3RS8A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with adp-ribose
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 182
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rs8A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rs8A02
5CM5A 1RKSA 1WYEA 2JGVA 2YXUA 3NC2A 3NC9A 3PL2A 4S1HA 4JJPA 1EKKA 3GBUA 4DC3A 4K8CA 3W4SA 2V78A 1RFVA 5BYEA 3BGKA 1YHJA 4K9IA 4K9CA 4O1LA 3B1RA 4LC4A 4KALA 4E8WA 1C3QA 1JXIA 2A9ZA 3NL3A 4K8TA 4KBEA 1V1AA 1UA4A 5COJA 3UQEA 3ROXA 3IQ0A 1LHPA 3NM3A 4U7XA 4LBGA 3RPZA 3Q92A 3B1OA 2DDMA 3HYOA 3ROEA 4JKSA 4EN4A 4EUMA 1TZ3A 1LIJA 3UBOA 3RU3A 4PVVA 1BX4A 2ABQA 4K8PA 3H74A 2DDWA 3RO4A 3RQQA 3RQXA 4B8RA 1RFTA 4WJMA 5EYNA 3NL6A 3KZHA 4KANA 2I6AA 3NBVA 4XF7A 3RQ6A 4C5LA 5F0ZA 3HPDA 4C5MA 3UQDA 3H49A 1RFUA 2R3EA 3DRWA 3QA2A 3RQ2A 5B6AA 3RSSA 3RRFA 2XTBA 3B1NA 4E8YA 5BYDA 1L2LA 2VARA 3RS8A 2PKNA 1TYYA 5C40A 1V1SA 1JXHA 3N1CA 3RSFA 2DCNA 5BYCA 1KYHA 3FHYA 4C5NA 3RNOA 1LIKA 5C41A 5C3ZA 2DG2A 3RQ5A 5CGAA 1RKDA 4XDAA 1JZTA 2C49A 3NBWA 2AB8A 3MBHA 5EY7A 1GC5A 3ROGA 4LBXA 3IN1A 2RBCA 3KTNA 3NM1A 2JG5A 2R3BA 2F7KA 3RTBA 3LHXA 3RQHA 4KADA 3RM5A 3NL2A 3RSGA 4K93A 2DDOA 2NWHA 5TRWA 4B8SA 4E8ZA 2PKFA 3QAIA 3NCAA 2AWDA 4E69A 3Q1YA 4E84A 4KAHA 3RQ8A 2F02A 3RT9A 2PKKA 3RY7A 3UMOA 5F11A 2A9YA 4YL5A 3B1PA 3RTDA 1ESQA 2HQQA 3BF5A 3NL5A 4O1GA 3K9EA 3JULA 3CQDA 4C5JA 1YGJA 1VI9A 4LCAA 2AX3A 2Q5RA 1RK2A 4N09A 1LHRA 4N08A 4E3AA 3IE7A 2ABSA 2AA0A 3UMPA 2HLZA 3K5WA 3UQ9A 3RO7A 3LKIA 4XCKA 3D3KA 2JG1A 1ESJA 3RSQA 2HW1A 3OTXA 4YWRA 4S1IA 5C3YA 2O8NA 1LIOA 4X8FA 3RREA 2AJPA 1TZ6A 1RKAA 3VASA 3IKHA 3IBQA 1VM7A 3B1QA 5BYFA 3KD6A 1GQTA 3I3YA 3LOOA 4XF6A 3DZVA 4S1IB 3RS9A 3RTGA 2QCVA 3IH0A 3RPHA 4EBUA 1LIIA 3RRBA 3UQ6A 1DGMA 3RRJA 2AJRA 2FV7A 2QHPA 3GO6A 3LJSA 4UBEA 3VAQA 3HICA 3B3LA 1YGKA 2I6BA 3RTAA 3ZS7A 2YXTA 4K8KA 3RT7A 3ROZA 4S1MA 3PZSA 2PKMA 3GO7A 4DU5A 5CGEA 3RTEA 3RU2A 1V1BA 1TD2A 2AFBA 3KEUA 3EWMA 3RTCA 4JKUA 1U2XA 5TQIA 4C5KA 3D3JA 3FHXA 4GM6A 1EKQA 3MBJA 1V19A 1VK4A 1UB0A 4EOHA 2I5BA 2C4EA
chains in the Genus database with same CATH superfamily
2QSJA 3H9JA 3VMFA 1COWD 5DGXA 2FPGA 3GRVA 2RHTA 3QNMA 1L4NA 1S01A 2HO4A 1FYVA 5LB4A 3BIFA 2I99A 3HVUA 4IIDA 4IIHA 2M32A 3RADC 4BXOA 1ZM4A 1Z7EA 3NYIA 3PU6A 2FPPB 3FPLA 4M9QA 1Z08A 2BHTA 3TRFA 1H94A 1OYOA 1QRDA 1TUGA 2A1UB 1SKYE 3VNAA 1TTQB 1VPDA 1QHXA 3D2LA 4E5UA 4COKA 2AYXA 4EKNB 2B92A 2EKZA 3R6WA 2PBZA 2R11A 1VFPA 4ENQA 5H3HA 1JHYA 3M4XA 1SZDA 1UC8A 1ULSA 1AHIA 1ZEMA 4A27A 1CUUA 2A9KA 2X1LA 1V5FA 2DKOA 4V3CA 1CG6A 1XUOA 1WD5A 4XGKA 5DTEA 4CLOB 5ENDA 2PUDA 1QGOA 3DVSX 1F0PA 1JQBA 4B84A 2FOLA 2WG2A 3CEJA 2VDNB 3DTVD 5AM3A 1E0AA 5CNMA 3LCUA 3C7CB 3GR6A 1KMCA 2PMBA 4DANA 1SCNE 4KCGA 4WNAB 3NYWA 3FTDA 1BS2A 4YRTA 5H4HA 2W6PA 1DO2A 2J45A 3OSUA 3EUFA 3UJCA 1PGJA 4L5YA 4HDSA 3UJHA 2GHQA 1TKBA 3SF8B 2FFQA 4OQZA 2G1KA 4EO4A 4ZJPA 3WKAA 1V1MA 1XJ5A 2MIIA 4QQ8A 1PUJA 4XYLA 5KX5A 2FWMX 4YIHA 1U8UA 3JAWA 1RJFA 3O1IC 3V00A 3VVMA 2AOUA 4MROA 4XI9A 4BRZA 5M2QA 1IQRA 2VPPA 5AOBA 4X62B 3TNFA 3IFSA 1JQEA 3C6QA 3TQSA 2GEJA 1AQ6A 1G6HA 1OCEA 1TF7A 2NSDA 2R2AA 2WA2A 3AU8A 4FIZA 4YXWA 1ZAYA 2VHEA 1YAHA 1Z5OA 2X8BA 3HP4A 4QXMA 2IOHA 2PWZA 3U4HA 1LFDB 1PLLA 2A35A 2FB9A 1JMYA 1JT9A 1RKBA 4MYSA 3W2GA 1Y7LA 3R0JA 2A0XA 5FF9A 2AJTA 2FFRA 1BZYA 2G9VA 3KKQA 4BNDA 3DE4X 2O2EA 3ZR4B 5A1JA 3EASA 2RHMA 3BN3A 1OFTA 3DEKA 5CIYA 3KQKA 4TTQA 2PH5A 2CJYA 1JFFB 4WBNB 2TMDA 1NI3A 4LNAA 1ZKMA 2XUHA 2AXQA 3GAMA 3UPDA 5HIMA 1V2GA 4U00A 1CUZA 1FUYB 1MF7A 3D3KA 5LMCA 2FZKA 2YV1A 4MV5A 4MGEA 4ZO7A 5J5VA 2W7TA 3T5DA 4QWMA 3FCEA 4NL4H 1UFOA 1X87A 5FUWA 5J1SB 2W43A 2OORA 5J23A 3HVRA 3ZD7A 1U90A 1NXQA 4U7GA 1Z75A 3B2EA 1FSPA 3I3YA 2FLKA 2ROQA 1Q21A 3EUAA 4G25A 2Z6QA 3J7AC 3PK0A 3ZXIA 5BMOA 2C77A 2NSJA 4OBXA 3CVVA 4O4JA 3B1FA 1UBTS 1JLMA 4BIMA 1PE0A 4EQZA 3RUIA 4G4SO 4TZKA 3X1WA 1KIFA 4DLAA 1OYVA 5LBTA 1B23P 3ZS7A 3RHFA 1AV7A 4IJQA 1BMTA 1OGIA 4KLZA 4BFXA 4EX6A 5C2JB 3SYRA 1L7QA 3CKMA 4UBMA 2IBSA 3STHA 1QFXA 3E9EA 1WMSA 3F8TA 1PWYE 3O75A 1J90A 1IY1A 1NJ5A 5EWJB 2O2SA 3S40A 4BECA 2QTBA 3L0ZA 3HY4A 5KYVA 2Q3CA 1O9GA 4QXRA 2VP3A 1M6VA 2JRCA 4MP8A 3UGTA 4DSNA 1G8PA 4HAYA 2YXUA 1H0SA 5CNKA 2M1XA 1FPQA 4JC8A 4H1WA 4IQ4A 1H8HA 2H18A 4BATA 1YRAA 4YV2A 4XIJA 1XD8A 1W5EA 1JEQA 3DMGA 2CWDA 1K9SA 4GOMD 4IO1A 1DX6A 2MMCA 5DLDA 3VR5D 4EUSA 1MJFA 3QFSA 3ZCSA 4ZVNA 2I67A 4I9GA 3T3PB 5CA1B 1M2WA 1XO1A 1GG4A 2VDPB 3TDKA 2LDXA 3VR4H 3THWA 1R2QA 3NM3A 5F7OA 5BMVB 4DQUA 2NO7A 2AJLI 1QANA 1H2FA 2J9FB 3CNLA 2O57A 1TL7C 3P27A 2ABQA 3RQQA 4UVHA 1E9EA 1UT6A 4HJRA 1I7LA 4L4ZA 1T8PA 1U81A 2XITA 5GM2A 5JJBA 3B6EA 1PUIA 1FFAA 2QP3A 4MR7B 1NX6A 1RWQA 4LWOA 2H0QA 4QBHA 5KOHA 1B3RA 4UAUA 2CXSA 3T38A 3SE0A 4JKOA 3DD5A 4L9WA 1MVOA 1Y6FA 2GCIA 2QTVA 4EG3A 1U7UA 