2HLZA

Crystal structure of human ketohexokinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
296
Chain Sequence
GSQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human ketohexokinase (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ketohexokinase
total genus 98
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.3: Ketohexokinase.
pdb deposition date 2006-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2hlzA00
3GO6A 3FHXA 3RQ5A 4X8FA 2I6BA 3RT7A 2AFBA 2PKKA 3VAQA 4E8WA 3MBHA 3NL2A 4N09A 3QAIA 4C5JA 3LHXA 3RQ6A 2RBCA 2I6AA 4KAHA 2A9YA 3RM5A 3IE7A 5CGAA 4EN4A 4E84A 3NM3A 3RSQA 4EBUA 1C3QA 4KADA 4JKSA 2HW1A 1V1AA 1TD2A 3K9EA 5B6AA 1WYEA 4C5MA 3UMPA 3HICA 2AX3A 2AB8A 2FV7A 3QA2A 1KYHA 3RSGA 1RKSA 3W4SA 2PKNA 3I3YA 4K9CA 4O1LA 4S1IA 3B1RA 3K5WA 4UBEA 1V19A 3KTNA 3NCAA 3H49A 3CQDA 1RK2A 3RO4A 2DDWA 1U2XA 3B1NA 4KALA 3RQ2A 5EY7A 3RY7A 4JJPA 3RS9A 2ABQA 2C49A 1GQTA 1YGJA 3NBWA 4LBXA 2AJRA 1EKQA 4C5LA 1GC5A 2C4EA 5C3ZA 3RU3A 4K8KA 3LKIA 4XF6A 4C5KA 4E69A 5BYFA 3DRWA 3GBUA 4WJMA 2ABSA 4S1IB 5C3YA 3RTGA 2R3EA 3DZVA 3N1CA 2AWDA 3RTAA 5BYDA 3RRJA 4JKUA 2QCVA 4LBGA 3JULA 3KEUA 2YXUA 3RU2A 2R3BA 4LCAA 4O1GA 4DU5A 3IBQA 1YHJA 1LHRA 3NL6A 2HLZA 2JG1A 3UQ6A 2F7KA 2JG5A 2PKFA 2YXTA 3H74A 3NM1A 3LJSA 3RREA 3MBJA 3RTBA 4S1HA 5F11A 3BGKA 1VM7A 3NL5A 3ZS7A 3BF5A 3RRBA 3RQ8A 2JGVA 4N08A 1ESJA 3PZSA 4E8ZA 3KD6A 1LIKA 4K93A 1TZ3A 4LC4A 3RQQA 1V1SA 2NWHA 5COJA 3RRFA 3UBOA 4K8CA 3IKHA 4K8PA 1UB0A 2AA0A 5C41A 3LOOA 3HPDA 4E8YA 3EWMA 4EUMA 5BYCA 1YGKA 5CM5A 3B1QA 1RFUA 1BX4A 4K9IA 3FHYA 2F02A 3B1PA 5CGEA 2DDMA 3RSFA 4GM6A 4KANA 3RPZA 2HQQA 5TRWA 4EOHA 2A9ZA 2PKMA 2DCNA 5C40A 1RKAA 5F0ZA 3Q92A 2Q5RA 1VK4A 3RPHA 1TYYA 1UA4A 4XCKA 3UMOA 3IQ0A 3UQEA 4U7XA 4C5NA 1LHPA 2I5BA 3GO7A 1DGMA 3B1OA 1RFVA 3RTEA 3NC9A 4YL5A 3NL3A 3RSSA 2XTBA 3UQ9A 4B8SA 3RQXA 3PL2A 1LIJA 2AJPA 1L2LA 4YWRA 3OTXA 1JXIA 4S1MA 4B8RA 1ESQA 3IN1A 3Q1YA 3RT9A 1VI9A 3RQHA 1V1BA 2DDOA 1EKKA 1LIIA 3KZHA 3RTCA 4PVVA 5BYEA 5TQIA 3NBVA 3RTDA 3VASA 3HYOA 3B3LA 1TZ6A 5EYNA 2V78A 3IH0A 2VARA 1LIOA 3RS8A 4DC3A 4K8TA 1JXHA 4KBEA 4E3AA 2QHPA 4XDAA 4XF7A 1RFTA 3UQDA 3NC2A 1RKDA
