2HLZA

Crystal structure of human ketohexokinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
296
Chain Sequence
GSQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human ketohexokinase (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ketohexokinase
total genus 98
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.3: Ketohexokinase.
pdb deposition date 2006-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2hlzA00
4B8SA 1TYYA 3QAIA 3RY7A 3NL2A 1ESJA 2DCNA 1LIKA 4EUMA 2QCVA 4WJMA 3RO4A 4K8KA 4JKSA 3NL6A 4E8YA 1VK4A 5C3ZA 4PVVA 3VAQA 4DC3A 3RQ8A 3UMOA 1V1SA 5EYNA 1LHRA 2ABSA 3IKHA 3NL3A 4EN4A 3NC2A 4B8RA 1RKDA 4N09A 2RBCA 3HPDA 4KAHA 2NWHA 5COJA 3RRFA 2AJRA 3Q92A 1YGKA 4YWRA 3RTBA 1C3QA 5TQIA 4LBGA 2I6AA 2R3EA 1RFUA 3RTCA 3RTEA 4E84A 2ABQA 3B1QA 2AWDA 2Q5RA 5CGAA 4K93A 3EWMA 3RT7A 3MBJA 1V1BA 4K9CA 1TZ6A 3MBHA 3B1PA 3H49A 5TRWA 3NC9A 4XF7A 1RKAA 3FHXA 4XDAA 3RRJA 3IE7A 2DDOA 2F7KA 2JGVA 1EKKA 2I6BA 3GO7A 3B1RA 3KEUA 2PKKA 3BF5A 3BGKA 4UBEA 1UB0A 3RS8A 1V19A 3IBQA 1L2LA 3NBVA 2AX3A 4KALA 3DRWA 1VI9A 4C5LA 3NM1A 1WYEA 2A9YA 1GQTA 4N08A 4U7XA 2AA0A 2JG1A 3RU2A 3JULA 3HYOA 4EBUA 3NM3A 1RFTA 1V1AA 3DZVA 4X8FA 4K8CA 3IH0A 3RTDA 4GM6A 3QA2A 3RQQA 5B6AA 2YXTA 5C3YA 3UQDA 3UQEA 3RQ6A 2V78A 3RQXA 2AFBA 2I5BA 1GC5A 3KZHA 4O1LA 3PZSA 1LIJA 2F02A 3RPHA 5BYDA 4E3AA 5BYEA 3UQ6A 3LOOA 4KADA 3K5WA 3ZS7A 4K9IA 3NL5A 4LCAA 3CQDA 3LHXA 2AJPA 4E69A 3RPZA 1LIIA 2XTBA 3RREA 3RQHA 3RSGA 4XCKA 2C4EA 5CGEA 3RRBA 5EY7A 4C5MA 2HLZA 2C49A 1YGJA 3RS9A 4E8WA 5C41A 4K8TA 3W4SA 3N1CA 3RQ2A 3IQ0A 2R3BA 3I3YA 1ESQA 3VASA 4XF6A 2QHPA 3KTNA 5F0ZA 4K8PA 1DGMA 3IN1A 4S1MA 2HQQA 2FV7A 4S1IB 3NCAA 3OTXA 5BYFA 2AB8A 1LIOA 2PKMA 5C40A 2DDWA 3FHYA 3RSSA 4S1IA 4JKUA 3UBOA 2DDMA 3HICA 1TZ3A 4S1HA 5BYCA 3NBWA 2A9ZA 1BX4A 1U2XA 4JJPA 3UQ9A 4C5NA 4E8ZA 4LBXA 4EOHA 1VM7A 4C5JA 4KANA 3UMPA 4O1GA 1KYHA 2PKNA 3RTAA 1RFVA 3RM5A 2HW1A 2VARA 1UA4A 4LC4A 1RKSA 3GBUA 3LJSA 1JXIA 3LKIA 5CM5A 1YHJA 3RTGA 3RSQA 2YXUA 3RSFA 1LHPA 4C5KA 3K9EA 3KD6A 3B1NA 3PL2A 1TD2A 1EKQA 3B3LA 1JXHA 3GO6A 3H74A 4DU5A 2JG5A 3RT9A 4KBEA 3RU3A 3B1OA 3Q1YA 3RQ5A 5F11A 4YL5A 1RK2A 2PKFA
