YHJA 1BX4A 3RSFA 1YGKA 1JXHA 2YXTA 3GBUA 5CM5A 2DDMA 3RT9A 3KZHA 4XDAA 2DDOA 3NL3A 3RY7A 2R3EA 4UBEA 5CGAA 3B1PA 3N1CA 4B8SA 1L2LA 2C49A 3IN1A 4C5JA 3LJSA 1RK2A 3B1OA 4LCAA 4U7XA 5F11A 3H49A 1TZ6A 3RTDA 1KYHA 2R3BA 4E8ZA 5COJA 3MBJA 4KAHA 4JJPA 3RM5A 3HICA 2XTBA 2PKKA 4C5MA 5CGEA 3IE7A 4K9IA 2A9ZA 3RRJA 4K8PA 2QCVA 3UMOA 2AJPA 1LIIA 5TRWA 1YGJA 2QHPA 1GQTA 3NL6A 4K8CA 4LBXA 3IH0A 4N08A 1ESJA 4XF6A 2AJRA 2NWHA 4E69A 4S1HA 4S1IA 5F0ZA 3BGKA 4C5LA 4XCKA 1UB0A 4O1GA 3I3YA 4YL5A 5C41A 3IBQA 5EYNA 5EY7A 2AFBA 1LIJA 4EOHA 4C5NA 2Q5RA 2PKFA 2RBCA 3DZVA 3RS8A 4O1LA 2AWDA 3RTBA 2JGVA 2AA0A 4S1IB 1RFUA 3PL2A 3MBHA 5C3YA 4E84A 3NM3A 4B8RA 3UQ6A 3UQEA 1EKKA 3RTAA 3KEUA 1UA4A 2JG5A 3B3LA 3RT7A 3GO7A 3K5WA 3OTXA 1RFTA 3LHXA 4JKUA 4EBUA 3UMPA 3B1QA 3RSGA 3NC2A 3NBWA 1TD2A 2YXUA 3IQ0A 4E3AA 4E8WA 2F02A 3UQ9A 3RQ5A 3UBOA 2HQQA 1C3QA 3RQHA 2ABQA 3JULA 1LIKA 2F7KA 1V1SA 3BF5A 4K9CA
chains in the Genus database with same CATH superfamily
3VAQA 4K93A 3RU2A 4K8TA 3NBVA 5TQIA 3H74A 4QF5A 3RS9A 3ZM5A 3RTEA 3EWMA 3CQDA 1VK4A 4S1MA 1RKSA 4BUBA 3VASA 1V19A 1UAGA 4E8YA 4KADA 1LIOA 2FV7A 1O5ZA 3LOOA 3Q92A 4JKSA 2I5BA 3HN7A 3RQ6A 3B1NA 2HLZA 2UUPA 1P3DA 1J6UA 3GO6A 2C4EA 3IKHA 3Q1YA 1JBWA 2ABSA 4LC4A 3RO4A 4DC3A 3W4SA 5BYCA 2V78A 1E0DA 3B1RA 3LKIA 1RFVA 3PZSA 3RTGA 5C3ZA 3NC9A 4WJMA 1WYEA 1RKDA 4EUMA 5A5FA 2HW1A 3FHYA 2I6AA 2XPCA 3RU3A 3KD6A 2AX3A 4GM6A 4C12A 1TZ3A 1EKQA 2PKNA 2VARA 2Y1OA 3RRBA 1GC5A 2JFFA 3RQQA 3DRWA 2VTEA 1ESQA 4YWRA 3NL2A 2AM2A 2I6BA 4K8KA 3RQ2A 4PVVA 1TYYA 3RSQA 2X5OA 1DGMA 1U2XA 4N09A 1V1BA 3RPHA 2VOSA 1JXIA 5C40A 3HPDA 1W7KA 1VI9A 1FGSA 3ZS7A 1RKAA 3QA2A 4XF7A 2DDWA 3RREA 5BYDA 3UQDA 3QAIA 1EEHA 3RQ8A 3RRFA 3RTCA 3NL5A 3NM1A 2Y67A 2A9YA 4DU5A 3RSSA 1VM7A 2UUOA 4C5KA 5B6AA 1LHPA 4X8FA 4EN4A 3KTNA 3NCAA 5BYFA 3HYOA 3FHXA 4KBEA 2PKMA 3RPZA 3HJ6A 2AB8A 1LHRA 3LK7A 1GQQA 3RQXA 4C13A 5BYEA 4LBGA 1V1AA 3K9EA 