chains in the Genus database with same CATH superfamily
3GO6A 4CVKA 3FHXA 3RQ5A 4X8FA 2I6BA 3RT7A 2AFBA 2PKKA 3NRSA 3VAQA 3MBHA 4E8WA 3NL2A 4N09A 3QAIA 4C5JA 2VORA 2XJAA 3LHXA 2RBCA 2I6AA 3RQ6A 4KAHA 2A9YA 3RM5A 2GC5A 3IE7A 5CGAA 1P3DA 4EN4A 4E84A 1FGSA 2VOSA 3NM3A 3RSQA 4EBUA 1C3QA 4KADA 4JKSA 2HW1A 1V1AA 1TD2A 3K9EA 4QDIA 5B6AA 1WYEA 2UUPA 4C5MA 3UMPA 3HICA 2AX3A 2AB8A 2FV7A 3QA2A 1KYHA 3RSGA 1RKSA 2JFGA 1E0DA 2PKNA 3I3YA 4K9CA 4O1LA 3W4SA 4S1IA 3B1RA 3K5WA 3HN7A 4UBEA 1V19A 3KTNA 2GC6A 2Y67A 3NCAA 3QCZA 2GCAA 3CQDA 3H49A 1RK2A 3RO4A 2DDWA 1E8CA 1U2XA 2JFFA 3B1NA 4KALA 5EY7A 3RQ2A 2JFHA 4JJPA 1JBWA 3RS9A 2ABQA 3RY7A 2C49A 1GQTA 1YGJA 3NBWA 4LBXA 2AJRA 1EKQA 3UAGA 4BUCA 4C5LA 1GC5A 2C4EA 5C3ZA 3RU3A 2AM1A 4K8KA 3LKIA 4XF6A 4C5KA 4E69A 1W7KA 3DRWA 2Y1OA 3GBUA 2ABSA 4S1IB 4UAGA 4WJMA 3RTGA 2R3EA 4BUBA 3DZVA 2XPCA 2AWDA 3N1CA 1JBVA 3RTAA 5BYDA 3RRJA 4JKUA 1P31A 2X5OA 4CVMA 2QCVA 4LBGA 3JULA 3KEUA 2YXUA 3RU2A 2R3BA 4LCAA 4O1GA 4DU5A 3IBQA 1W78A 1YHJA 1LHRA 3NL6A 2Y68A 2HLZA 4ZIYA 2JG1A 3UQ6A 2F7KA 2JG5A 2PKFA 2YXTA 1O5ZA 3H74A 3LJSA 3NM1A 3RREA 3MBJA 3RTBA 4C13A 4S1HA 3LK7A 5F11A 3BGKA 1VM7A 3NL5A 3ZS7A 3BF5A 3RRBA 3RQ8A 1UAGA 2JGVA 4N08A 1J6UA 1ESJA 3N2AA 3PZSA 4E8ZA 1GQYA 3KD6A 1LIKA 3EAGA 4K93A 1TZ3A 4C12A 4LC4A 3RQQA 1V1SA 2NWHA 5COJA 3RRFA 3UBOA 2AM2A 4K8CA 3IKHA 4K8PA 1UB0A 2AA0A 2VTDA 3LOOA 3HPDA 4E8YA 3EWMA 4EUMA 4HV4A 5BYCA 1YGKA 5C41A 5CM5A 3B1QA 1RFUA 5A5EA 1BX4A 4K9IA 5BYFA 3FHYA 2F02A 4QF5A 3B1PA 5C3YA 5CGEA 2DDMA 3PYZA 3RSFA 4GM6A 4KANA 3RPZA 2HQQA 5TRWA 4EOHA 2A9ZA 2PKMA 2DCNA 5C40A 1RKAA 5F0ZA 3Q92A 2Q5RA 1VK4A 3ZL8A 3RPHA 1TYYA 1UA4A 2VTEA 2WTZA 4XCKA 3UMOA 3IQ0A 3UQEA 4U7XA 4C5NA 2Y66A 1LHPA 2I5BA 3GO7A 1DGMA 3B1OA 2GCBA 3HJ6A 1RFVA 3RTEA 3ZM5A 4CVLA 1GQQA 3NC9A 2UAGA 4YL5A 3NL3A 3RSSA 2XTBA 3UQ9A 4B8SA 3RQXA 3PL2A 1LIJA 3ZM6A 2AJPA 1L2LA 4YWRA 3OTXA 1JXIA 4S1MA 4B8RA 1ESQA 3IN1A 3Q1YA 3RT9A 1VI9A 3RQHA 1V1BA 2DDOA 1EKKA 1LIIA 2WJPA 3KZHA 3RTCA 4PVVA 5BYEA 5TQIA 2UUOA 3NBVA 3RTDA 3VASA 3HYOA 1GG4A 1TZ6A 3B3LA 5EYNA 2V78A 2F00A 3IH0A 2VARA 1LIOA 3RS8A 4DC3A 4K8TA 5A5FA 1JXHA 4KBEA 4E3AA 2QHPA 4XDAA 4XF7A 1EEHA 1RFTA 3UQDA 3NC2A 1RKDA