2M6LA 5HM6A 5JJ5A 5JBIA 2Z9DA 4OBBA 3OX3A 2VJPA 4N7RA 4RM3A 2XE7A 4YQEA 1YTUA 4WZBE 5HKOA 5HDQA 4OHCA 1KYXA 2XA1A 4MWBA 4FHFA 2QU7A 3KS9A 5CGAA 1FX0A 3U3JA 4K6OA 1YL6A 2YZGA 5AKEA 5FWNA 4DSTA 1KE2A 4X64B 2HZ7A 1X92A 1S2MA 3PNYA 2AQKA 1AQUA 2GBIA 3HPQA 2H1HA 3WOVA 1NNSA 4CZ2A 1EZZA 2JEYA 4KKXB 3ANMA 4F6CA 3W78A 1XG5A 4DM3A 2AWDA 2QGNA 1GZ5A 3PFGA 1RYZA 2R85A 3EZ7A 3IALA 2GEDA 3HP7A 3UHFA 2CNLA 4ESHA 2P6OA 2VJNA 1J56A 1D2HA 1KMIY 2IUTA 3H1FA 3I72A 3X1MA 4CG2A 3A6HA 3I12A 2UYOA 4I1OA 2PGXA 3D8NA 5CW1A 2CMFA 4Q1CA 4ZGBA 5CM8B 4N49A 2B30A 1A4RA 3A7EA 3ILYA 1QLHA 3X1XA 1J5EB 3BJZA 5A0VA 3C1AA 3K73O 3OZDA 4HQLA 3TBHA 1IK4A 4C2TA 1D1TA 1Y33E 4WZ6A 3AUJB 1OWNA 3K8ZA 4CWAA 2CZCA 5J2UA 3C0KA 2ZIZA 3JXEA 5LYYA 3TXYA 2AWNA 2QDXA 3X2EA 1IJBA 1PR3A 5ALWA 3PNMA 3D2AA 1Z18A 1J8DA 3JRXA 4P80A 4XM0A 1F2TB 2QYOA 1XHEA 2O3JA 1OKKD 1IVNA 1Y7PA 2X3YA 4GNKA 1W2GA 3G0OA 4RCVA 3DMTA 5DTIA 5CYPA 1I7PA 5JBNA 2W42A 3A3YA 1MG5A 2VK1A 2YN0A 3H8SA 4OB8A 4GHWA 2C4NA 2O20A 4X93A 1NBHA 1OLSB 2GM5A 1RP7A 1UKVY 2ID7A 4GPD1 3SLGA 4NZOA 2UXCB 4JJ7A 1N9ZA 2WJWA 4RD6A 5HYVA 1L2TA 4FONA 1HMYA 1W85B 3BWBA 4HT3B 1PFGA 4XAQA 4EO7A 3I9V1 5JTTA 1ZINA 2AK2A 1XRRA 2Z3VA 5K20A 2PHZA 2MHCA 3HHPA 4RADA 5DHRA 1DKPA 3GLIE 3MF4A 4MQLA 3FFAA 2V4ZA 5KOJB 2J0EA 3QGMA 4IEIA 2A5LA 1D2RA 2V1UA 4L5JA 1XQYA 1DQRA 3Q4GA 1OH5A 5B3LA 1CUCA 1LS6A 1VC2A 2QW0X 3LXRA 4H6WA 4Z2YA 1N9KA 2O2CA 2F3SA 3FBTA 4ID3A 4GMKA 4KX3A 3TKLA 5FFFA 1GZHB 4DJDC 3G8DA 1DCTA 4NRDA 1XMJA 2DUUA 3PP8A 3FJOA 3IQDB 4KC0A 4K88A 5K8CA 4RHXA 3AEKB 3CZ5A 2XWJI 3ETJA 2H1CA 4ND7A 1XTPA 4MI9A 5IVDA 5T3UA 3DTNA 4CM4A 2XEDA 5HGXA 2HWKA 2OQRA 3V3TA 4PO8A 4QGHA 2F1HA 2Q2NA 3HH8A 4CR7A 5BQOA 5DXAA 3B8EA 4LY3A 3AR5A 5HZMA 2BHNA 4NOMA 2RI6A 2XJ9A 5JLJA 2IWRA 4E8YA 1L8LA 3PHHA 4W8GA 4B6PA 5B3KA 1KVUA 4JYCA 2FVXA 1CF9A 3GT0A 3AOEA 3LDGA 3FKQA 1IE3A 4KE7A 2BELA 1VBFA 2CJWA 4JP5A 3UAWA 3EGXA 1JB1A 4G89A 4DN6A 2JLQA 3RFTA 2AB8A 2SICE 3CE9A 1WZ2A 3DVQX 4JZYA 3W2IA 4H7EA 1Y4UA 4P3PA 1E3EA 3H1GA 4A15A 2QLLA 5A9SB 1B0PA 4Y1RB 2XUAA 1SG6A 1NSFA 1KDYA 1UM9B 3CC8A 2XJAA 3OY7A 5BSKA 4LC1A 1ZGJA 3RT9A 3FROA 3TLYA 4CN8A 3L6BA 4I5EA 2JJ1A 3LC7O 4MR8A 4Z7QB 1DOZA 4B71A 1I4OA 4CIBA 2JIQA 3M9LA 1TJ3A 3LBNA 2UAGA 4P92A 4PONA 1EUDA 2AG8A 5TGZA 4CM1A 1B6SA 5HZGA 1VJDA 4QRIA 1WXWA 2N1MA 1C41A 3IR5A 2ZRHA 2OL4A 3SKYA 1K4KA 3B6ZA 3V33A 1S8FA 3NOVA 4OHRA 3RKUA 1VA4A 3BKXA 3F6BX 1SQSA 5JSQA 4Q9IA 2IK8A 1M5UA 1B42A 1NN1A 3IOEA 1V5WA 3BORA 3IUPA 5C18A 1C1XB 5F1PA 3HMQA 4J7UA 5TT1A 4D6PA 2IF2A 5HNKA 2VDUE 3EGDB 4I81A 1E2HA 1DAGA 1TPYA 1WPXA 1W0JA 3HQ4O 4MYTA 4NICA 4JA2A 2PKQP 1PWHA 2C92A 1BH2A 2J31A 3G59A 2W6CX 3ST7A 5J2UB 1RLIA 5BSEA 3B9BA 1QIDA 2G9UA 3FNRA 2OHVA 4IRXA 4WMLA 3W9BA 4EA9A 4MRVA 1I5RA 1Z36A 3S99A 3W06A 5DBGA 3K70D 2B1IA 5FI3A 1I80A 2VSYA 1Y9ZA 4PPYA 1V4NA 1E2EA 3FJ1A 3KR2A 4PCAA 2DR0A 1XRLA 2RKBA 4M0PA 4AROA 2OHGA 4PVDA 2QAGA 3K0FB 3I2FA 1A77A 3IYLW 4XYEA 2QVYX 3NCTA 3DV0A 1P0PA 1SC9A 2ZVJA 3I83A 2I5PO 2DE0X 4XARA 2PLNA 2HV9A 3ET4A 3UNXA 1NJ6A 1VMAA 3DMRA 2FW1A 1BHO1 2FF5A 1Y3AA 5K03A 1N8KA 1MIHA 1QBGA 1TEHA 4QOIA 3RK1A 3Q11A 1DO0A 3BGKA 1ML4A 1YR6A 1ZNYA 2EFCB 2IXGA 2ESRA 2EP5A 1CY0A 1IRXA 1QZZA 1YCHA 1QZ3A 1SWVA 2P3SA 1JHOA 4JQZA 1E2UA 3A04A 3U7QB 4V1CI 1BDHA 2YVAA 3ZWMA 1A9ZA 5I7WA 2ZI4A 5LMNB 1RYBA 1F9AA 1KAOA 2E85A 3N0XA 1I2AA 1BW9A 1E2IA 4F2GA 4TWJA 5DN6A 4UATA 3PGXA 2VFAA 4FMPA 3GVCA 4GL4A 1ENYA 4JL8A 4LE1A 5JSZA 3Q8KA 1N0IA 3GLIA 1Q6ZA 2JI9A 1AK9A 1Z83A 2UYYA 2ZJ3A 4RE6A 3Q2OA 5BWCA 3RJTA 1FYFA 1EEHA 3Q87B 1CYDA 4PSCA 2XYQA 1FA9A 1VBKA 4P3XA 3R9KA 1ZBDA 2WIAA 4LEIA 3AUAA 1UMDB 4ZKEA 3EZGA 1P44A 4XUGB 4CKZA 3EW9A 4LV5B 1YU9A 2AC4A 2B5VA 5M3BA 1W9HA 3CISA 2BFAA 4X1IA 4CM4B 8GPBA 2AIRA 4I4TA 4LE0A 5TQ2B 5EEHA 1GZSA 1TJNA 4DMFA 4QUGA 3M3PA 1E3WB 1EQUA 2ODPA 5CXSA 1DELA 4O3FA 5EZ5A 3T34A 3VV2A 8ADHA 1BGWA 3DAPA 5BNZA 2FK8A 4IDFA 1H2XA 1IBSA 2AW3A 4GSLA 4BFTA 2JZNA 4AG3A 4YRSA 1OAAA 2C2GA 3AVPA 1HTWA 5LIRA 4IHQA 3I9V6 1TT5A 3AFNA 3AYZB 3Q7TA 4LRUA 2O5VA 4N6OA 4PYLA 1GFIA 2NUBA 2YXEA 3PKIA 2ZUTA 5JQGA 2DDOA 2JH8A 2QD3A 3Q7SA 1BHJA 4ZK2A 1VG8A 2HI0A 4OQQA 4AN1A 1SBCA 5LM3A 2G6BA 3K2EA 1H2YA 3R5XA 5CX4A 5IU6A 5ECWA 3P97A 3AETB 3KYIB 1FFBA 1AKNA 2Q7XA 4OXQA 3WWOA 3WAKA 5BR4A 1USUA 3L1IA 1SA0B 3BGOS 2IZ1A 3JYNA 4G5YA 1ODSA 1LLCA 1UKYA 3AJRA 1CZNA 3P4XA 3ADOA 4YN3A 4BQPA 3PXAA 4OLFA 2R25B 3E8MA 3IE7A 1L8OA 1PGQA 2CLCX 2RKOA 3VJRA 1CPYA 2W6NA 3B1XA 4LBWA 5FULA 3UG7A 4NE2A 3L8MA 5IP5A 3MAGA 2JCSA 3FVWA 3S2UA 2E7ZA 4O2AF 4JLBA 5F2EA 4W7SA 3GJ4A 5F64A 3MINA 5EGNA 5F5NA 5KTKA 4RV4A 5E9AA 1T2UA 1FDUA 1NVXQ 3SFVA 3TW8A 4O1IA 2WKQA 3LDFA 4FJ2A 4FGKA 2PNFA 2Z5GA 4IDBA 4XSVA 4Y6QA 4ZAWA 1LK0A 4FINA 5L4SA 4JSRA 2GZ1A 5HJ5A 2EJVA 2JHAA 2J9FA 4DWJA 3CPEA 3T5PA 4GSYA 