4KANA 2DCNA 4KALA 2JG1A 1YHJA 1BX4A 2JFGA 3RSFA 1YGKA 1JXHA 2YXTA 2WTZA 3GBUA 1E8CA 4CVKA 5CM5A 2DDMA 3RT9A 3KZHA 4XDAA 2DDOA 3NL3A 3RY7A 2R3EA 4UBEA 2VORA 5CGAA 2GCBA 3B1PA 3N1CA 4B8SA 1L2LA 2C49A 3IN1A 4C5JA 3LJSA 1RK2A 3B1OA 4LCAA 4U7XA 5F11A 3H49A 1TZ6A 3RTDA 3N2AA 1KYHA 2R3BA 4E8ZA 2WJPA 5COJA 3MBJA 4KAHA 4JJPA 4QDIA 3RM5A 3HICA 2XTBA 2PKKA 4C5MA 5CGEA 2JFHA 3IE7A 4K9IA 2A9ZA 3RRJA 1W78A 4K8PA 5A5EA 2QCVA 3UMOA 2AJPA 1LIIA 3QCZA 1YGJA 3NRSA 5TRWA 3PYZA 2QHPA 2Y68A 1GQTA 3NL6A 4K8CA 1GQYA 3IH0A 4LBXA 1ESJA 2AM1A 2VTDA 2AJRA 2NWHA 4N08A 4XF6A 4S1HA 4S1IA 3ZL8A 3BGKA 4C5LA 4E69A 4UAGA 5F0ZA 4XCKA 1UB0A 4O1GA 3I3YA 4YL5A 5C41A 3IBQA 5EYNA 5EY7A 2AFBA 1LIJA 2Y66A 4C5NA 2Q5RA 2PKFA 2RBCA 3DZVA 3RS8A 4EOHA 4ZIYA 4O1LA 2AWDA 2XJAA 3RTBA 2GC6A 3ZM6A 2JGVA 2AA0A 4S1IB 1RFUA 3PL2A 1P31A 4BUCA 3MBHA 5C3YA 4E84A 3NM3A 4B8RA 3UQ6A 3UQEA 1EKKA 2UAGA 2GCAA 3RTAA 3KEUA 1UA4A 2JG5A 3UAGA 3B3LA 3RT7A 3GO7A 3K5WA 3OTXA 1RFTA 3LHXA 4JKUA 4EBUA 3UMPA 3B1QA 3RSGA 1GG4A 3NBWA 1TD2A 3NC2A 2YXUA 3IQ0A 4E3AA 4E8WA 4CVMA 2F02A 3UQ9A 3RQ5A 3UBOA 2HQQA 1C3QA 3RQHA 2ABQA 1JBVA 3JULA 3EAGA 2GC5A 1LIKA 2F7KA 2F00A 4HV4A 4CVLA 1V1SA 3BF5A 4K9CA
chains in the Genus database with same CATH topology
3VAQA 4K93A 3RU2A 4K8TA 3NBVA 5TQIA 3H74A 3RS9A 3RTEA 3EWMA 3CQDA 1VK4A 4S1MA 1RKSA 3VASA 1V19A 4E8YA 4KADA 1LIOA 2FV7A 3LOOA 3Q92A 4JKSA 2I5BA 3RQ6A 3B1NA 2HLZA 3GO6A 3Q1YA 2C4EA 3IKHA 4DC3A 4LC4A 2ABSA 3RO4A 5BYCA 3W4SA 5C3ZA 2V78A 3LKIA 3B1RA 3PZSA 1RFVA 3RTGA 3NC9A 4WJMA 1WYEA 1RKDA 4EUMA 2HW1A 3FHYA 2I6AA 3RU3A 3KD6A 2AX3A 4GM6A 1TZ3A 1EKQA 2PKNA 2VARA 3RRBA 1GC5A 3RQQA 3DRWA 1ESQA 4YWRA 3NL2A 4K8KA 2I6BA 3RQ2A 4PVVA 1TYYA 3RSQA 4N09A 1DGMA 1U2XA 1V1BA 3RPHA 5C40A 1JXIA 3HPDA 1VI9A 3ZS7A 1RKAA 3QA2A 4XF7A 2DDWA 3RREA 5BYDA 3UQDA 3QAIA 3RQ8A 3RRFA 3RTCA 3NL5A 3NM1A 2A9YA 4DU5A 3RSSA 1VM7A 4C5KA 5B6AA 1LHPA 4X8FA 4EN4A 