chains in the Genus database with same CATH topology
3GO6A 3FHXA 3RQ5A 4X8FA 2I6BA 3RT7A 2AFBA 2PKKA 3VAQA 4E8WA 3MBHA 3NL2A 4N09A 3QAIA 4C5JA 3LHXA 3RQ6A 2RBCA 2I6AA 4KAHA 2A9YA 3RM5A 3IE7A 5CGAA 4EN4A 4E84A 3NM3A 3RSQA 4EBUA 1C3QA 4KADA 4JKSA 2HW1A 1V1AA 1TD2A 3K9EA 5B6AA 1WYEA 4C5MA 3UMPA 3HICA 2AX3A 2AB8A 2FV7A 3QA2A 1KYHA 3RSGA 1RKSA 3W4SA 2PKNA 3I3YA 4K9CA 4O1LA 4S1IA 3B1RA 3K5WA 4UBEA 1V19A 3KTNA 3NCAA 3H49A 3CQDA 1RK2A 3RO4A 2DDWA 1U2XA 3B1NA 4KALA 3RQ2A 5EY7A 3RY7A 4JJPA 3RS9A 2ABQA 2C49A 1GQTA 1YGJA 3NBWA 4LBXA 2AJRA 1EKQA 4C5LA 1GC5A 2C4EA 5C3ZA 3RU3A 4K8KA 3LKIA 4XF6A 4C5KA 4E69A 5BYFA 3DRWA 3GBUA 4WJMA 2ABSA 4S1IB 5C3YA 3RTGA 2R3EA 3DZVA 3N1CA 2AWDA 3RTAA 5BYDA 3RRJA 4JKUA 2QCVA 4LBGA 3JULA 3KEUA 2YXUA 3RU2A 2R3BA 4LCAA 4O1GA 4DU5A 3IBQA 1YHJA 1LHRA 3NL6A 2HLZA 2JG1A 3UQ6A 2F7KA 2JG5A 2PKFA 2YXTA 3H74A 3NM1A 3LJSA 3RREA 3MBJA 3RTBA 4S1HA 5F11A 3BGKA 1VM7A 3NL5A 3ZS7A 3BF5A 3RRBA 3RQ8A 2JGVA 4N08A 1ESJA 3PZSA 4E8ZA 3KD6A 1LIKA 4K93A 1TZ3A 4LC4A 3RQQA 1V1SA 2NWHA 5COJA 3RRFA 3UBOA 4K8CA 3IKHA 4K8PA 1UB0A 2AA0A 5C41A 3LOOA 3HPDA 4E8YA 3EWMA 4EUMA 5BYCA 1YGKA 5CM5A 3B1QA 1RFUA 1BX4A 4K9IA 3FHYA 2F02A 3B1PA 5CGEA 2DDMA 3RSFA 4GM6A 4KANA 3RPZA 2HQQA 5TRWA 4EOHA 2A9ZA 2PKMA 2DCNA 5C40A 1RKAA 5F0ZA 3Q92A 2Q5RA 1VK4A 3RPHA 1TYYA 1UA4A 4XCKA 3UMOA 3IQ0A 3UQEA 4U7XA 4C5NA 1LHPA 2I5BA 3GO7A 1DGMA 3B1OA 3HJ6A 1RFVA 3RTEA 3NC9A 4YL5A 3NL3A 3RSSA 2XTBA 3UQ9A 4B8SA 3RQXA 3PL2A 1LIJA 2AJPA 1L2LA 4YWRA 3OTXA 1JXIA 4S1MA 4B8RA 1ESQA 3IN1A 3Q1YA 3RT9A 1VI9A 3RQHA 1V1BA 2DDOA 1EKKA 1LIIA 3KZHA 3RTCA 4PVVA 5BYEA 5TQIA 3NBVA 3RTDA 3VASA 3HYOA 3B3LA 1TZ6A 5EYNA 2V78A 3IH0A 2VARA 1LIOA 3RS8A 4DC3A 4K8TA 1JXHA 4KBEA 4E3AA 2QHPA 4XDAA 4XF7A 1RFTA 3UQDA 3NC2A 1RKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO6 A;  3FHX A;  3RQ5 A;  4X8F A;  2I6B A;  3RT7 A;  2AFB A;  2PKK A;  3VAQ A;  4E8W A;  3MBH A;  3NL2 