chains in the Genus database with same CATH superfamily
4B8SA 1TYYA 3QAIA 3RY7A 3NL2A 4CVKA 1ESJA 2DCNA 1LIKA 4EUMA 2QCVA 4WJMA 2JFFA 4K8KA 4JKSA 3NL6A 1O5ZA 3RO4A 3ZM6A 4E8YA 1VK4A 5C3ZA 4PVVA 2X5OA 3VAQA 4DC3A 3RQ8A 3UMOA 1V1SA 5EYNA 1LHRA 2ABSA 3IKHA 3NL3A 4EN4A 3NC2A 4B8RA 1RKDA 2AM1A 2WTZA 4N09A 1E8CA 2RBCA 3HPDA 4KAHA 4QDIA 4BUCA 2NWHA 2WJPA 5COJA 2Y66A 3RRFA 2AJRA 3HJ6A 3Q92A 1YGKA 4YWRA 3RTBA 1C3QA 1W78A 5TQIA 4LBGA 2I6AA 2R3EA 5BYCA 1RFUA 2UUOA 2UUPA 3RTEA 3RTCA 4E84A 2ABQA 1JBWA 1GQQA 3B1QA 1JBVA 2AWDA 2Q5RA 4K93A 3EWMA 2GC5A 1P3DA 3RT7A 5CGAA 3MBJA 1V1BA 4K9CA 1TZ6A 3MBHA 3B1PA 3H49A 1P31A 1E0DA 3NC9A 4XF7A 5TRWA 1RKAA 3HN7A 3FHXA 2GC6A 4XDAA 3RRJA 2VTEA 2DDOA 2F7KA 2JGVA 1EKKA 2I6BA 3GO7A 3B1RA 3IE7A 2PKKA 3BF5A 3BGKA 3KEUA 1UB0A 4UBEA 3QCZA 3RS8A 1V19A 2Y1OA 3IBQA 1L2LA 3NBVA 4KALA 3DRWA 1VI9A 4C5LA 3NM1A 1WYEA 2A9YA 1GQTA 4N08A 4U7XA 2AA0A 2JG1A 4UAGA 3RU2A 3JULA 3HYOA 4EBUA 3NM3A 1RFTA 2VTDA 1V1AA 5A5EA 3DZVA 4X8FA 4K8CA 3IH0A 3RTDA 4GM6A 3QA2A 1GQYA 3RQQA 5B6AA 2YXTA 5A5FA 5C3YA 3UQDA 4C12A 3UQEA 3RQ6A 2V78A 3RQXA 2F00A 2AFBA 2I5BA 1GC5A 3KZHA 2Y68A 3PZSA 1LIJA 2F02A 4O1LA 3RPHA 3ZL8A 4E3AA 5BYEA 1J6UA 5BYDA 2PKFA 3LOOA 3K5WA 4KADA 3ZS7A 4K9IA 3NL5A 4LCAA 3CQDA 3LHXA 2AJPA 4E69A 3RPZA 1LIIA 2XTBA 4QF5A 3RREA 3RQHA 3RSGA 4XCKA 2C4EA 5CGEA 3NRSA 3RRBA 5EY7A 4C5MA 2HLZA 1EEHA 2C49A 1YGJA 3RS9A 3ZM5A 4E8WA 5C41A 4K8TA 3W4SA 3N1CA 3RQ2A 3IQ0A 2R3BA 2UAGA 1ESQA 2VORA 3I3YA 2QHPA 3KTNA 4XF6A 3VASA 5F0ZA 4K8PA 2XJAA 2XPCA 4C13A 1DGMA 3IN1A 4S1MA 2HQQA 2FV7A 4S1IB 3N2AA 4CVMA 1W7KA 2AM2A 3NCAA 3OTXA 5BYFA 2AB8A 1LIOA 2PKMA 3PYZA 5C40A 2DDWA 3EAGA 3FHYA 3LK7A 4JKUA 4S1IA 3RSSA 2DDMA 3UBOA 3HICA 1TZ3A 2GCBA 4S1HA 3NBWA 2A9ZA 1BX4A 1U2XA 4JJPA 3UQ9A 4ZIYA 4C5NA 4LBXA 4E8ZA 1VM7A 4EOHA 4C5JA 4KANA 2JFHA 4O1GA 3UMPA 1KYHA 2PKNA 3RTAA 1RFVA 3RM5A 2HW1A 2VARA 1UA4A 4LC4A 1GG4A 1RKSA 3GBUA 2JFGA 3LJSA 4BUBA 1JXIA 3LKIA 2VOSA 5CM5A 2Y67A 1YHJA 4CVLA 2GCAA 3RTGA 3RSQA 2YXUA 3RSFA 1UAGA 1FGSA 1LHPA 3UQ6A 4C5KA 3K9EA 3KD6A 3B1NA 3PL2A 1TD2A 1EKQA 3B3LA 1JXHA 3GO6A 3H74A 3UAGA 2JG5A 4DU5A 3RT9A 4HV4A 4KBEA 3RU3A 3B1OA 3Q1YA 3RQ5A 5F11A 4YL5A 1RK2A 2AX3A