3KTNA 3NCAA 5BYFA 3HYOA 3FHXA 4KBEA 2PKMA 3RPZA 3HJ6A 2AB8A 1LHRA 3RQXA 5BYEA 4LBGA 1V1AA 3K9EA 4KANA 2DCNA 4KALA 2JG1A 1YHJA 1BX4A 3RSFA 1YGKA 1JXHA 2YXTA 3GBUA 5CM5A 2DDMA 3RT9A 3KZHA 4XDAA 2DDOA 3NL3A 3RY7A 2R3EA 4UBEA 5CGAA 3B1PA 3N1CA 4B8SA 1L2LA 2C49A 3IN1A 4C5JA 3LJSA 1RK2A 3B1OA 4LCAA 4U7XA 5F11A 3H49A 1TZ6A 3RTDA 1KYHA 2R3BA 4E8ZA 5COJA 3MBJA 4KAHA 4JJPA 3RM5A 3HICA 2XTBA 2PKKA 4C5MA 5CGEA 3IE7A 4K9IA 2A9ZA 3RRJA 4K8PA 2QCVA 3UMOA 2AJPA 1LIIA 5TRWA 1YGJA 2QHPA 1GQTA 3NL6A 4K8CA 4LBXA 3IH0A 4N08A 1ESJA 4XF6A 2AJRA 2NWHA 4E69A 4S1HA 4S1IA 5F0ZA 3BGKA 4C5LA 4XCKA 1UB0A 4O1GA 3I3YA 4YL5A 5C41A 3IBQA 5EYNA 5EY7A 2AFBA 1LIJA 4EOHA 4C5NA 2Q5RA 2PKFA 2RBCA 3DZVA 3RS8A 4O1LA 2AWDA 3RTBA 2JGVA 2AA0A 4S1IB 1RFUA 3PL2A 3MBHA 5C3YA 4E84A 3NM3A 4B8RA 3UQ6A 3UQEA 1EKKA 3RTAA 3KEUA 1UA4A 2JG5A 3B3LA 3RT7A 3GO7A 3K5WA 3OTXA 1RFTA 3LHXA 4JKUA 4EBUA 3UMPA 3B1QA 3RSGA 3NC2A 3NBWA 1TD2A 2YXUA 3IQ0A 4E3AA 4E8WA 2F02A 3UQ9A 3RQ5A 3UBOA 2HQQA 1C3QA 3RQHA 2ABQA 3JULA 1LIKA 2F7KA 1V1SA 3BF5A 4K9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAQ A;  4K93 A;  3RU2 A;  4K8T A;  3NBV A;  5TQI A;  3H74 A;  3RS9 A;  3RTE A;  3EWM A;  3CQD A;  1VK4 A;  4S1M A;  1RKS A;  3VAS A;  1V19 A;  4E8Y A;  4KAD A;  1LIO A;  2FV7 A;  3LOO A;  3Q92 A;  4JKS A;  2I5B A;  3RQ6 A;  3B1N A;  2HLZ A;  3GO6 A;  3Q1Y A;  2C4E A;  3IKH A;  4DC3 A;  4LC4 A;  2ABS A;  3RO4 A;  5BYC A;  3W4S A;  5C3Z A;  2V78 A;  3LKI A;  3B1R A;  3PZS A;  1RFV A;  3RTG A;  3NC9 A;  4WJM A;  1WYE A;  1RKD A;  4EUM A;  2HW1 A;  3FHY A;  2I6A A;  3RU3 A;  3KD6 A;  2AX3 A;  4GM6 A;  1TZ3 A;  1EKQ A;  2PKN A;  2VAR A;  3RRB A;  1GC5 A;  3RQQ A;  3DRW A;  1ESQ A;  4YWR A;  3NL2 A;  4K8K A;  2I6B A;  3RQ2 A;  4PVV A;  1TYY A;  3RSQ A;  4N09 A;  1DGM A;  1U2X A;  1V1B A;  3RPH A;  5C40 A;  1JXI A;  3HPD A;  1VI9 A;  3ZS7 A;  1RKA A;  3QA2 A;  4XF7 A;  2DDW A;  