A;  4N09 A;  3QAI A;  4C5J A;  3LHX A;  3RQ6 A;  2RBC A;  2I6A A;  4KAH A;  2A9Y A;  3RM5 A;  3IE7 A;  5CGA A;  4EN4 A;  4E84 A;  3NM3 A;  3RSQ A;  4EBU A;  1C3Q A;  4KAD A;  4JKS A;  2HW1 A;  1V1A A;  1TD2 A;  3K9E A;  5B6A A;  1WYE A;  4C5M A;  3UMP A;  3HIC A;  2AX3 A;  2AB8 A;  2FV7 A;  3QA2 A;  1KYH A;  3RSG A;  1RKS A;  3W4S A;  2PKN A;  3I3Y A;  4K9C A;  4O1L A;  4S1I A;  3B1R A;  3K5W A;  4UBE A;  1V19 A;  3KTN A;  3NCA A;  3H49 A;  3CQD A;  1RK2 A;  3RO4 A;  2DDW A;  1U2X A;  3B1N A;  4KAL A;  3RQ2 A;  5EY7 A;  3RY7 A;  4JJP A;  3RS9 A;  2ABQ A;  2C49 A;  1GQT A;  1YGJ A;  3NBW A;  4LBX A;  2AJR A;  1EKQ A;  4C5L A;  1GC5 A;  2C4E A;  5C3Z A;  3RU3 A;  4K8K A;  3LKI A;  4XF6 A;  4C5K A;  4E69 A;  5BYF A;  3DRW A;  3GBU A;  4WJM A;  2ABS A;  4S1I B;  5C3Y A;  3RTG A;  2R3E A;  3DZV A;  3N1C A;  2AWD A;  3RTA A;  5BYD A;  3RRJ A;  4JKU A;  2QCV A;  4LBG A;  3JUL A;  3KEU A;  2YXU A;  3RU2 A;  2R3B A;  4LCA A;  4O1G A;  4DU5 A;  3IBQ A;  1YHJ A;  1LHR A;  3NL6 A;  2HLZ A;  2JG1 A;  3UQ6 A;  2F7K A;  2JG5 A;  2PKF A;  2YXT A;  3H74 A;  3NM1 A;  3LJS A;  3RRE A;  3MBJ A;  3RTB A;  4S1H A;  5F11 A;  3BGK A;  1VM7 A;  3NL5 A;  3ZS7 A;  3BF5 A;  3RRB A;  3RQ8 A;  2JGV A;  4N08 A;  1ESJ A;  3PZS A;  4E8Z A;  3KD6 A;  1LIK A;  4K93 A;  1TZ3 A;  4LC4 A;  3RQQ A;  1V1S A;  2NWH A;  5COJ A;  3RRF A;  3UBO A;  4K8C A;  3IKH A;  4K8P A;  1UB0 A;  2AA0 A;  5C41 A;  3LOO A;  3HPD A;  4E8Y A;  3EWM A;  4EUM A;  5BYC A;  1YGK A;  5CM5 A;  3B1Q A;  1RFU A;  1BX4 A;  4K9I A;  3FHY A;  2F02 A;  3B1P A;  5CGE A;  2DDM A;  3RSF A;  4GM6 A;  4KAN A;  3RPZ A;  2HQQ A;  5TRW A;  4EOH A;  2A9Z A;  2PKM A;  2DCN A;  5C40 A;  1RKA A;  5F0Z A;  3Q92 A;  2Q5R A;  1VK4 A;  3RPH A;  1TYY A;  1UA4 A;  4XCK A;  3UMO A;  3IQ0 A;  3UQE A;  4U7X A;  4C5N A;  1LHP A;  2I5B A;  3GO7 A;  1DGM A;  3B1O A;  1RFV A;  3RTE A;  3NC9 A;  4YL5 A;  3NL3 A;  3RSS A;  2XTB A;  3UQ9 A;  4B8S A;  3RQX A;  3PL2 A;  1LIJ A;  2AJP A;  1L2L A;  4YWR A;  3OTX A;  1JXI A;  4S1M A;  4B8R A;  1ESQ A;  3IN1 A;  