2G9QA 3VR6D 3KSAC 5LP6A 1E20A 1R4MA 4JXKA 3KYJB 3PRHA 4H3SA 2G1PA 3N2GA 4TTJA 3R8XA 4AWXA 2R47A 4ANFA 3TX2A 1DVRA 2W2VA 2BFDA 4J0EA 4RK5A 4WXPA 1HRKA 4R81A 3V7FA 4ARVA 1TD2A 1PJ4A 2QU8A 3OM8A 4HAUA 4NVRA 2YHUA 4K40A 4M8IA 2VRCD 5KTNA 1UP6A 1PV4A 3PQEA 5IM5A 1S7CA 2FDRA 4IR7A 2YCBA 5JARA 1DRWA 1VYTA 1ZD8A 4S1HA 3IIIA 2CLMB 1E3TA 3G9UA 4N3GA 4PAWA 2GYWA 3ACBA 4QULA 2OQIA 4WINA 2I78A 3NTUA 1ONOA 4MK4A 5ALFA 3R75A 4FDTA 4BGIA 1IUOA 1GPJA 4B33A 2WE8A 4II2A 1W78A 2ZTSA 1LX7A 4CDMA 1IN4A 2VQSA 5KTSA 1IVYA 1OLXA 4AZWA 3CH4B 1PF7E 3AWDA 5HW0A 3TVDA 4WJZA 3RVMA 4F93B 4ETWA 1YR1A 1XQXA 2QG4A 2VPWA 3HDGA 3KSMA 4MRNA 5FB3A 3GLHB 4G0WA 4CQMA 3H0EA 3W2EA 4OOFA 3HKCB 4QRDA 3TLAA 2CMKA 4M89A 1YRHA 3LLVA 1TZMA 1HM5A 3CX8A 4JT9A 3E7DA 3I2JA 2Q5QA 1J1ZA 3VAAA 3AVWA 1D6NA 5GONA 3RVSA 1YZTA 2XZDA 4AMUA 4RLHA 5C5IA 3O3NB 4TXLA 5EWMB 4ZPXA 3NBZC 1FUEA 4KYUA 4NEGA 1ECLA 2P2NA 3B9QA 4KDRA 4P3KA 1ELOA 1C1DB 1FOEB 1QWOA 3CUUA 3N8DA 4UU0A 1N3LA 4ITRC 2XZTA 2F6RA 4UC0A 4HL6A 1HYQA 3RS4A 1DADA 4GOXA 3NIWA 1K7CA 4UBKA 2HA5A 3GGOA 2J3QA 4IS3A 4ZRNA 3WNCA 1E0KA 1YZKA 2HA4A 1IEWA 4LV8B 4TGLA 2ERYA 2GAOA 3VNUA 3MBHA 3RLIA 4ND4A 1VGRA 2PDAA 2GEVA 1ONSA 5H1YA 2PS9A 4QOJA 1UANA 3D8SA 2XR1A 2OKCA 1YI0A 2QRZA 4HGOA 5KJFA 4YMVA 2Y0BA 1GL7A 2OGTA 1NURA 3EXIB 1E1YA 4ECAA 4NYIR 4ED9A 1P2VA 2FE4A 3H19A 3AMVA 3TI7A 5IX8A 1SIUA 4A6XA 1UR5A 1ZRHA 2R1TB 3AUSA 3EG9B 5LWHA 3CVWA 4CHGA 4DEYA 3C98A 2QZPA 2B9VA 2OZLA 2J5XA 4ENPA 2O8FB 4ARZA 1MAAA 1FBNA 2QR3A 2GJKA 1CUJA 3ASYA 1N25A 4JVSB 4ZEWA 5J9FA 5CA1A 4HWKA 4IIEA 5ILQA 1ID8A 1OBVA 4PS0A 5EFOA 2R4QA 4HN4B 4Z3KA 1I3MA 2AUTA 4QFCA 3LA6A 3OEED 3Q8XB 4CKYA 1QV6A 4PRYA 5CPFA 1KRXA 3JD0A 4E2ZA 1V8OA 4GAEA 4HFJA 3WISA 5KQSA 4DV1B 1XPRA 4HX9A 1OFUX 2BFNA 1Z82A 1W7AA 2QX7A 4P38A 1KK1A 5ALGA 3EIUA 3EFOA 4RAQA 1TOAA 2A6PA 4P5PA 3NNSA 2GASA 1T3ZA 1WSBA 2EL7A 4KVGA 1ECCA 2VUTA 3MJDA 4J0DA 5F7ZA 4WVLA 2GERA 5B6JA 1QQAA 3U62A 3IDSA 2J9XB 3GV0A 2ZDQA 4A8HA 2GTPA 2HLDA 2O07A 3D4LA 1PR6A 4OU4A 4M0UA 2IHBA 1N3BA 4CF3A 4E5SA 1PFVA 2WVJA 1S3SA 1WOYA 4M1EA 3AR6A 3TVTA 3RQSA 3OQJA 2QIOA 1DBIA 1EFVB 2HMWA 1HEUA 1QH1A 4MV7A 3VNRA 3WOHA 4U8GA 4B40A 3LQ2A 1P2UA 1AKRA 3KOYA 1NVFA 2XZPA 4K9MA 4G0QA 5K8VA 1RLJA 3ELWA 3HA2A 2H2DA 3QENA 2PK3A 3V1UA 4BYGA 4DC9A 5JYDA 3OPYA 3TL2A 3LS2A 2H5EA 3ZXYA 1SU8A 1U2SA 1JH8A 2WVGA 3Q6NA 3VDNB 4BE7B 1LI5A 1C3QA 4Y2SA 1YZYA 4RMGA 1I2ZA 3NHMA 1Z0FA 3DV9A 1V1AA 2A1TS 1UL1X 3NM4A 5EUQB 4YWJA 1MB2A 4GKBA 4KLAA 2FJ0A 4YJ3B 4LFCB 3ROEA 3AIMA 2JJ2A 1DAKA 4X61A 4R2HA 1D3AA 1IUKA 1SHTX 4TXMA 5FA8A 3UK6A 3GJ6A 1T5HX 2DWQA 4TL6A 4E7OA 1HLFA 1EXWA 5K09A 1TPZA 3QUBA 4KAFA 1U2PA 2FCAA 2HJRA 2X22A 2IUUA 4WGFA 2P79A 1WXDA 4QE3A 2UYGA 3UAXA 4EB6B 5EJ2A 2Z09A 3AFOA 2IDJA 3H5TA 4S0ZA 3RRFA 4PC1A 3AUFA 5JCZA 3OZUA 1GGNA 5LZ5A 3WK4A 2OORC 3WGYA 1QFZA 3QVVA 2IYLD 1G6OA 1V95A 4NG5A 3EBPA 4RA6B 1OW3B 4C5NA 1FVXA 3HEMA 5JAOA 3HK2A 1S2NA 3FFWA 1BYIA 2YQ4A 4K9KA 2OWEA 2EFDB 4FX2A 3ECCA 4YR7A 1U1DA 4LJ6A 3KJEA 4OK3A 4BS9A 4LBXA 4XOIA 4J4BA 5SYNA 2YW9A 3L05A 2CDNA 1LDGA 5HQJA 3USES 1TJ4A 4FXOA 1EEXB 4HDQB 4FYWA 4HH0A 2ZJ0A 3A06A 4I6GA 4IDHA 4O4JB 3DW1X 1ZIYA 2FU5C 2XNDA 5SY6A 1BGVA 2ZBPA 3N0TA 5D8DA 1UT5A 2PZFA 3IMEA 5CDSA 2PSDA 1IZZA 5KHAA 2NPFA 4LWPA 4X66B 1C3EA 5HF6A 3EQ9A 4ZI3A 1QTNA 2OOKA 5DHAA 3PS9A 1GRNA 1VJ5A 1WU8A 3A36A 1EVQA 1HL3A 5IAKA 1M1UA 3GW8A 2I6GA 2NXJA 3F98A 5DO9A 5EUCA 3ZD9A 3W2HA 2PYZA 1P9NA 2AMYA 5EJEA 3L7OA 2G04A 1O5OA 5A4MS 3QVLA 3MAAC 1USKA 4WBNA 2SBTA 5EVJA 1KWGA 3ZPXA 1T43A 4KJXA 4EJ6A 3L8YA 1EKXA 3TMYA 3M4ZA 4A16A 2I1LA 2AJPA 5IC6A 1UMKA 2XIJA 2HRDA 3PWKA 4HXGA 2QUBA 4MDFA 3HCWA 1W85A 3C3CA 5G3YA 1V8ZA 4ZO9A 1RBZA 3AQ4A 4DJ5X 1LBIA 3RPHA 5ALDA 5BN3A 1UK9A 4G5FA 4KKVA 4FQ8A 4Q3LA 2WHEA 3NDBB 4Z0PA 1T4CB 4ZN6A 2WSSD 2VH5R 3TTVA 3IMCA 4R6WA 3GGPA 3KHKA 1S6YA 4YMSA 1TYDE 2GBCA 5HFNA 2AS0A 1W75A 1EFRA 3UFBA 3PFKA 4DLYA 1V48A 4HQRA 4UKDA 2O50A 3TRKA 4ND1A 4OVKA 5KMGB 3AVVA 1M2GA 1X38A 3DMYA 4TUYA 1GGVA 2PMKA 3EMBA 1U2GC 3M81A 1SVIA 4XUEA 2VCYA 4EOGA 3HUFA 1IHOA 3NI2A 3GPLA 1ZOOA 2DERA 2OC9A 1SOUA 3MGCA 3LC0A 2IRWA 4XR4A 3CSDA 4Y9DA 5JECA 1V4BA 3IUSA 1XHFA 3PDWA 2BFBA 1N2SA 3LUKA 4YK7A 1WQ4A 4D5EA 1RRMA 1WDLA 3DZDA 5GV7A 2I4TA 3C85A 3HCEA 4JR2A 3TLJA 2XKJE 3O4IA 1REQA 4DDTA 3D2CA 4EUNA 3JQDA 3E22A 3AI2A 3PI7A 3AI1A 1IATA 3D3NA 5UKDA 5KZMB 2OAEA 3L5OA 4YO8A 1PFYA 3DLHA 3HJUA 4IOLA 3HO8A 3TLCA 2W90A 1PD0A 4S3MA 1M54A 3SNHA 3I9NA 1OOEA 5FNVB 3GLKA 2QY9A 3OBIA 1FLNA 4HNGA 4K6KA 1O54A 3FCOA 5AJXA 3UW3A 3WKDA 2ILTA 3G3EA 4N82A 4A82A 1MJHA 1L2LA 2NO1A 3SJAA 3NTOA 4CMAA 2HJVA 1SNYA 3SVLA 4A4DA 1US8A 1EDOA 3GCWA 3GYGA 3WJ7A 5FAKA 2O2XA 1Q92A 3ITNA 2WU8A 1S9HA 5EIHA 5D3ZA 3VV3A 4CM8B 2HNAA 2HRBA 3D1LA 4G5HA 1ISPA 4A92A 4KR3A 2C7RA 1RZRA 4ZT3A 