3RRE A;  5BYD A;  3UQD A;  3QAI A;  3RQ8 A;  3RRF A;  3RTC A;  3NL5 A;  3NM1 A;  2A9Y A;  4DU5 A;  3RSS A;  1VM7 A;  4C5K A;  5B6A A;  1LHP A;  4X8F A;  4EN4 A;  3KTN A;  3NCA A;  5BYF A;  3HYO A;  3FHX A;  4KBE A;  2PKM A;  3RPZ A;  2AB8 A;  1LHR A;  3RQX A;  5BYE A;  4LBG A;  1V1A A;  3K9E A;  4KAN A;  2DCN A;  4KAL A;  2JG1 A;  1YHJ A;  1BX4 A;  3RSF A;  1YGK A;  1JXH A;  2YXT A;  3GBU A;  5CM5 A;  2DDM A;  3RT9 A;  3KZH A;  4XDA A;  2DDO A;  3NL3 A;  3RY7 A;  2R3E A;  4UBE A;  5CGA A;  3B1P A;  3N1C A;  4B8S A;  1L2L A;  2C49 A;  3IN1 A;  4C5J A;  3LJS A;  1RK2 A;  3B1O A;  4LCA A;  4U7X A;  5F11 A;  3H49 A;  1TZ6 A;  3RTD A;  1KYH A;  2R3B A;  4E8Z A;  5COJ A;  3MBJ A;  4KAH A;  4JJP A;  3RM5 A;  3HIC A;  2XTB A;  2PKK A;  4C5M A;  5CGE A;  3IE7 A;  4K9I A;  2A9Z A;  3RRJ A;  4K8P A;  2QCV A;  3UMO A;  2AJP A;  1LII A;  5TRW A;  1YGJ A;  2QHP A;  1GQT A;  3NL6 A;  4K8C A;  4LBX A;  3IH0 A;  4N08 A;  1ESJ A;  4XF6 A;  2AJR A;  2NWH A;  4E69 A;  4S1H A;  4S1I A;  5F0Z A;  3BGK A;  4C5L A;  4XCK A;  1UB0 A;  4O1G A;  3I3Y A;  4YL5 A;  5C41 A;  3IBQ A;  5EYN A;  5EY7 A;  2AFB A;  1LIJ A;  4EOH A;  4C5N A;  2Q5R A;  2PKF A;  2RBC A;  3DZV A;  3RS8 A;  4O1L A;  2AWD A;  3RTB A;  2JGV A;  2AA0 A;  4S1I B;  1RFU A;  3PL2 A;  3MBH A;  5C3Y A;  4E84 A;  3NM3 A;  4B8R A;  3UQ6 A;  3UQE A;  1EKK A;  3RTA A;  3KEU A;  1UA4 A;  2JG5 A;  3B3L A;  3RT7 A;  3GO7 A;  3K5W A;  3OTX A;  1RFT A;  3LHX A;  4JKU A;  4EBU A;  3UMP A;  3B1Q A;  3RSG A;  3NC2 A;  3NBW A;  1TD2 A;  2YXU A;  3IQ0 A;  4E3A A;  4E8W A;  2F02 A;  3UQ9 A;  3RQ5 A;  3UBO A;  2HQQ A;  1C3Q A;  3RQH A;  2ABQ A;  3JUL A;  1LIK A;  2F7K A;  1V1S A;  3BF5 A;  4K9C A; 
#chains in the Genus database with same CATH topology