3Q1Y A;  3RT9 A;  1VI9 A;  3RQH A;  1V1B A;  2DDO A;  1EKK A;  1LII A;  3KZH A;  3RTC A;  4PVV A;  5BYE A;  5TQI A;  3NBV A;  3RTD A;  3VAS A;  3HYO A;  3B3L A;  1TZ6 A;  5EYN A;  2V78 A;  3IH0 A;  2VAR A;  1LIO A;  3RS8 A;  4DC3 A;  4K8T A;  1JXH A;  4KBE A;  4E3A A;  2QHP A;  4XDA A;  4XF7 A;  1RFT A;  3UQD A;  3NC2 A;  1RKD A; 
#chains in the Genus database with same CATH topology
 3GO6 A;  4CVK A;  3FHX A;  3RQ5 A;  4X8F A;  2I6B A;  3RT7 A;  2AFB A;  2PKK A;  3NRS A;  3VAQ A;  3MBH A;  4E8W A;  3NL2 A;  4N09 A;  3QAI A;  4C5J A;  2VOR A;  2XJA A;  3LHX A;  2RBC A;  2I6A A;  3RQ6 A;  4KAH A;  2A9Y A;  3RM5 A;  2GC5 A;  3IE7 A;  5CGA A;  1P3D A;  4EN4 A;  4E84 A;  1FGS A;  2VOS A;  3NM3 A;  3RSQ A;  4EBU A;  1C3Q A;  4KAD A;  4JKS A;  2HW1 A;  1V1A A;  1TD2 A;  3K9E A;  4QDI A;  5B6A A;  1WYE A;  2UUP A;  4C5M A;  3UMP A;  3HIC A;  2AX3 A;  2AB8 A;  2FV7 A;  3QA2 A;  1KYH A;  3RSG A;  1RKS A;  2JFG A;  1E0D A;  2PKN A;  3I3Y A;  4K9C A;  4O1L A;  3W4S A;  4S1I A;  3B1R A;  3K5W A;  3HN7 A;  4UBE A;  1V19 A;  3KTN A;  2GC6 A;  2Y67 A;  3NCA A;  3QCZ A;  2GCA A;  3CQD A;  3H49 A;  1RK2 A;  3RO4 A;  2DDW A;  1E8C A;  1U2X A;  2JFF A;  3B1N A;  4KAL A;  5EY7 A;  3RQ2 A;  2JFH A;  4JJP A;  1JBW A;  3RS9 A;  2ABQ A;  3RY7 A;  2C49 A;  1GQT A;  1YGJ A;  3NBW A;  4LBX A;  2AJR A;  1EKQ A;  3UAG A;  4BUC A;  4C5L A;  1GC5 A;  2C4E A;  5C3Z A;  3RU3 A;  2AM1 A;  4K8K A;  3LKI A;  4XF6 A;  4C5K A;  4E69 A;  1W7K A;  3DRW A;  2Y1O A;  3GBU A;  2ABS A;  4S1I B;  4UAG A;  4WJM A;  3RTG A;  2R3E A;  4BUB A;  3DZV A;  2XPC A;  2AWD A;  3N1C A;  1JBV A;  3RTA A;  5BYD A;  3RRJ A;  4JKU A;  1P31 A;  2X5O A;  4CVM A;  2QCV A;  4LBG A;  3JUL A;  3KEU A;  2YXU A;  3RU2 A;  2R3B A;  4LCA A;  4O1G A;  4DU5 A;  3IBQ A;  1W78 A;  1YHJ A;  1LHR A;  3NL6 A;  2Y68 A;  2HLZ A;  4ZIY A;  2JG1 A;  3UQ6 A;  2F7K A;  2JG5 A;  2PKF A;  2YXT A;  1O5Z A;  3H74 A;  3LJS A;  3NM1 A;  3RRE A;  3MBJ A;  3RTB A;  4C13 A;  4S1H A;  3LK7 A;  5F11 A;  3BGK A;  1VM7 A;  3NL5 A;  3ZS7 A;  3BF5 A;  