chains in the Genus database with same CATH topology
4B8SA 1TYYA 3QAIA 3RY7A 3NL2A 1ESJA 2DCNA 1LIKA 4EUMA 2QCVA 4WJMA 3RO4A 4K8KA 4JKSA 3NL6A 4E8YA 1VK4A 5C3ZA 4PVVA 3VAQA 4DC3A 3RQ8A 3UMOA 1V1SA 5EYNA 1LHRA 2ABSA 3IKHA 3NL3A 4EN4A 3NC2A 4B8RA 1RKDA 4N09A 2RBCA 3HPDA 4KAHA 2NWHA 5COJA 3RRFA 2AJRA 3HJ6A 3Q92A 1YGKA 4YWRA 3RTBA 1C3QA 5TQIA 4LBGA 2I6AA 2R3EA 1RFUA 3RTCA 3RTEA 4E84A 2ABQA 3B1QA 2AWDA 2Q5RA 5CGAA 4K93A 3EWMA 3RT7A 3MBJA 1V1BA 4K9CA 1TZ6A 3MBHA 3B1PA 3H49A 5TRWA 3NC9A 4XF7A 1RKAA 3FHXA 4XDAA 3RRJA 3IE7A 2DDOA 2F7KA 2JGVA 1EKKA 2I6BA 3GO7A 3B1RA 3KEUA 2PKKA 3BF5A 3BGKA 4UBEA 1UB0A 3RS8A 1V19A 3IBQA 1L2LA 3NBVA 2AX3A 4KALA 3DRWA 1VI9A 4C5LA 3NM1A 1WYEA 2A9YA 1GQTA 4N08A 4U7XA 2AA0A 2JG1A 3RU2A 3JULA 3HYOA 4EBUA 3NM3A 1RFTA 1V1AA 3DZVA 4X8FA 4K8CA 3IH0A 3RTDA 4GM6A 3QA2A 3RQQA 5B6AA 2YXTA 5C3YA 3UQDA 3UQEA 3RQ6A 2V78A 3RQXA 2AFBA 2I5BA 1GC5A 3KZHA 4O1LA 3PZSA 1LIJA 2F02A 3RPHA 5BYDA 4E3AA 5BYEA 3UQ6A 3LOOA 4KADA 3K5WA 3ZS7A 4K9IA 3NL5A 4LCAA 3CQDA 3LHXA 2AJPA 4E69A 3RPZA 1LIIA 2XTBA 3RREA 3RQHA 3RSGA 4XCKA 2C4EA 5CGEA 3RRBA 5EY7A 4C5MA 2HLZA 2C49A 1YGJA 3RS9A 4E8WA 5C41A 4K8TA 3W4SA 3N1CA 3RQ2A 3IQ0A 2R3BA 3I3YA 1ESQA 3VASA 4XF6A 2QHPA 3KTNA 5F0ZA 4K8PA 1DGMA 3IN1A 4S1MA 2HQQA 2FV7A 4S1IB 3NCAA 3OTXA 5BYFA 2AB8A 1LIOA 2PKMA 5C40A 2DDWA 3FHYA 3RSSA 4S1IA 4JKUA 3UBOA 2DDMA 3HICA 1TZ3A 4S1HA 5BYCA 3NBWA 2A9ZA 1BX4A 1U2XA 4JJPA 3UQ9A 4C5NA 4E8ZA 4LBXA 4EOHA 1VM7A 4C5JA 4KANA 3UMPA 4O1GA 1KYHA 2PKNA 3RTAA 1RFVA 3RM5A 2HW1A 2VARA 1UA4A 4LC4A 1RKSA 3GBUA 3LJSA 1JXIA 3LKIA 5CM5A 1YHJA 3RTGA 3RSQA 2YXUA 3RSFA 1LHPA 4C5KA 3K9EA 3KD6A 3B1NA 3PL2A 1TD2A 1EKQA 3B3LA 1JXHA 3GO6A 3H74A 4DU5A 2JG5A 3RT9A 4KBEA 3RU3A 3B1OA 3Q1YA 3RQ5A 5F11A 4YL5A 1RK2A 2PKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8S A;  1TYY A;  3QAI A;  3RY7 A;  3NL2 A;  1ESJ A;  2DCN A;  1LIK A;  4EUM A;  2QCV A;  4WJM A;  3RO4 