 3VAQ A;  4K93 A;  3RU2 A;  4K8T A;  3NBV A;  5TQI A;  3H74 A;  4QF5 A;  3RS9 A;  3ZM5 A;  3RTE A;  3EWM A;  3CQD A;  1VK4 A;  4S1M A;  1RKS A;  4BUB A;  3VAS A;  1V19 A;  1UAG A;  4E8Y A;  4KAD A;  1LIO A;  2FV7 A;  1O5Z A;  3LOO A;  3Q92 A;  4JKS A;  2I5B A;  3HN7 A;  3RQ6 A;  3B1N A;  2HLZ A;  2UUP A;  1P3D A;  1J6U A;  3GO6 A;  2C4E A;  3IKH A;  3Q1Y A;  1JBW A;  2ABS A;  4LC4 A;  3RO4 A;  4DC3 A;  3W4S A;  5BYC A;  2V78 A;  1E0D A;  3B1R A;  3LKI A;  1RFV A;  3PZS A;  3RTG A;  5C3Z A;  3NC9 A;  4WJM A;  1WYE A;  1RKD A;  4EUM A;  5A5F A;  2HW1 A;  3FHY A;  2I6A A;  2XPC A;  3RU3 A;  3KD6 A;  2AX3 A;  4GM6 A;  4C12 A;  1TZ3 A;  1EKQ A;  2PKN A;  2VAR A;  2Y1O A;  3RRB A;  1GC5 A;  2JFF A;  3RQQ A;  3DRW A;  2VTE A;  1ESQ A;  4YWR A;  3NL2 A;  2AM2 A;  2I6B A;  4K8K A;  3RQ2 A;  4PVV A;  1TYY A;  3RSQ A;  2X5O A;  1DGM A;  1U2X A;  4N09 A;  1V1B A;  3RPH A;  2VOS A;  1JXI A;  5C40 A;  3HPD A;  1W7K A;  1VI9 A;  1FGS A;  3ZS7 A;  1RKA A;  3QA2 A;  4XF7 A;  2DDW A;  3RRE A;  5BYD A;  3UQD A;  3QAI A;  1EEH A;  3RQ8 A;  3RRF A;  3RTC A;  3NL5 A;  3NM1 A;  2Y67 A;  2A9Y A;  4DU5 A;  3RSS A;  1VM7 A;  2UUO A;  4C5K A;  5B6A A;  1LHP A;  4X8F A;  4EN4 A;  3KTN A;  3NCA A;  5BYF A;  3HYO A;  3FHX A;  4KBE A;  2PKM A;  3RPZ A;  3HJ6 A;  2AB8 A;  1LHR A;  3LK7 A;  1GQQ A;  3RQX A;  4C13 A;  5BYE A;  4LBG A;  1V1A A;  3K9E A;  4KAN A;  2DCN A;  4KAL A;  2JG1 A;  1YHJ A;  1BX4 A;  2JFG A;  3RSF A;  1YGK A;  1JXH A;  2YXT A;  2WTZ A;  3GBU A;  1E8C A;  4CVK A;  5CM5 A;  2DDM A;  3RT9 A;  3KZH A;  4XDA A;  2DDO A;  3NL3 A;  3RY7 A;  2R3E A;  4UBE A;  2VOR A;  5CGA A;  2GCB A;  3B1P A;  3N1C A;  4B8S A;  1L2L A;  2C49 A;  3IN1 A;  4C5J A;  3LJS A;  1RK2 A;  3B1O A;  4LCA A;  4U7X A;  5F11 A;  3H49 A;  1TZ6 A;  3RTD A;  3N2A A;  1KYH A;  2R3B A;  4E8Z A;  2WJP A;  5COJ A;  3MBJ A;  4KAH A;  4JJP A;  4QDI A;  3RM5 A;  3HIC A;  2XTB A;  2PKK A;  4C5M A;  5CGE A;  2JFH A;  3IE7 A;  4K9I A;  2A9Z A;  3RRJ A;  1W78 A;  4K8P