3RRB A;  3RQ8 A;  1UAG A;  2JGV A;  4N08 A;  1J6U A;  1ESJ A;  3N2A A;  3PZS A;  4E8Z A;  1GQY A;  3KD6 A;  1LIK A;  3EAG A;  4K93 A;  1TZ3 A;  4C12 A;  4LC4 A;  3RQQ A;  1V1S A;  2NWH A;  5COJ A;  3RRF A;  3UBO A;  2AM2 A;  4K8C A;  3IKH A;  4K8P A;  1UB0 A;  2AA0 A;  2VTD A;  3LOO A;  3HPD A;  4E8Y A;  3EWM A;  4EUM A;  4HV4 A;  5BYC A;  1YGK A;  5C41 A;  5CM5 A;  3B1Q A;  1RFU A;  5A5E A;  1BX4 A;  4K9I A;  5BYF A;  3FHY A;  2F02 A;  4QF5 A;  3B1P A;  5C3Y A;  5CGE A;  2DDM A;  3PYZ A;  3RSF A;  4GM6 A;  4KAN A;  3RPZ A;  2HQQ A;  5TRW A;  4EOH A;  2A9Z A;  2PKM A;  2DCN A;  5C40 A;  1RKA A;  5F0Z A;  3Q92 A;  2Q5R A;  1VK4 A;  3ZL8 A;  3RPH A;  1TYY A;  1UA4 A;  2VTE A;  2WTZ A;  4XCK A;  3UMO A;  3IQ0 A;  3UQE A;  4U7X A;  4C5N A;  2Y66 A;  1LHP A;  2I5B A;  3GO7 A;  1DGM A;  3B1O A;  2GCB A;  3HJ6 A;  1RFV A;  3RTE A;  3ZM5 A;  4CVL A;  1GQQ A;  3NC9 A;  2UAG A;  4YL5 A;  3NL3 A;  3RSS A;  2XTB A;  3UQ9 A;  4B8S A;  3RQX A;  3PL2 A;  1LIJ A;  3ZM6 A;  2AJP A;  1L2L A;  4YWR A;  3OTX A;  1JXI A;  4S1M A;  4B8R A;  1ESQ A;  3IN1 A;  3Q1Y A;  3RT9 A;  1VI9 A;  3RQH A;  1V1B A;  2DDO A;  1EKK A;  1LII A;  2WJP A;  3KZH A;  3RTC A;  4PVV A;  5BYE A;  5TQI A;  2UUO A;  3NBV A;  3RTD A;  3VAS A;  3HYO A;  1GG4 A;  1TZ6 A;  3B3L A;  5EYN A;  2V78 A;  2F00 A;  3IH0 A;  2VAR A;  1LIO A;  3RS8 A;  4DC3 A;  4K8T A;  5A5F A;  1JXH A;  4KBE A;  4E3A A;  2QHP A;  4XDA A;  4XF7 A;  1EEH A;  1RFT A;  3UQD A;  3NC2 A;  1RKD A; 
#chains in the Genus database with same CATH homology
 3GO6 A;  3FHX A;  3RQ5 A;  4X8F A;  2I6B A;  3RT7 A;  2AFB A;  2PKK A;  3VAQ A;  4E8W A;  3MBH A;  3NL2 A;  4N09 A;  3QAI A;  4C5J A;  3LHX A;  3RQ6 A;  2RBC A;  2I6A A;  4KAH A;  2A9Y A;  3RM5 A;  3IE7 A;  5CGA A;  4EN4 A;  4E84 A;  3NM3 A;  3RSQ A;  4EBU A;  1C3Q A;  4KAD A;  4JKS A;  2HW1 A;  1V1A A;  1TD2 A;  3K9E A;  5B6A A;  1WYE A;  4C5M A;  3UMP A;  3HIC A;  2AX3 A;  2AB8 A;  2FV7 A;  3QA2 A;  1KYH A;  3RSG A;  1RKS A;  3W4S A;  2PKN A;  3I3Y A;  4K9C A;  4O1L A;  4S1I A;  3B1R A;  3K5W