3E9ZA 5BVHB 3MNFA 2BMVA 1WUHS 4RK6A 3RIMA 3DZKA 3PUYA 5BWOA 3C6ZA 2H4YA 3KWFA 2CNBA 4UM5A 3V9PA 4DRXA 4F72A 5FUMA 2PKFA 3C15C 2C20A 3NR2A 4DCMA 2CD7A 2PUVA 1GIAA 2IKSA 3O8NA 4KVFA 3TZLA 4ARSA 3WO0A 1GGHA 2JGEA 3LO8A 4MMXB 3VSDA 5A3QA 2ZIXA 3A9SA 3O8CA 5C5CA 2G63A 1WMAA 2JA2A 3LHIA 3S8EA 1G4AE 3A14A 2ZT8A 3KJGA 1M10A 2VNKA 2HN9A 4MAFA 4R1NA 4NP6A 5JYBA 5EHGA 4M0LA 4GR5A 4HDCA 5LQSA 3ZW9A 1F6WA 1W8DA 3VVLA 2PLFA 3SYTA 1OA1A 2PKQO 1WF6A 1U9ZA 3EVAA 5CW2A 5G0TA 5F2NA 3L1VA 3G02A 2JG1A 1TMKA 2OCBA 3V8EA 3G2MA 2PBLA 2ZIEA 4FGZA 4X24A 5FUYA 4ECEA 1GUBA 5AK5A 2XXAA 4R2KA 4XB6B 4BV3A 4EHDA 5KOIA 1CDEA 4II3A 5F9FA 3OCWA 3K1TA 1GNRA 4LMPA 4OREX 3QVMA 4YI5A 1C4XA 2FN3A 2IS1A 3HCBA 4IPTA 4UHFA 5IM4A 2VBFA 1QH8B 1JIIA 4GICA 1K1EA 2XRMA 3BGSA 3DDCA 3E9DA 1UKAA 2OV4A 3QJGA 4JT8A 3ZZ1A 4XX1A 4HUJA 1YI8A 1Z6AA 5AW9A 3IODA 2E87A 4PV7A 1J1IA 5D3MB 2OG2A 3PWTA 4ICIA 1IMJA 3T12A 3G2HA 3MPOA 3HC7A 1DMRA 1G8GA 2RAFA 4UBNA 2PCLA 4JI6B 3SBOA 4DSUA 4EPTA 3K1ZA 3SZUA 1J99A 2P2GA 3N9IA 3PIRA 1ZA1A 1UB0A 4R7ZA 1V16A 2O3RA 4J2OA 4ZTZB 4S1VA 3PDJA 1MC5A 1ZOPA 3O03A 1PU2A 3E3MA 2P2DA 3A37A 1Z2PX 3BMCB 5E7IA 2WAYA 4YMUA 2K2QB 2YWXA 4IQGA 3B1RA 3HUTA 1YMQA 4BBJA 2PR7A 4QDZA 1Q50A 1SBHA 3T52A 4Q34A 4YGYA 3BX1A 5IHPA 3C45A 3LL7A 2XTAA 3Q40A 1ZSNA 2VKQA 4HS9A 2WVAA 3L7AA 1BEEA 4K9DA 4NZNA 1GTRA 1GSIA 3C48A 3KNZA 2OV8A 1AKEA 1ZN8A 2NU9B 5JEDA 2ATVA 1EE2A 2EJUA 2OFFA 2P9TA 3HJCA 4NNPA 4UU8A 2FWPA 1AB5A 1E3DA 1C4KA 1OTYA 1OBCA 4PIMA 4R8RA 3WFIA 3ZG6A 1GAEO 1HLPA 3AC0A 3LAWA 4Q1DA 3U0BA 3RQ6A 6CHYA 2VXYA 4RAOA 3HXTA 4B0PA 2BHSA 3D4IA 4KBGA 3B3QA 1G21E 1X7DA 2EOAA 3N07A 3NBQA 4V03A 4A2QA 1KI1A 1B0AA 4DNFA 2CJXA 1HL7A 2Q3HA 4MLZA 5CT4A 1AO3A 5F7JA 3VPAA 1R7RA 5JQGF 2CT8A 4A8JB 1Y7HA 2HPHA 5BV2P 4LQDA 5G1NA 2D3WA 3Q85A 3S1AB 4TPKA 1LTHR 3BFKA 3EISA 2YJ4A 4AO6A 4J0QA 2XZOA 4HLCA 1T3HA 3HBLA 1JZTA 4ZMSA 2VJMA 3OHPA 2WKRA 2ENWA 1W4CA 1YS7A 3AO0B 3F2IA 5AHKA 2FSVA 4HLDA 5IXJA 3TNYA 3RJZA 5BRAA 2I80A 1C9YA 2NQTA 4H59A 2ONZA 1QK5A 2P6UA 4QAQA 3W7BA 5AM0A 1TM2A 3K4PA 3LDAA 3NB0A 4X44A 2DMRA 2WUWE 5ICCA 3OUTA 1TZBA 3UXHA 2Q28A 1W96A 4AU1A 1YQGA 1VPWA 1PBNA 5B1DA 4BXOB 2NUAB 1VJ0A 1B8VA 3T3OA 1V1JA 1X8JA 4J8PA 4MTCA 3Q8LA 1JLRA 4GX5A 4EA8A 3AM1A 1KIMA 2XMCA 4RPJA 3TZEA 4DCTA 4REMA 1JKIA 1BXRA 1OHHD 2Z8ZA 1Z47A 1ISRA 1ZAKA 4PFSA 1P77A 1OZGA 5LQCA 3WAGA 3QX3A 3LMKA 5H9WA 3AFHA 1BFDA 1LEHA 4F0JA 2C5AA 4I1PA 2WU4A 4KWHA 3KT0A 4GM0A 2QK4A 1QG6A 4BN5A 2J3KA 3QBDA 1OT3A 1ZG3A 3OA0A 1YDFA 4GKAA 1EH5A 3NALA 3ZI4A 1B14A 3U19A 1MRNA 1RLOA 4N01A 5CFOA 2HK8A 3ZE9A 1T3GA 3BICA 3GBVA 5TQ0B 4K05A 4MW1A 3FUUA 2BISA 5NLLA 1J97A 4HQOA 1WTCA 2GDZA 4KQ9A 2OB2A 3MMXA 5BT8A 2I2DA 2HSZA 3LW8A 4YACA 4V3BA 2C4MA 3QHAA 2H65A 2GN4A 1G20A 4TT8A 1FDIA 1XC7A 2PNJA 2C2XA 2J9GA 2OCPA 1O94C 3CN9A 4GO1A 3SR0A 1KH2A 1LVGA 2VXOA 2YBDA 2H8GA 3IAFA 4OU5A 4W8OA 5U1PA 2XRYA 3C3EA 2P2ZA 3KPWA 5DYTA 1YKSA 2HAEA 3GD5A 1UFRA 2ZG6A 1O6FA 5KNDH 4NQRA 3GL9A 4WFQA 1USGA 2HU8A 1ZZGA 2PGDA 3UKJA 3OE1A 3W4JA 3OX1A 3P20A 2HBRA 4HQ6A 4B6RA 3R0IA 1IN5A 5K0SA 1EJ0A 5HS6A 3FCCA 4Q4AA 4DLBA 5H8WA 3N3BC 1EB8A 3GA0A 4I6EA 4UE2A 3HU5A 3N2IA 4C7OA 4B6SA 2H3HA 1CUAA 3LFHA 2FPUA 3H0CA 3ND5A 1JJIA 3QYJA 4BTVA 4G81A 4CMEA 5BNWA 5L4NA 4JI1B 3UGQA 3PFIA 1ZUIA 4ZEXA 3BTOA 1JG6A 1I4DD 1RM5A 4AZTA 5FUQA 1GUYA 2UUPA 2ZIXB 4TUYF 2C1EA 1XJCA 4Z86A 4ZVSA 3ZWPA 5FO1A 3CNNA 4DAOA 1F60A 2FAXA 2BBSA 2BEVA 3O4VA 4F85A 5C8ZA 2BKUA 5IYZA 3V2IA 3WLHA 2B9EA 3WNBA 2HQ1A 2GKGA 5B55A 1XK7A 3C3YA 3JQPA 4JI4B 3QZUA 4PXAA 1N0WA 1MFZA 2C95A 1SUEA 2J8ZA 2RK6A 2JAWA 4I4LA 3BSFA 1XA3A 2XUKA 1EWTA 4IZHA 1ZQ1A 4CYMA 4OSOA 4C43A 3EA5A 4LFAB 4L2IA 2BH9A 1Y8QA 5FT9A 1AF7A 1LX6A 1BE6A 4W5JA 4Y18A 4JBLA 4RGVA 3G1WA 1EGVB 4GF5A 1R1DA 4ZO4A 3IT3A 4UNSA 4GYYA 5C5EA 4MUMA 5HE8A 2OAQ1 3SOZA 3H2ZA 2EJBA 3QWAA 2FN9A 2ODEA 4FDAA 4IVNA 3VRHA 1BCSA 2DM6A 5EWMA 4DTIA 1EUYA 3NGLA 2W8ZA 3IUMA 4M21A 4CU5A 5JFOA 1MHTA 2Z08A 2WD7A 3KYBA 4Z54A 5AQEA 3H97A 2NO5A 4R5HA 4GEKA 1CR6A 4F1WA 2IIBA 3C7TA 3CPJB 4GWKA 3OKFA 3TOZA 4BZWA 2R00A 2K2WA 4MZDA 1VI9A 4CR8A 4HNSA 4EG7A 4EAAA 4KH1A 3QOWA 3NIFB 1KJZA 2VAXA 5JWOA 1S5PA 2R6AA 4DJAA 1YZUA 3QXSA 2GK7A 3SR3A 5G4LA 4F3NA 2ZM5A 2C3PA 4OI4A 3KLBA 3CKYA 1Q74A 4AG5A 1EM8A 2HRQA 2VDVE 5DN6D 1E2DA 4F56A 2ZZNA 1XEXB 3CQ9A 3RVRA 3FCYA 2Y6UA 2IZ7A 1SEPA 4G1VA 5ES4B 2Z6UA 1Y5NA 1PFUA 1JHPA 1T8UA 3GUCA 3DHNA 3OOSA 2J46A 3EBOA 3WX0A 3TIXB 1WZEA 2RHJA 4L6AA 1BE8A 2AF3C 2UZ4A 1SXJB 4YAJA 3L49A 2KWIA 5IAAA 2EBWA 1BWRA 4Y98A 1RC1A 2ARKA 2EKQA 3H84A 3D7LA 4ND2A 4PPGA 1A9YA 1ACMA 1STOA 2QAJA 4KQHA 4ZCQA 5JLAA 1OFVA 2ZTVA 4Z99A 3VAQA 4UEWA 2MT9A 3C6YA 3IL2A 4G5QA 2QR5A 3UTCA 4WD3A 3PC8C 4CF6A 5EKTA 2G82A 2BF4A 3JALB 1LDNA 9GPBA 2F1KA 3FWZA 1TO1E 1ZI9A 2H7CA 3D7SA 3L4BC 5DLPA 