A;  5A5E A;  2QCV A;  3UMO A;  2AJP A;  1LII A;  3QCZ A;  1YGJ A;  3NRS A;  5TRW A;  3PYZ A;  2QHP A;  2Y68 A;  1GQT A;  3NL6 A;  4K8C A;  1GQY A;  3IH0 A;  4LBX A;  1ESJ A;  2AM1 A;  2VTD A;  2AJR A;  2NWH A;  4N08 A;  4XF6 A;  4S1H A;  4S1I A;  3ZL8 A;  3BGK A;  4C5L A;  4E69 A;  4UAG A;  5F0Z A;  4XCK A;  1UB0 A;  4O1G A;  3I3Y A;  4YL5 A;  5C41 A;  3IBQ A;  5EYN A;  5EY7 A;  2AFB A;  1LIJ A;  2Y66 A;  4C5N A;  2Q5R A;  2PKF A;  2RBC A;  3DZV A;  3RS8 A;  4EOH A;  4ZIY A;  4O1L A;  2AWD A;  2XJA A;  3RTB A;  2GC6 A;  3ZM6 A;  2JGV A;  2AA0 A;  4S1I B;  1RFU A;  3PL2 A;  1P31 A;  4BUC A;  3MBH A;  5C3Y A;  4E84 A;  3NM3 A;  4B8R A;  3UQ6 A;  3UQE A;  1EKK A;  2UAG A;  2GCA A;  3RTA A;  3KEU A;  1UA4 A;  2JG5 A;  3UAG A;  3B3L A;  3RT7 A;  3GO7 A;  3K5W A;  3OTX A;  1RFT A;  3LHX A;  4JKU A;  4EBU A;  3UMP A;  3B1Q A;  3RSG A;  1GG4 A;  3NBW A;  1TD2 A;  3NC2 A;  2YXU A;  3IQ0 A;  4E3A A;  4E8W A;  4CVM A;  2F02 A;  3UQ9 A;  3RQ5 A;  3UBO A;  2HQQ A;  1C3Q A;  3RQH A;  2ABQ A;  1JBV A;  3JUL A;  3EAG A;  2GC5 A;  1LIK A;  2F7K A;  2F00 A;  4HV4 A;  4CVL A;  1V1S A;  3BF5 A;  4K9C A; 
#chains in the Genus database with same CATH homology
 3VAQ A;  4K93 A;  3RU2 A;  4K8T A;  3NBV A;  5TQI A;  3H74 A;  3RS9 A;  3RTE A;  3EWM A;  3CQD A;  1VK4 A;  4S1M A;  1RKS A;  3VAS A;  1V19 A;  4E8Y A;  4KAD A;  1LIO A;  2FV7 A;  3LOO A;  3Q92 A;  4JKS A;  2I5B A;  3RQ6 A;  3B1N A;  2HLZ A;  3GO6 A;  3Q1Y A;  2C4E A;  3IKH A;  4DC3 A;  4LC4 A;  2ABS A;  3RO4 A;  5BYC A;  3W4S A;  5C3Z A;  2V78 A;  3LKI A;  3B1R A;  3PZS A;  1RFV A;  3RTG A;  3NC9 A;  4WJM A;  1WYE A;  1RKD A;  4EUM A;  2HW1 A;  3FHY A;  2I6A A;  3RU3 A;  3KD6 A;  2AX3 A;  4GM6 A;  1TZ3 A;  1EKQ A;  2PKN A;  2VAR A;  3RRB A;  1GC5 A;  3RQQ A;  3DRW A;  1ESQ A;  4YWR A;  3NL2 A;  4K8K A;  2I6B A;  3RQ2 A;  4PVV A;  1TYY A;  3RSQ A;  4N09 A;  