A;  4K8K A;  4JKS A;  3NL6 A;  4E8Y A;  1VK4 A;  5C3Z A;  4PVV A;  3VAQ A;  4DC3 A;  3RQ8 A;  3UMO A;  1V1S A;  5EYN A;  1LHR A;  2ABS A;  3IKH A;  3NL3 A;  4EN4 A;  3NC2 A;  4B8R A;  1RKD A;  4N09 A;  2RBC A;  3HPD A;  4KAH A;  2NWH A;  5COJ A;  3RRF A;  2AJR A;  3Q92 A;  1YGK A;  4YWR A;  3RTB A;  1C3Q A;  5TQI A;  4LBG A;  2I6A A;  2R3E A;  1RFU A;  3RTC A;  3RTE A;  4E84 A;  2ABQ A;  3B1Q A;  2AWD A;  2Q5R A;  5CGA A;  4K93 A;  3EWM A;  3RT7 A;  3MBJ A;  1V1B A;  4K9C A;  1TZ6 A;  3MBH A;  3B1P A;  3H49 A;  5TRW A;  3NC9 A;  4XF7 A;  1RKA A;  3FHX A;  4XDA A;  3RRJ A;  3IE7 A;  2DDO A;  2F7K A;  2JGV A;  1EKK A;  2I6B A;  3GO7 A;  3B1R A;  3KEU A;  2PKK A;  3BF5 A;  3BGK A;  4UBE A;  1UB0 A;  3RS8 A;  1V19 A;  3IBQ A;  1L2L A;  3NBV A;  2AX3 A;  4KAL A;  3DRW A;  1VI9 A;  4C5L A;  3NM1 A;  1WYE A;  2A9Y A;  1GQT A;  4N08 A;  4U7X A;  2AA0 A;  2JG1 A;  3RU2 A;  3JUL A;  3HYO A;  4EBU A;  3NM3 A;  1RFT A;  1V1A A;  3DZV A;  4X8F A;  4K8C A;  3IH0 A;  3RTD A;  4GM6 A;  3QA2 A;  3RQQ A;  5B6A A;  2YXT A;  5C3Y A;  3UQD A;  3UQE A;  3RQ6 A;  2V78 A;  3RQX A;  2AFB A;  2I5B A;  1GC5 A;  3KZH A;  4O1L A;  3PZS A;  1LIJ A;  2F02 A;  3RPH A;  5BYD A;  4E3A A;  5BYE A;  3UQ6 A;  3LOO A;  4KAD A;  3K5W A;  3ZS7 A;  4K9I A;  3NL5 A;  4LCA A;  3CQD A;  3LHX A;  2AJP A;  4E69 A;  3RPZ A;  1LII A;  2XTB A;  3RRE A;  3RQH A;  3RSG A;  4XCK A;  2C4E A;  5CGE A;  3RRB A;  5EY7 A;  4C5M A;  2HLZ A;  2C49 A;  1YGJ A;  3RS9 A;  4E8W A;  5C41 A;  4K8T A;  3W4S A;  3N1C A;  3RQ2 A;  3IQ0 A;  2R3B A;  3I3Y A;  1ESQ A;  3VAS A;  4XF6 A;  2QHP A;  3KTN A;  5F0Z A;  4K8P A;  1DGM A;  3IN1 A;  4S1M A;  2HQQ A;  2FV7 A;  4S1I B;  3NCA A;  3OTX A;  5BYF A;  2AB8 A;  1LIO A;  2PKM A;  5C40 A;  2DDW A;  3FHY A;  3RSS A;  4S1I A;  4JKU A;  3UBO A;  2DDM A;  3HIC A;  1TZ3 A;  4S1H A;  5BYC A;  3NBW A;  2A9Z A;  1BX4 A;  1U2X A;  4JJP A;  3UQ9 A;  4C5N A;  4E8Z A;  4LBX A;  4EOH A;  1VM7 A;  4C5J A;  4KAN A;  3UMP A;  4O1G A;  1KYH A;  2PKN A;  3RTA A;  1RFV A;  3RM5 A;  2HW1 A;  2VAR A;  