4CTNA 2EEPA 2NU6B 2O7RA 4LRTB 1E2MA 2DWCA 2WDPA 4B0OA 1K6EA 1SVWA 3S2SA 2DWOA 3GJ5A 4RGQA 4DPLA 1RFTA 3ZXUB 4E94A 4L0DA 3DTVB 4KQ1A 5ALHA 1MT3A 3TFQA 1JVBA 2WWFA 1VHJA 1AMUA 3WYCA 2E82A 2XE6A 3ETNA 4Q9DA 1T1SA 3Q7PA 4KAXA 4ZTBA 3KVRA 2W6JA 3D6MA 1JSCA 2KMLA 3FDZA 2VDLB 4IV0A 4NU5A 2AMLA 3N8NA 2BONA 1M7BA 1J5PA 4AZ0B 4KALA 1CVIA 5BVHA 3GUUA 2EBHX 4M7RA 4NH0A 4XDHA 5ECGC 3W9UA 3EXEA 3KETA 5DHTA 3VBCA 1NKVA 4TV9B 1U7TA 3IHKA 4TL7A 1QYIA 2DT5A 2H52A 3PWZA 3HNPA 3QIAA 5COQA 2QTCA 4G23A 5FFMA 4U9IS 3S7TA 4F12A 3AYXB 4GLLA 2Y9PB 4QUBA 3V55A 3AVOA 5DNEA 3SEFA 3BK7A 5JCOC 1PNVA 4HEA1 3LE8A 4Y7CA 1QNFA 4CL0A 1VGVA 4H7DA 4RDXA 5ICSA 3CUWA 5BSRA 1ZH0A 2CYCA 4DLLA 1EUCA 1NMEA 5JSUA 5MGBA 2XKKA 1OGYA 2DQKA 2G25A 5B6AA 5FOTA 3TB6A 3NPMA 5MF6A 1J7JA 3DTTA 3TLMA 2CK3D 1VHDA 1JB9A 3BOSA 4Q1EA 1VJGA 1LA2A 1R6XA 1YKFA 4A6PA 3FHLA 4IHJB 4LRWA 2P9YA 1ZK3A 1N6IA 1YOVA 3FR8A 2B6HA 2GX6A 5JU6A 3L7KA 2RSLA 3PSHA 1DSSG 3IP5A 3DC7A 3L84A 4NBNA 4Q24A 5DPMA 2F1OA 3OLCX 5K6AA 4N48A 4ENTA 1YL5A 4K1XA 4GG1A 4Q02A 3E23A 4YCJA 5HMMA 5H4GA 3RSGA 1QDUA 5HMLA 3I8OA 1GQFA 1M2EA 3BHJA 1EFKA 5E95A 5AOVA 2QXTA 1XZCA 2R9VA 3WV5A 4WFKA 2C2HA 4TMXA 5BSUA 3BF5A 1X2BA 1XPUA 5SZIA 5AW1A 4XWWA 4AD8A 3LHDA 3DCIA 4FD2A 2ZVPX 5JR3A 1G8AA 2WT8A 3G2KA 3KUDA 3TS1A 3ZCQA 4F8YA 5AVVA 1KAMA 2IHNA 2QZZA 2I03A 1IQPA 2AZDA 3LY9A 1HEYA 3IO5A 2H00A 5JYEA 1RZUA 2FUKA 2YC4C 1QBKC 3ICOA 3BCRA 1YR7A 5FNVF 3E0XA 4BMDA 4DV0B 1DC8A 1X1EA 1N0UA 1G19A 1VKNA 3MT9A 2B0JA 2ZAOA 3IVGA 2KBFA 4PYIA 4MYUA 4E33A 4MWEA 5F4BA 4RYLA 2LCIA 4CLRB 2X0NA 3G2JA 3L77A 4ZDIA 5JNRA 1VM7A 4LSWA 2IITA 4Q16A 2DYKA 3ECSA 1E79D 1JHVA 4G4GA 3OIUA 3QQ5A 3S8MA 4FUTA 3T5AA 1ZCZA 4KR7A 4HYTA 1IJEA 1J5XA 3BFXA 3MN1A 1NBOA 2ODAA 2IOQA 4WEOA 5J4VA 4PHHA 3O8QB 4XB1A 1C0PA 2OBBA 2CCJA 3SXPA 1YDMA 1O5ZA 1TTHA 1GVHA 1IMOA 1UCFA 2GSWA 1M2FA 2WJVA 4OKNA 1RCUA 5K3FA 3STTA 3ZW7A 2QLBA 4MDEA 4FZRA 4B6GA 2Y0EA 3CW8X 1I2BA 2DPLA 4FILA 1KJWA 4EW2A 3HO1A 3AKEA 2I3AA 3C3KA 1J2UA 1QGUB 3CLHA 2QHXA 3DFIA 3GLGB 1GA6A 1JR2A 2NZVG 4ISCA 4CKWB 1LJUA 4UHKA 4TKUA 3RV4A 1IBRA 4LTMA 1RFGE 1JGTA 4DRZA 3R9XA 1MZPA 4KO3S 3THXB 4B4UA 4EGQA 4C1NA 3HCCA 3K9GA 3PSAA 3Q3VA 3QSGA 4N39A 1T91A 4Y8VA 1XIVA 3L2OB 4YP5A 3Q5EA 4NAHA 3Q41A 1G2QA 2ZUFA 4XCXA 1VMDA 3DOEA 1VL1A 3DLAA 3UQEA 4XFKA 1LF5A 1WHSA 2QS9A 4YUZA 1AOXA 4ZQHA 1BKDR 2OD7A 2X8JB 1SA0A 1T5DX 4CFZA 3UBOA 4EN4A 1F4LA 3ZDCA 9LDTA 3ZV3A 2ZVQX 2XJ4A 3CVYA 2O9JA 3FGPA 4X7PA 5JVDF 4FI3F 1KR2A 3CYFA 1NC1A 4O25A 2ZRBA 4KFSA 4RV5A 4WE3A 3MJEA 4M87A 3IEIA 4F4IA 1U7HA 3GLFE 3DOJA 2HA7A 1T8TA 1I5EA 1A50B 4DT1A 5CLIA 4R7TA 3EE6A 3WYBA 2FI1A 3Q8WA 4KOEC 1KAGA 4GBED 1H23A 4PNPA 5TXGA 3UPTA 1GTVA 4YO7A 1JIQA 2X7JA 3TCNA 3TRJA 4YJGA 4BV2A 1ZUD1 1O94D 1O7JA 1C7RA 1SJ9A 1F9EA 1IUPA 4XM1A 4GZLA 5TNXA 4M1TA 3ZX5A 1KJQA 2O1XA 4JGIA 1WMDA 1ZSVA 4PM4A 3GU3A 3NGMA 3VOSA 3ZY5A 5CVTA 1KVTA 2IEIA 4L5CA 3BWDD 1SN7A 2J7PA 3VR5H 3NM1A 3IX7A 3UJPA 3L4KA 1CIPA 4RTQA 3DZ8A 4J16C 3D6UA 5IEJA 2YWGA 3KQTA 1H2RS 4LBYA 1RYDA 3WB1A 1IY9A 4R2JA 3SK0A 4DPKA 1N78A 3VR4D 2XCIA 4NAUA 2D1QA 1XQ1A 2HO5A 3I39X 3LQ4A 1FPMA 4MWGA 2Y1XA 3A6LA 3C8ZA 1DMSA 1TJPB 3HEAA 4BZXA 3GAAA 4ZZ0A 5JALA 1QP0A 4YL5A 1XKXA 4UDXX 5DBEX 4WL0A 5FCDA 1ADFA 1QH1B 5FPSA 2XBLA 1NG1A 2I66A 3BVPA 4FEGA 3SJBA 1BE1A 1DJNA 1CCWA 1GQ2A 3TNJA 3ZUPA 4MNTA 4DA9A 1J9ZA 1YQTA 1KMNA 4MYHA 3ADKA 1PZGA 2IV2X 3B5EA 2YMQA 4FR5A 2JFXA 3WLRA 3NDIA 1PGNA 3LL4A 3OOEA 4IJ6A 3LCRA 2HF9A 2J9ZB 3IDZA 3B3JA 4YJ3F 3CEHA 4PEVA 4JCCA 3IURA 5KTTA 1FUUA 2V4MA 1D1QA 1UXHA 1A7UA 2E89A 5DKFA 4C9BA 2JGRA 3ESQA 4KBFA 2BGLA 1E6CA 2QQGA 2J33A 2QR2A 2RC5A 1G6KA 1SC1A 4JVOA 2W8BB 2BGWA 1A8UA 1RQXA 1LSUA 1NJSA 1AUVA 3O4FA 3V8BA 5KNCD 7ADHA 1RYNA 3CA8A 2DUNA 1SXJE 3CH5A 3D54D 3QK7A 4KAAA 4YVFA 3JALA 5JNTA 4A8PA 4HO1X 2BFOA 2PX6A 4X85A 5KVAA 2RKWA 2ZUVA 1QIEA 4X45A 1DKQA 3FBWA 4V2IA 4YDQA 1KYYA 1M0WA 4CIYA 1NYTA 4U2BA 5I4CA 3RAPR 3NX4A 5FDFA 5CA0A 4DY4A 1AHHA 1G5IA 2OG1A 2QZSA 3MS2A 2XT0A 5C4MA 1JA1A 4HVAA 5IMBA 1A7AA 2ASEA 3R76A 4A03A 1IZ8A 4DRYA 7MHTA 1DG1G 2DTEA 4JBIA 2FEWB 3U2QA 3DO8A 4DADA 4P34A 3EPJA 2QBYB 2HZBA 1MIOA 1GITA 1Z25A 1K6MA 3OFJA 2GN1A 1LCIA 4NHEA 4KGXA 5BMVF 2XNHA 3CLUD 3VXKA 4ND6A 3S68A 2I22A 4CMIA 1EFTA 2G77B 4PYMA 2Q5IA 3LDHA 1C0IA 3BJEA 1TLFA 4FOPA 3QE2A 4OP3A 1BIFA 2Y2VA 5FPQA 4KREA 1GNVA 3HLYA 1SCUB 2WP0A 3QPWA 3VPCA 4C7MA 1QHNA 2FSFA 5CNIA 4RNCA 3TPFA 4BV8A 2NTYC 5ADHA 2XODA 4NPCA 3UWPA 4V2UA 3DXXA 3FNIA 3DKPA 3OU2A 4FFOA 4NQZA 4OD0A 3RU7A 4E2FA 3A0UA 4HEA6 4CGYA 3U5ZB 4YP7A 4CDGA 4RTPA 3DHYA 2GWHA 2VF5X 2FH5B 4OHUA 1NLUA 2Q6LA 1O95C 3H5IA 1QGDA 1C2YA 2EFHB 2G36A 3NHYA 4YRPA 4B17A 3CRZA 1MAVA 3DV0B 1JYEA 1KPIA 3M1LA 1LQ2A 4XD7D 3RNOA 1Q7EA 4RZIA 3W4SA 3ZDQA 1EFRD 1ZGBA 3A1VA 2NZUG 2FHPA 3OZEA 