1DGM A;  1U2X A;  1V1B A;  3RPH A;  5C40 A;  1JXI A;  3HPD A;  1VI9 A;  3ZS7 A;  1RKA A;  3QA2 A;  4XF7 A;  2DDW A;  3RRE A;  5BYD A;  3UQD A;  3QAI A;  3RQ8 A;  3RRF A;  3RTC A;  3NL5 A;  3NM1 A;  2A9Y A;  4DU5 A;  3RSS A;  1VM7 A;  4C5K A;  5B6A A;  1LHP A;  4X8F A;  4EN4 A;  3KTN A;  3NCA A;  5BYF A;  3HYO A;  3FHX A;  4KBE A;  2PKM A;  3RPZ A;  3HJ6 A;  2AB8 A;  1LHR A;  3RQX A;  5BYE A;  4LBG A;  1V1A A;  3K9E A;  4KAN A;  2DCN A;  4KAL A;  2JG1 A;  1YHJ A;  1BX4 A;  3RSF A;  1YGK A;  1JXH A;  2YXT A;  3GBU A;  5CM5 A;  2DDM A;  3RT9 A;  3KZH A;  4XDA A;  2DDO A;  3NL3 A;  3RY7 A;  2R3E A;  4UBE A;  5CGA A;  3B1P A;  3N1C A;  4B8S A;  1L2L A;  2C49 A;  3IN1 A;  4C5J A;  3LJS A;  1RK2 A;  3B1O A;  4LCA A;  4U7X A;  5F11 A;  3H49 A;  1TZ6 A;  3RTD A;  1KYH A;  2R3B A;  4E8Z A;  5COJ A;  3MBJ A;  4KAH A;  4JJP A;  3RM5 A;  3HIC A;  2XTB A;  2PKK A;  4C5M A;  5CGE A;  3IE7 A;  4K9I A;  2A9Z A;  3RRJ A;  4K8P A;  2QCV A;  3UMO A;  2AJP A;  1LII A;  5TRW A;  1YGJ A;  2QHP A;  1GQT A;  3NL6 A;  4K8C A;  4LBX A;  3IH0 A;  4N08 A;  1ESJ A;  4XF6 A;  2AJR A;  2NWH A;  4E69 A;  4S1H A;  4S1I A;  5F0Z A;  3BGK A;  4C5L A;  4XCK A;  1UB0 A;  4O1G A;  3I3Y A;  4YL5 A;  5C41 A;  3IBQ A;  5EYN A;  5EY7 A;  2AFB A;  1LIJ A;  4EOH A;  4C5N A;  2Q5R A;  2PKF A;  2RBC A;  3DZV A;  3RS8 A;  4O1L A;  2AWD A;  3RTB A;  2JGV A;  2AA0 A;  4S1I B;  1RFU A;  3PL2 A;  3MBH A;  5C3Y A;  4E84 A;  3NM3 A;  4B8R A;  3UQ6 A;  3UQE A;  1EKK A;  3RTA A;  3KEU A;  1UA4 A;  2JG5 A;  3B3L A;  3RT7 A;  3GO7 A;  3K5W A;  3OTX A;  1RFT A;  3LHX A;  4JKU A;  4EBU A;  3UMP A;  3B1Q A;  3RSG A;  3NC2 A;  3NBW A;  1TD2 A;  2YXU A;  3IQ0 A;  4E3A A;  4E8W A;  2F02 A;  3UQ9 A;  3RQ5 A;  3UBO A;  2HQQ A;  1C3Q A;  3RQH A;  2ABQ A;  3JUL A;  1LIK A;  2F7K A;  1V1S A;  3BF5 A;  4K9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...