1UA4 A;  4LC4 A;  1RKS A;  3GBU A;  3LJS A;  1JXI A;  3LKI A;  5CM5 A;  1YHJ A;  3RTG A;  3RSQ A;  2YXU A;  3RSF A;  1LHP A;  4C5K A;  3K9E A;  3KD6 A;  3B1N A;  3PL2 A;  1TD2 A;  1EKQ A;  3B3L A;  1JXH A;  3GO6 A;  3H74 A;  4DU5 A;  2JG5 A;  3RT9 A;  4KBE A;  3RU3 A;  3B1O A;  3Q1Y A;  3RQ5 A;  5F11 A;  4YL5 A;  1RK2 A;  2PKF A; 
#chains in the Genus database with same CATH topology
 4B8S A;  1TYY A;  3QAI A;  3RY7 A;  3NL2 A;  4CVK A;  1ESJ A;  2DCN A;  1LIK A;  4EUM A;  2QCV A;  4WJM A;  2JFF A;  4K8K A;  4JKS A;  3NL6 A;  1O5Z A;  3RO4 A;  3ZM6 A;  4E8Y A;  1VK4 A;  5C3Z A;  4PVV A;  2X5O A;  3VAQ A;  4DC3 A;  3RQ8 A;  3UMO A;  1V1S A;  5EYN A;  1LHR A;  2ABS A;  3IKH A;  3NL3 A;  4EN4 A;  3NC2 A;  4B8R A;  1RKD A;  2AM1 A;  2WTZ A;  4N09 A;  1E8C A;  2RBC A;  3HPD A;  4KAH A;  4QDI A;  4BUC A;  2NWH A;  2WJP A;  5COJ A;  2Y66 A;  3RRF A;  2AJR A;  3HJ6 A;  3Q92 A;  1YGK A;  4YWR A;  3RTB A;  1C3Q A;  1W78 A;  5TQI A;  4LBG A;  2I6A A;  2R3E A;  5BYC A;  1RFU A;  2UUO A;  2UUP A;  3RTE A;  3RTC A;  4E84 A;  2ABQ A;  1JBW A;  1GQQ A;  3B1Q A;  1JBV A;  2AWD A;  2Q5R A;  4K93 A;  3EWM A;  2GC5 A;  1P3D A;  3RT7 A;  5CGA A;  3MBJ A;  1V1B A;  4K9C A;  1TZ6 A;  3MBH A;  3B1P A;  3H49 A;  1P31 A;  1E0D A;  3NC9 A;  4XF7 A;  5TRW A;  1RKA A;  3HN7 A;  3FHX A;  2GC6 A;  4XDA A;  3RRJ A;  2VTE A;  2DDO A;  2F7K A;  2JGV A;  1EKK A;  2I6B A;  3GO7 A;  3B1R A;  3IE7 A;  2PKK A;  3BF5 A;  3BGK A;  3KEU A;  1UB0 A;  4UBE A;  3QCZ A;  3RS8 A;  1V19 A;  2Y1O A;  3IBQ A;  1L2L A;  3NBV A;  4KAL A;  3DRW A;  1VI9 A;  4C5L A;  3NM1 A;  1WYE A;  2A9Y A;  1GQT A;  4N08 A;  4U7X A;  2AA0 A;  2JG1 A;  4UAG A;  3RU2 A;  3JUL A;  3HYO A;  4EBU A;  3NM3 A;  1RFT A;  2VTD A;  1V1A A;  5A5E A;  3DZV A;  4X8F A;  4K8C A;  3IH0 A;  3RTD A;  4GM6 A;  3QA2 A;  1GQY A;  3RQQ A;  5B6A A;  2YXT A;  5A5F A;  5C3Y A;  3UQD A;  4C12 A;  3UQE A;  3RQ6 A;  2V78 A;  3RQX A;  2F00 A;  2AFB A;  2I5B A;  1GC5 A;  3KZH A;  2Y68 A;  3PZS A;  1LIJ A;  2F02 A;  4O1L A;  3RPH A;  3ZL8 A;  4E3A A;  