A;  4UBE A;  1V19 A;  3KTN A;  3NCA A;  3H49 A;  3CQD A;  1RK2 A;  3RO4 A;  2DDW A;  1U2X A;  3B1N A;  4KAL A;  3RQ2 A;  5EY7 A;  3RY7 A;  4JJP A;  3RS9 A;  2ABQ A;  2C49 A;  1GQT A;  1YGJ A;  3NBW A;  4LBX A;  2AJR A;  1EKQ A;  4C5L A;  1GC5 A;  2C4E A;  5C3Z A;  3RU3 A;  4K8K A;  3LKI A;  4XF6 A;  4C5K A;  4E69 A;  5BYF A;  3DRW A;  3GBU A;  4WJM A;  2ABS A;  4S1I B;  5C3Y A;  3RTG A;  2R3E A;  3DZV A;  3N1C A;  2AWD A;  3RTA A;  5BYD A;  3RRJ A;  4JKU A;  2QCV A;  4LBG A;  3JUL A;  3KEU A;  2YXU A;  3RU2 A;  2R3B A;  4LCA A;  4O1G A;  4DU5 A;  3IBQ A;  1YHJ A;  1LHR A;  3NL6 A;  2HLZ A;  2JG1 A;  3UQ6 A;  2F7K A;  2JG5 A;  2PKF A;  2YXT A;  3H74 A;  3NM1 A;  3LJS A;  3RRE A;  3MBJ A;  3RTB A;  4S1H A;  5F11 A;  3BGK A;  1VM7 A;  3NL5 A;  3ZS7 A;  3BF5 A;  3RRB A;  3RQ8 A;  2JGV A;  4N08 A;  1ESJ A;  3PZS A;  4E8Z A;  3KD6 A;  1LIK A;  4K93 A;  1TZ3 A;  4LC4 A;  3RQQ A;  1V1S A;  2NWH A;  5COJ A;  3RRF A;  3UBO A;  4K8C A;  3IKH A;  4K8P A;  1UB0 A;  2AA0 A;  5C41 A;  3LOO A;  3HPD A;  4E8Y A;  3EWM A;  4EUM A;  5BYC A;  1YGK A;  5CM5 A;  3B1Q A;  1RFU A;  1BX4 A;  4K9I A;  3FHY A;  2F02 A;  3B1P A;  5CGE A;  2DDM A;  3RSF A;  4GM6 A;  4KAN A;  3RPZ A;  2HQQ A;  5TRW A;  4EOH A;  2A9Z A;  2PKM A;  2DCN A;  5C40 A;  1RKA A;  5F0Z A;  3Q92 A;  2Q5R A;  1VK4 A;  3RPH A;  1TYY A;  1UA4 A;  4XCK A;  3UMO A;  3IQ0 A;  3UQE A;  4U7X A;  4C5N A;  1LHP A;  2I5B A;  3GO7 A;  1DGM A;  3B1O A;  3HJ6 A;  1RFV A;  3RTE A;  3NC9 A;  4YL5 A;  3NL3 A;  3RSS A;  2XTB A;  3UQ9 A;  4B8S A;  3RQX A;  3PL2 A;  1LIJ A;  2AJP A;  1L2L A;  4YWR A;  3OTX A;  1JXI A;  4S1M A;  4B8R A;  1ESQ A;  3IN1 A;  3Q1Y A;  3RT9 A;  1VI9 A;  3RQH A;  1V1B A;  2DDO A;  1EKK A;  1LII A;  3KZH A;  3RTC A;  4PVV A;  5BYE A;  5TQI A;  3NBV A;  3RTD A;  3VAS A;  3HYO A;  3B3L A;  1TZ6 A;  5EYN A;  2V78 A;  3IH0 A;  2VAR A;  1LIO A;  3RS8 A;  4DC3 A;  4K8T A;  1JXH A;  4KBE A;  4E3A A;  2QHP A;  4XDA A;  4XF7 A;  1RFT A;  3UQD A;  3NC2 A;  1RKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...