1O89A 5KKCA 5ITSA 2HCTA 2PGLA 2WJZB 5B2FA 2FFHA 4ZEVA 2JAQA 2UZ1B 1S7GA 4PCUA 5G3ZA 4C05A 1WQ3A 1NUSA 3NETA 1CEQA 3WKCA 4LXTA 2XADA 2ZCVA 4PQGA 2QLFA 1WCV1 2R1ZA 1Z7WA 2UZ1A 3EVFA 1NUTA 1V2HE 4IIYA 3BB4A 1TEXA 2REQB 5LLDA 1CUDA 2G8NA 3GH1A 4RSGA 1T9DA 3FKJA 5ES3A 3RHSA 4COOA 4M22A 4ZGWA 1P9OA 4Q4CA 4FHCA 3QPUA 4KQMA 4N09A 2AJ8A 2W2PA 3WYNA 2OSVA 3OPMA 4MP3A 3CW9A 4F04A 5AVUA 1T6NA 4RY0A 4BBPA 3IUNA 3NWOA 1S4MA 2AB0A 3GBPA 4N40A 4PYOA 3VU0A 1RFLA 3BE6A 3MUOA 4K6GA 1L4EA 4MLCA 4PW0A 1C3LA 4Q6BA 2IYYA 4DCSA 2BL4A 3FX2A 1EHCA 1L4MA 1KO5A 1XRNA 1XZBA 3LOUA 2D2XA 3M6WA 1MO2A 4J7CA 1G20B 4YFYA 4NR0A 3T3HA 2ZYRA 1XVUA 3MRSA 5AJWA 1CE8A 5DCLA 3F78A 3HGTA 3AI7A 4EB0A 1ODJA 2PRZA 2P9EA 5AMXA 3T9DA 5CLJA 4QHTA 3DT9A 1F0NA 2IUEA 2RHCA 3GIWA 4B5LA 5A6VA 2RBEA 5KYNA 2GR9A 4PLVA 4RA9A 5FBLB 4D96A 4L6IA 4MRPA 5EHXA 4I46A 2O1WA 1SXHA 4LZOA 3RU2A 2XUIA 4ZI5A 4TTVA 4L5IA 2Z2ZA 3KJQA 1JALA 2ZZKA 3RI3A 1E9DA 4C88A 1F2UA 1LBTA 3U7RA 2SKDA 3UJ8A 3PEVA 4DE5A 5KWEA 4GM6A 1JZSA 2EIXA 2FP4A 1P5ZB 1RZVA 4PBSA 1ZI6A 5AKYA 3F4KA 3LRTA 1B2LA 1YHZA 2ACVA 2GZ3A 3C39A 1DZIA 3LZCA 4IX9A 4KSCA 4F46A 4WOKA 5K5EA 3DE1X 4BDTA 3OPYI 3IC5A 4M54A 5BSGA 2NUPA 2GO7A 1VLHA 3MWDA 1E4VA 1N2EA 2QN3A 3QBJA 3SIRA 1U4NA 3OIYA 3SLRA 3AL2A 4YQZA 3NH9A 1GXSB 3KUXA 3THYA 1VI6A 2YHIB 5EXSA 2ZSJA 3KKZA 3QFHA 1KP9A 3CX7A 1IBCA 1OMOA 4PLFA 1FFGA 1I7QB 2DETA 2WF9A 4CF7A 1T6ZA 2XNSA 3ZI7A 1QIFA 2BJHA 1TCCA 1EUDB 3FYHA 5HCIA 3PCTA 2ZKIA 2BKAA 3QFTA 3SM3A 3X1KA 4AB1A 3NBVA 1MCZA 1JIVA 1KJNA 2ZZMA 2CLDX 1CLUA 2XQJA 2ZOSA 5ALXA 3BCUA 3CJTA 4EJSB 5ITZB 3GZJA 4C7BA 3AXSA 1W6RA 3IPXA 3BWEA 4HBGA 5JNUA 1QVVA 3U3RA 3D6HA 4RIHA 2XECA 5ER9A 5JS2A 5HK8A 2OENG 1E4OA 1Y82A 1R00A 2X42A 4A0GA 3R8FA 4JLKA 5EXXA 2OCIA 3EPRA 3OQPA 5LOVF 4CI9A 4HQFA 1IOZA 2LR0A 1DFIA 1GNPA 5EP4A 5H83A 1BG6A 3HO6A 4DJEC 3UB2A 3DFUA 1OLSA 4KX5A 5EJ7A 5JCXA 2XCSB 1PYGA 4RPKA 2G88A 2GPBA 1V3QE 1T5BA 3B60A 2HHHB 2F62A 3WIVA 4E32A 2YR0A 4IGKA 4C0XA 3AONB 1KL7A 1VCIA 3PB3A 4JCOA 4EG8A 5FPYA 3GG2A 1TAHA 3BH7A 1YFZA 4ZVUA 4B4OA 4BC0A 2E5FA 4IS2A 1DS6A 1JJFA 2XCQA 3BWMA 3HA5A 1VHLA 4YJHA 3LYAA 3V2HA 5BW4A 2GYUA 1GZ6A 4W6ZA 3FYUB 5FOXA 4EHHA 4I9UA 1D4ZA 4CMIB 2IYFA 5F33A 2E1PA 4B3HA 1ZZEA 5AFSA 2HW8A 4IKOA 1F2DA 1JXAA 3QMWA 3Q3IA 5E9WA 1G5HA 3GNLA 1UBHS 3P2IA 2HU2A 4NS1A 4J76A 5FUXA 1TD9A 1CEXA 1MX9A 1Z7YA 2FZWA 3LT1A 1W94A 4W9NA 2PWPA 4J4HA 4V38A 1JQJC 2W00A 4M60A 4UM7A 1H0KA 4MITA 1CETA 3IOMA 3MZ0A 4KQFA 3BXOA 2Q6OA 3MTQA 3PA6A 1THGA 4LQCA 3TSOA 3KEMA 3IAXA 4N5LA 4EYQA 2PZAA 4LHVA 5F78A 4JJEA 4ZP1A 1IN1A 2KX7A 3DBVO 1NMZA 3C3PA 3EGDA 4HKTA 4V0OA 3RS9A 3UMJA 2QMHA 1XB2A 4BQNA 3T7IA 4EHAA 4JBWA 1XXHE 3EEBA 2OHOA 5IZCA 2IUFA 1MLDA 4RCYA 1OJLA 4YJ2B 3BWVA 4BO2A 3AJEA 5CDHA 1QFMA 1Z2EA 4QL3A 4LRYA 2HSJA 2J30A 4NCJA 1CS0B 1DBWA 1T9GR 1GPAA 2OCAA 1JUDA 1NM5A 1Q84A 3FSEA 4ZVLA 1QIJA 1Z0KA 3LT0A 2HIHA 1KQ3A 2XX3A 3REQA 1PTKA 1R6UA 4BFVA 1QOZA 4RDHA 4YRDA 3HJAA 3OIVA 4LYEA 5CTJA 3W0LB 4QLOA 5CEJA 4FMDF 3FI9A 1QKJA 2H9AA 3KTAB 5CM5A 1QHHA 2QROA 5MHTA 3P9NA 2UZ0A 3UO8B 1E2JA 2FN7A 1MD9A 4XEUA 2F4NA 4KPEC 2A78A 3O8OA 3E7XA 5CDFA 3ZE8A 1TQ8A 5J2UF 2XVYA 1SCJA 1N2HA 2FPWA 4GI1A 3RS3A 4E8WA 3M7IA 4A2PA 4YXFA 1M34A 4YLEA 1N4AA 1OIWA 2WUEA 2ZB2A 4FE3A 1Q16A 1XLUA 1H4QA 5JJCA 2I6XA 1R4NB 5C8XA 4TVOA 4NMLA 5CLHA 3HN2A 2R5WA 3H05A 2O19A 4EUMA 3QEMB 2WV7A 1C7ZA 4FEYA 4LOAA 1GPMA 1I10A 4GNRA 5AJVB 4BWFB 4RPIA 5IN5A 1K5PA 2OCLA 4C6SA 3COJA 1U8CB 3ZHRA 1DWUA 1CUBA 1Q19A 4FFDA 2WZDA 4WZBA 3WKBA 2E1RA 3KZNA 1FL9A 1ZD9A 4YX9A 2ZYAA 1EGQA 5C8VA 5ALTA 2VTDA 3U9SA 1JA9A 1HA3A 4D81A 2B7BA 1MRSA 3QLUA 3H16A 1T1IA 2Q4OA 1K63A 2DULA 4QFBA 4C7KA 1H22A 5DNAA 2H2GA 4BRSA 5KSOA 1E2KA 3UCFA 3ZJTA 1BA3A 1Z7GA 3KO8A 2I7CA 1Z0ZA 2CB0A 1HXHA 3JYHA 5ECDA 3G8BA 1BWPA 2JGDA 3DP7A 1R16A 1VL8A 1X7HA 2VHWA 2VTVA 4H4DA 4KK4A 2VT2A 3L4EA 3KTNA 4YY3B 5SYAA 4H18A 4DA7A 4DWWA 1GZVA 2PQ0A 4YAKA 4ZFNA 3WGTA 1O5IA 5JCJA 3RM5A 2H5IA 1F8YA 3K0CC 3ZBUA 4KFRA 1GSOA 2YCLA 2OD9A 3IP9A 4P53A 3DMHA 5GMOA 4BVGA 4DA6A 5JS6A 3F73A 3E82A 4S05A 3H3JA 4I3FA 3CMMA 3ZHCA 3FLAA 5K0ZA 3U6KA 5H81A 3NKLA 5EJ5A 4UHHA 4XKJA 1YGJA 4LJ8A 1ZOLA 5DTRA 3CKKA 3B3AA 2PS0A 5CA0F 2WVHA 3OVMA 1Z6PA 3AV3A 2WTUA 1WPRA 3QA3E 1P0QA 3A7DA 1CERA 1DQSA 1VL0A 4UUNA 3WLFA 5A71A 4KQXA 4KMOA 1XP8A 2R2GA 2WZBA 1ZD3A 3MWFA 5LOVB 3KZMA 2Y0CA 1GN9A 1PJ3A 3RVLA 4KR2A 4R71A 1JNYA 1XCJA 2H0AA 1UJ6A 3CZAA 2RH8A 4UUPA 4ACBA 5I4KA 1KIAA 3N8GA 1U6JA 1L9XA 2G07A 2JJ8A 2V7GA 2XV1A 2JLWA 4I8IA 1A4UA 2B8WA 2JD2A 4F84A 1BKYA 3FHTA 3HLTA 2FETA 2D62A 4PX9A 2YY7A 4YJFB 1J49A 2PZLA 3JARA 1XFAA 3P19A 4JAVC 5G0VA 1RJWA 3ZWAA 5KYYB 3CRMA 4NSNA 1H8EA 1TB4A 4RKRA 1NQOA 3K9LA 4FKMA 3SICE 1ABEA 4YRMA 3GO7A 1AGRA 2P5YA 3SC2A 2PUJA 3ASVA 2QX6A 1NZJA 3GEBA 3ICVA 1T0IA 4C5CA 2SECE 4C30A 4C21A 4Y9RA 4JSYA 3FHXA 2H16A 3MBJA 1I1OA 1NWCA 1QCZA 2ZWIA 4G0ZA 4ZIRB 1N77A 2QTGA 3Q7EA 3UMYA 4RVNA 3C8MA 5K6AC 5AUQA 1J00A 1HYBA 1WNTA 1YQDA 4MW6A 4PZYA 4DRXB 4DEVA 5LQRA 3VPBA 2V78A 2M2IA 3QPAA 3R5SA 2EQ5A 1AKTA 4Q9KA 4O1LA 4JLSA 1KEKA 821PA 3U5TA 1RHJA 3RHZA 3M83A 2JBWA 1DAMA 4OAQA 1RQLA 4LC0A 2IP2A 1Z16A 1A7JA 1U9IC 1R5NA 2XGOA 1YS1X 3W5IA 2X2EA 3GNQA 1DQNA 4K8PA 3K4HA 5J4HA 1EQAA 4X00A 1PVVA 1QF6A 2R6GA 1D5CA 2WNHA 5B5SA 4AP6A 5C32A 3FPEA 1AS2A 4GX1A 4RVSA 4ZT5A 4KN9S 3PR2B 1OH8A 1SUBA 1VMIA 1HY3A 4OBWA 5ARDA 1P2GA 2R751 2YXDA 4IYRA 4RVFA 4IGFA 4BLRA 4EPRA 2UYQA 1WUIS 4L3VA 1MPTA 1ORTA 2WIJA 3DL2A 3O1JC 3ORFA 5H3LA 5DW0A 1ZDMA 2VA9A 3MUNA 4WKOA 1FDTA 4I3HA 4URUR 4OGFA 5JXHA 3IA2A 1VPLA 3H3XA 3MOSA 1LC3A 1NBMA 4JUDX 4ZDJA 2QYTA 1CNFA 1B1AA 2Z83A 3K71B 1M6HA 2A9OA 5E8RA 2PKRA 2OEPA 3PR1A 3WWDA 1JFRA 4UZEA 1P4RA 1S0UA 3QKRA 4ZAFA 1QONA 3UUFA 2DLDA 3USZA 1CZKA 3L6UA 4IIFA 2A7XA 2I6QA 2Q5EA 4RANA 3TR6A 1H4SA 3GELA 3UWDA 1AXEA 4BMNA 2G6TA 4DMUB 2Q1SA 3NRCA 5DBIA 4QDUA 5A5EA 5ED4A 4OJNA 2YUTA 2C8LA 3EFHA 1GGJA 4NYIQ 3WJ2A 3A4VA 1F0YA 3WLSA 2FMXA 2VNJA 1HPLA 4RLSA 4GZ5A 1FC0A 2ZYTX 3IR6A 5IDYA 3U6BA 4UCFA 3HACA 1D6JA 3A6DA 4YJ3A 5EHNA 4JR0A 5MFZA 3WMRA 3PC7A 5IT4A 2HR1A 1OD6A 1ZVJA 4NARA 4YRZA 1YXMA 3PQ4A 5I7EA 3HTXA 1ESNA 1E4EA 4BO1A 1MU0A 3D5QA 1HEIA 3EOAI 1U0RA 4BFYA 1Y4DE 2FPPA 3C5VA 3E2MA 3GLSA 5TPZA 1H1DA 3FW1A 1D6MA 2ZCUA 3HL0A 4ZT6A 4O8ZA 4YPVA 2RJ3A 4ZQIA 1XP5A 4GPTA 4MPPA 1BGXT 1IQ0A 3ROQA 3KOXA 5BW5A 2RARA 2IS4A 3EN0A 5ICMA 5A04A 4B45A 3KSZO 1CTQA 3IP3A 1QVZA 3PXUA 4N6NA 3OC6A 1TMOA 2VHVA 5BSVA 2QN2A 1CY1A 1XZAA 1FGSA 4D0GA 1L5WA 1UQUA 4AP5A 1CQIA 5A4KA 3WTBA 4G5RA 3AP1A 4F45A 1Z4IA 4U7HA 1UINA 3KSBC 3NBKA 5BV1A 2ZS7A 2B4TO 2CHFA 2PV7A 1B8UA 3UWOA 3JVUA 4X1YA 5CITA 2K7FA 2W0SA 4W5WA 3Q2KA 1YGYA 4PU0A 3SC4A 1G8SA 1E96A 3VHXB 3WBJA 5TQIA 1L5SA 2P5TB 5ALZA 4M9UA 3PTAA 5DMHA 3DO6A 5IDVA 4MUNA 3UWMA 3I8SA 1L4LA 2ZJ8A 3C3BA 2CLEB 2E4ZA 4OYLA 4LWQA 2GNPA 2GPJA 2IHTA 3Q6MA 4IGIA 3O8DA 5ETJA 1KZ7B 1UEXC 4PRKA 5T41A 4U7FA 4EHJA 1OV6A 1QQ5A 3FJYA 4DHWA 2FFJA 3RGGA 3QU4A 3ZKWA 2I3GA 4KZKA 3JAWB 1E4EB 2XA9A 1Y8RB 4HLUC 4R2XA 1AQJA 1FK8A 1A5TA 1WDMA 3RR2A 2ZK7A 4RWEA 3PA8A 4IVRA 4H15A 1YA6A 4YAWA 2C1ZA 2CN1A 3JQ9C 2PLAA 1T5SA 3H18A 4PSAA 4U7JA 3COSA 4RPLA 1A9PA 4ARZB 5LD2B 3LHKA 3CJQA 1Z6YA 3DFKA 1C29B 3FOAA 4I5DA 1H65A 1FRVA 3AFIA 3KAQA 4OQ4A 3JZFA 4XSGA 5FIUA 3DUWA 5HKKD 2WQ7A 4GSKA 3D3QA 4C01A 5JHGB 1JAIA 1RDFA 1ZJZA 3PXCX 4JITA 1RFUA 1NE2A 2AJCA 4ZI2A 3QKRB 1RHUA 1VZ2A 4IIXA 5G0UA 5TC4A 1XAGA 4DIDA 4ZV7A 3EZNA 2QUZA 3CW2A 4WCFA 3CGGA 1Q22A 5JG7A 3U3OA 5C7LO 2NXWA 1R5JA 3P94A 1T4DA 1T9BA 5JROA 5AJYA 2XCRB 2IXTA 3NTLA 1XQVA 1NDQA 2X3FA 3ELBA 4DABA 1F38A 4IZIA 1BAPA 2QV7A 3WLNA 5L7TA 1VKZA 1U9JA 1JRLA 4C29A 3IAM6 3PGMA 5FHRA 3T4XA 2CUTA 2E6KA 4D8TA 4MW0A 1XAIA 1WF3A 1XEAA 1E32A 3BIJA 4M0MA 4R2IA 5CB0A 4QJ4A 1BRTA 1WCYA 2VSOA 5HCNA 1BHQ1 4XFJA 5FWXA 1X6VA 3TRHA 5B1EA 1XKTA 1C1HA 3GRFA 5ALVA 5BV7A 2X77A 4LOJA 3JZDA 1JZQA 2D74A 2QIPA 1K7FB 4BN4A 4C0BA 2DOKA 4IMRA 2YW2A 5BQFA 2B0CA 3KXKA 4ZODA 3TW4A 2GJ9A 4RDCA 4O4LA 1YQ9A 2WYUA 1JVSA 5IC5A 3DR3A 2IEAA 1XPOA 4CLDA 3R23A 2GZDA 1TVCA 1JG4A 4JC0A 5EVCA 2ID4A 4K2HA 3ESCA 2Y92A 3VVBA 5BN1A 4PN7A 1QS0A 2HQRA 4XYBA 2WSLA 3NHRA 3ENZA 4OY3A 2QE6A 2QMQA 3TVYA 3FVRA 5AM5A 2A4MA 2UUBB 3PXBA 4N5HX 5F12A 1NJFA 3P2YA 3A1EA 1Z0AA 3DAOA 4Q37A 3MC1A 1WHTB 1QF9A 3UATA 5K2OA 3PUIA 2G5PA 1NUQA 2O8NA 1TU3A 2R68A 3JQAB 3KZ1E 4K1LA 4MS3B 3SX2A 4DTCA 5JXJA 2DLCX 1ISSA 3EZLA 2WJHA 4FFVA 3RUAA 4RQBA 3IQWA 3Q72A 4TOIA 2P35A 4M98A 4QU9A 2JLUA 4IIJF 2VWPA 5C7IO 1DAPA 4DY6A 1O58A 1LVUA 5CFNA 4UTRA 3EFBA 1XE3A 1QIIA 4URWR 2QXUA 1Z12A 1PL0A 3WQQA 1Y1QA 1VDMA 4REQA 3PUJA 4K8KA 2JATA 5EYPB 2I8CA 4WZAB 3W79A 1J33A 3MMZA 3ZK8A 1NTRA 4Q7QA 1CBUA 1BH6A 4D25A 4BGUA 1VGQA 1Y8QB 3UMCA 1Z88A 3DNMA 5JAMA 4O3MA 2GAJA 2AQIA 2FPRA 2EWMA 5FEUA 2BTOA 5JNVA 3GJ8A 5IJAA 2Z5LA 3TRDA 4U6QA 4WLEA 2C7QA 2Y6VA 1Z33A 3NONA 1XTQA 3VR4A 3HGQA 1MENA 4D4MA 4RTRA 5K3DA 3HJFA 3WHIA 2WJ3A 1ZITA 3AFGA 3DBHB 2R5FA 3VKWA 4LCEA 3ZVLA 3DT8A 4O1MA 4W1RA 1JLKA 1VFNA 3M6IA 3SYLA 3TXAA 1KK3A 3AUXA 5BWLA 4GMFA 4IL5A 3SHQA 3D6VA 1TCVA 3ZTWA 4AWAA 4JBYA 5LR6A 1ZWKA 5DM60 2IOFA 2A1TR 3LBHA 2P9JA 4DB4A 3RK4A 1C7IA 2QE7D 3DZBA 1Q6YA 2AQHA 2XQVA 3O3OB 3T06B 1AVTA 5KNLA 2WWTA 3RYIB 3N8HA 4GMHA 1SR8A 3UM9A 4H4CA 1PYOA 3F49S 1JV2B 1X13A 1UBLS 2C4HA 2BMEA 3HYLA 4QU8A 4TS3A 3VR0A 5DGCA 2C3MA 1GAJA 3UUWA 1YS4A 3NUGA 4YUWA 5JQGB 4D80A 1E79A 3WSWA 4L76A 2QUAA 5D51S 3M89A 3RQIA 1MORA 2Q3MA 4DNXA 3RS8A 1HDOA 3TNLA 4PGFA 3ZH9B 2PX2A 4PZEA 5JAHA 1IPHA 1NDHA 2UKDA 1N7HA 4JUIA 4N0PA 4MGKR 3RJMA 3HL4A 3O21A 3V46A 3LNCA 5AHRA 3PVSA 3TIVA 2XD4A 3WR5A 5BR7A 