5BYE A;  1J6U A;  5BYD A;  2PKF A;  3LOO A;  3K5W A;  4KAD A;  3ZS7 A;  4K9I A;  3NL5 A;  4LCA A;  3CQD A;  3LHX A;  2AJP A;  4E69 A;  3RPZ A;  1LII A;  2XTB A;  4QF5 A;  3RRE A;  3RQH A;  3RSG A;  4XCK A;  2C4E A;  5CGE A;  3NRS A;  3RRB A;  5EY7 A;  4C5M A;  2HLZ A;  1EEH A;  2C49 A;  1YGJ A;  3RS9 A;  3ZM5 A;  4E8W A;  5C41 A;  4K8T A;  3W4S A;  3N1C A;  3RQ2 A;  3IQ0 A;  2R3B A;  2UAG A;  1ESQ A;  2VOR A;  3I3Y A;  2QHP A;  3KTN A;  4XF6 A;  3VAS A;  5F0Z A;  4K8P A;  2XJA A;  2XPC A;  4C13 A;  1DGM A;  3IN1 A;  4S1M A;  2HQQ A;  2FV7 A;  4S1I B;  3N2A A;  4CVM A;  1W7K A;  2AM2 A;  3NCA A;  3OTX A;  5BYF A;  2AB8 A;  1LIO A;  2PKM A;  3PYZ A;  5C40 A;  2DDW A;  3EAG A;  3FHY A;  3LK7 A;  4JKU A;  4S1I A;  3RSS A;  2DDM A;  3UBO A;  3HIC A;  1TZ3 A;  2GCB A;  4S1H A;  3NBW A;  2A9Z A;  1BX4 A;  1U2X A;  4JJP A;  3UQ9 A;  4ZIY A;  4C5N A;  4LBX A;  4E8Z A;  1VM7 A;  4EOH A;  4C5J A;  4KAN A;  2JFH A;  4O1G A;  3UMP A;  1KYH A;  2PKN A;  3RTA A;  1RFV A;  3RM5 A;  2HW1 A;  2VAR A;  1UA4 A;  4LC4 A;  1GG4 A;  1RKS A;  3GBU A;  2JFG A;  3LJS A;  4BUB A;  1JXI A;  3LKI A;  2VOS A;  5CM5 A;  2Y67 A;  1YHJ A;  4CVL A;  2GCA A;  3RTG A;  3RSQ A;  2YXU A;  3RSF A;  1UAG A;  1FGS A;  1LHP A;  3UQ6 A;  4C5K A;  3K9E A;  3KD6 A;  3B1N A;  3PL2 A;  1TD2 A;  1EKQ A;  3B3L A;  1JXH A;  3GO6 A;  3H74 A;  3UAG A;  2JG5 A;  4DU5 A;  3RT9 A;  4HV4 A;  4KBE A;  3RU3 A;  3B1O A;  3Q1Y A;  3RQ5 A;  5F11 A;  4YL5 A;  1RK2 A;  2AX3 A; 
#chains in the Genus database with same CATH homology
 4B8S A;  1TYY A;  3QAI A;  3RY7 A;  3NL2 A;  1ESJ A;  2DCN A;  1LIK A;  4EUM A;  2QCV A;  4WJM A;  3RO4 A;  4K8K A;  4JKS A;  3NL6 A;  4E8Y A;  1VK4 A;  5C3Z A;  4PVV A;  3VAQ A;  4DC3 A;  3RQ8 A;  3UMO A;  1V1S A;  5EYN A;  1LHR A;  2ABS A;  3IKH A;  3NL3 A;  4EN4 A;  3NC2 A;  4B8R A;  1RKD A;  4N09 A;  2RBC A;  3HPD A;  4KAH A;  2NWH A;  5COJ A;  3RRF A;  2AJR A;  3HJ6 A;  3Q92 A;  1YGK A;  4YWR A;  3RTB A;  1C3Q A;  5TQI A;  4LBG A;  2I6A A;  2R3E A;  1RFU A;  3RTC A;  3RTE A;  4E84 A;  2ABQ A;  3B1Q A;  2AWD A;  2Q5R A;  5CGA A;  4K93 A;  3EWM A;  3RT7 A;  3MBJ A;  1V1B A;  4K9C A;  1TZ6 A;  3MBH A;  3B1P A;  3H49 A;  5TRW A;  3NC9 A;  4XF7 A;  1RKA A;  3FHX A;  4XDA A;  3RRJ A;  3IE7 A;  2DDO A;  2F7K A;  2JGV A;  1EKK A;  2I6B A;  3GO7 A;  3B1R A;  3KEU A;  2PKK A;  3BF5 A;  3BGK A;  4UBE A;  1UB0 A;  3RS8 A;  1V19 A;  3IBQ A;  1L2L A;  3NBV A;  2AX3 A;  4KAL A;  3DRW A;  1VI9 A;  4C5L A;  3NM1 A;  1WYE A;  2A9Y A;  1GQT A;  4N08 A;  4U7X A;  2AA0 A;  2JG1 A;  3RU2 A;  3JUL A;  3HYO A;  4EBU A;  3NM3 A;  1RFT A;  1V1A A;  3DZV A;  4X8F A;  4K8C A;  3IH0 A;  3RTD A;  4GM6 A;  3QA2 A;  3RQQ A;  5B6A A;  2YXT A;  5C3Y A;  3UQD A;  3UQE A;  3RQ6 A;  2V78 A;  3RQX A;  2AFB A;  2I5B A;  1GC5 A;  3KZH A;  4O1L A;  3PZS A;  1LIJ A;  2F02 A;  3RPH A;  5BYD A;  4E3A A;  5BYE A;  3UQ6 A;  3LOO A;  4KAD A;  3K5W A;  3ZS7 A;  4K9I A;  3NL5 A;  4LCA A;  3CQD A;  3LHX A;  2AJP A;  4E69 A;  3RPZ A;  1LII A;  2XTB A;  3RRE A;  3RQH A;  3RSG A;  4XCK A;  2C4E A;  5CGE A;  3RRB A;  5EY7 A;  4C5M A;  2HLZ A;  2C49 A;  1YGJ A;  3RS9 A;  4E8W A;  5C41 A;  4K8T A;  3W4S A;  3N1C A;  3RQ2 A;  3IQ0 A;  2R3B A;  3I3Y A;  1ESQ A;  3VAS A;  4XF6 A;  2QHP A;  3KTN A;  5F0Z A;  4K8P A;  1DGM A;  3IN1 A;  4S1M A;  2HQQ A;  2FV7 A;  4S1I B;  3NCA A;  3OTX A;  5BYF A;  2AB8 A;  1LIO A;  2PKM A;  5C40 A;  2DDW A;  3FHY A;  3RSS A;  4S1I A;  4JKU A;  3UBO A;  2DDM A;  3HIC A;  1TZ3 A;  4S1H A;  5BYC A;  3NBW A;  2A9Z A;  1BX4 A;  1U2X A;  4JJP A;  3UQ9 A;  4C5N A;  4E8Z A;  4LBX A;  4EOH A;  1VM7 A;  4C5J A;  4KAN A;  3UMP A;  4O1G A;  1KYH A;  2PKN A;  3RTA A;  1RFV A;  3RM5 A;  2HW1 A;  2VAR A;  1UA4 A;  4LC4 A;  1RKS A;  3GBU A;  3LJS A;  1JXI A;  3LKI A;  5CM5 A;  1YHJ A;  3RTG A;  3RSQ A;  2YXU A;  3RSF A;  1LHP A;  4C5K A;  3K9E A;  3KD6 A;  3B1N A;  3PL2 A;  1TD2 A;  1EKQ A;  3B3L A;  1JXH A;  3GO6 A;  3H74 A;  4DU5 A;  2JG5 A;  3RT9 A;  4KBE A;  3RU3 A;  3B1O A;  3Q1Y A;  3RQ5 A;  5F11 A;  4YL5 A;  1RK2 A;  2PKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...