2NO4A 2WTAA 3TLGB 2IY7A 3D3WB 3O2JA 4PX5A 1Y3BE 2CVQA 3HYNA 3JARB 3KSRA 1U8TA 5E0OA 2PYIA 1U2RA 3A6EA 1XAJA 3DCJA 5D85A 4N76A 4PX2A 1Z4JA 1KAQA 3ZJYA 2H7VA 4LJAA 1J2RA 2OFWA 3IP7A 2I7TA 3TW0A 4E31A 1U0JA 4D9BA 1Q0PA 3JW8A 1P73A 3K72B 1WCWA 2QN6A 1BDMA 1NY5A 3RS2A 3TKYA 4M2LA 2PBFA 1BC5A 2TYSB 3HB4X 2QRQA 3BM5A 4W6QA 3ZY3A 5JXWA 3B3GA 2H57A 3VFDA 2K7ZA 5CJJA 4DXDA 1QTRA 5FLEX 1N7JA 2P4QA 1WZIA 1IU9A 2JBAB 1K2WA 3KEOA 4M9XA 3UG6A 3G7NA 2PZKA 3N2NA 3LRXA 4QVIA 4EARA 4BFZA 1OHHA 3DO5A 2GPAA 4QYMA 3V8MA 4UFOA 5K45A 1WKVA 3QTBA 2YWHA 4G0UA 1DEAA 2WTZA 4QBIA 5IBPA 3VR5A 3UC9A 5TF0A 1NAHA 3S8YA 3PQFA 1MX3A 5HF5A 4L73A 4NCHA 2BPOA 2PGOA 3TIIA 2V1XA 4ZHQF 5KSZA 4JXJA 4EZEA 2CKMA 4J3FA 3GJSA 1OZFA 3EXAA 2QVXX 5REQA 2Z2KA 3EH2A 4ZDWA 4MPJA 2YFYA 3T5MA 1BMDA 5ILOA 4L3WA 1MNAA 5A5DA 4MVCA 3BC1A 2WJIA 1XBTA 4LXYA 4Z0HO 3IUBA 2BGMA 4TKMA 5ELMA 1CY2A 1IXRC 1ZSYA 4FLFA 4ENVA 3TDNA 3ZWNA 4HNVA 2C4EA 1SB8A 1RKSA 2Q27A 3G68A 1ZR4A 2BGKA 1PIWA 1Q14A 1Y3HA 1YQXA 2DPGA 2ERCA 2H4WA 1Z9BA 3HV2A 4DILA 3EVGA 2JHCA 4ID9A 4MA0A 3OT1B 5DBOA 2Z95A 1H42A 2Z1MA 3T3EA 1GPUA 4X8LA 5CDGA 1MQ8B 1KS9A 3UW1A 4AZSA 2C5HA 2IE8A 2OXRA 3HADA 3FG9A 4HCJA 2IYSA 2OYSA 2PCJA 3MT0A 1U3DA 5H68A 3AOGA 5LCXA 3I4FA 1PNRA 1CZLA 1T35A 4J1NA 2ORWA 2ZRJA 2VJQA 4Q18A 4C4YA 3OQBA 3VZCA 1YMVA 3UH1A 1H5UA 4Y6LA 1FNCA 4FDUA 1JHZA 2FEMA 2MJLA 2ZI7A 3QLEA 3B5JA 3J7TA 1VRCA 4QXAA 4RV9A 3U1TA 2GC6A 4OB7A 3FUCA 4Y1GA 3O90A 5KSWB 3O92A 2BTQB 3D4BA 1NVVR 2P27A 1EU1A 1PL8A 3AJDA 3IHLA 1IAQA 4GRIA 4L8WB 4Q66C 1PVDA 5C1IA 4AJPA 2AEJA 3RFCA 3K6SA 4K8RB 1ETUA 1PL6A 2DRIA 4RK1A 1G7SA 3EEFA 1BN7A 4YUXA 5KNCA 2VOEA 2ZWMA 3EGXB 4CQLB 4QPJC 3NWPA 4XSHA 1LDEA 4U2FA 5JZBA 1ZM7A 3EVBA 4KV9A 2H1WA 2C3YA 1N92A 2XI4A 3ESAA 1N6KA 4X90A 4HZGA 1T6XA 2A5DA 2ZJ5A 1W5FA 5FL7D 2R4TA 2C83A 3RUEA 1FTNA 2VZ9A 2AKEA 4GC9A 5BRJA 1DG9A 1NGSA 1D4OA 2PN1A 4PC7A 1AA6A 4B1FA 3PI6A 2X0JA 1RNLA 5KTOA 4OUDB 1FTYA 1XJWA 1AGPA 2E9SA 4IF4A 1WE2A 3O38A 4KIGA 3KZKA 1IK6A 3B85A 4MB6A 2GNAA 2PS1A 3C4VA 3BAFA 2YZ2A 1ESZA 3C14C 4Y6GB 2WLSA 3CRQA 3R3WA 4P6VF 2AG1A 5AM1A 3MIZA 4HJXA 1W1WA 4BO6A 5ICEA 1DCMA 1YJCA 3D4PA 1MTOA 1NIJA 4FKZA 4BCCA 3K0FA 1TM1E 3G82C 2IPMA 3KEQA 2VQFB 3BMNA 3BRWD 1F2UB 3PE4A 2PRYA 3CURA 2BDEA 1YUMA 2ECOA 2OM6A 2AOVA 2Z57A 3CGWA 1QHSA 5CB4B 1QIKA 5FI0B 4U7PB 3IUQA 4TXNA 1CYEA 3ZGXA 4O4LF 3NANA 5EMKA 3W6OA 5C5DA 1L5VA 1YWGO 1WDTA 2EDAA 2XTZA 4QEZA 4XIFA 4JQSA 5LU9A 1BD4A 1JU9A 2G9ZA 4BLQA 3PCXA 3ZE0B 2JLSA 1T2VA 1TO2E 3A26A 2Q1WA 3FKSA 2J6IA 5AK4A 2V97A 5FO0A 3INYA 1EIWA 1LS1A 2N9UA 4BO9A 3I1IA 4OLHA 4WZAE 1JFLA 4FFNA 4LSGA 2GLXA 1P2SA 2Y1LA 2OWDA 3QCZA 2Z4SA 1I36A 3H11B 4YUAA 1WA5A 1SWWA 4DCNA 5I7HA 3G8CA 2Z2XA 2EC5A 3LWBA 4BLSA 2QT0A 3EQ8A 2HF2A 3PV0A 3JQBC 4LHZA 1M75A 4C3ZA 4HLQB 3WLOA 4WRRA 1TX4B 3QLUC 5FLKA 5H59A 4KXYA 4MVJF 3RKSA 1YVPA 1E94E 4MMZB 3GNSA 1UWCA 2DC1A 4GWGA 2WR8A 4EFDA 5KSYA 2WTEA 3WBFA 5EKXA 4QUIA 5E2AA 4Y1RA 2PR2A 4ZC1A 5EYNA 3T4EA 4K8CA 3P4YA 2DLNA 3KHTA 1SCDA 1TRKA 2ZPAA 1C80A 2CDCA 3C3AA 3KSDO 4KXUA 3LYUA 5E9JA 2YTZA 4X65B 2XKAA 3ESXA 2D2VA 4OGGA 5CCEA 2F8LA 3B7WA 2OPBA 1FQKA 3K8OE 3OIGA 4NAVA 3K0AA 2HHLA 2X2FA 5TY0A 3MD9A 1VHQA 3QXJA 1L7RA 2J0QA 1PJTA 1ZNXA 1FEZA 3FYSA 3IP8A 4ZYXA 1I0LA 2YV2A 1FFWA 1M8FA 4GPAA 4N12A 3RS7A 3EXHC 4G24A 3A3PA 1MEOA 3FTEA 2XMSA 1XWWA 2FUG6 4BLUA 1Z0JA 3M4YA 1JQLB 3BDVA 4KWCA 5JJIA 4RHFA 3RC7A 2PKWA 3PHBE 4KQ2A 4WH0A 2PUCA 1KH1A 1AD2A 2ZTHA 5CX1A 1UDBA 1X42A 5AO9A 3IAUA 5JH7F 2XQGA 3FDIA 1Q1QA 4O4HA 1FDOA 3E84A 4WLFA 5KSPA 4JYMA 2Z6AA 2BE7A 2NT3A 2H54A 1PZNA 2MDTA 4IMJB 1IUNA 4RFSA 4U8HA 1CJUC 1I4TD 3IKJA 2HU7A 4Y2VA 1EK2A 3HVIA 4BMVA 4BX2A 4DMCA 1ADCA 1AHNA 2VHJA 3VOTA 1PS8A 3RYHA 1HFJA 3LX8A 1U63A 2ZXUA 3MMSA 1LJLA 4IFEA 1A8SA 1E1MA 2V9CA 4QPNA 1RAEA 2RBGA 1A1SA 1WLYA 1ZK2A 1BCRA 3N1UA 2ZBDA 4WJKB 3TIFA 1BD3A 1TCUA 3VJLA 3HYSA 3ASUA 2GCAA 3I42A 4J43A 2QRNA 1XN1A 1UC9A 2YXLA 2BEWA 4IH4A 1PNOA 1QH9A 2CBGA 2Z9BA 3R3UA 3WIUA 3LVFO 5JS8A 8MHTA 2FG7C 3HZOA 4X7BA 1R0RE 4K0KB 2BP7A 3N2EA 5FH9A 3E35A 3VH2A 4I6JA 4WKCA 5AKXA 3WL8A 1MC8A 1XV5A 2V5AA 2WKPA 1T2FA 1E2NA 3MQFA 1PW7A 4PLZA 1GM5A 1QTIA 1UZNA 1EFVA 2VKTA 1ZHFA 3DDHA 4MVWA 5K8IA 2ABSA 1NXPA 2QM3A 5JAQA 4P31A 1FQOA 1VYVA 2PANA 3N5CA 4WJLA 2X0IA 1P74A 5BORA 5IT0A 3ZZ0A 1GL3A 4O59O 3E0QA 4DT1B 5K9ZA 1WV0A 2OR3A 2IJGX 4QG7A 4QEKA 5HX7A 1ZU5A 3B8HA 2PVCA 4V1CB 4HN2A 5KHOC 3OM9A 2F1RA 3COZA 4RH3A 1VE7A 3W5VA 2J3LA 2REBA 2BJVA 2IYUA 4ZT7A 5CPBA 5GP1A 4OJTA 4EKEA 1G3IA 3LY7A 4RGBA 5K4GA 4TTPA 2E5LB 2P68A 2AD1A 4H1HA 1UOQA 4Q3EA 3HKCA 2F90A 2Y0DA 3SOPA 2AC2A 4WESA 1DARA 3MIIA 4HB3A 2OVFA 3ZZTA 2EZ8A 3RT7A 1TLTA 3IEPA 3VUEA 5C1OA 1CJVC 3Q3GE 1JMKC 4JI5B 4HXEB 3AEUA 5JFGA 5LA6F 4D3XA 3L7LA 2HK7A 2OZLB 5KI6A 2KM1A 2Z4RA 3D3JA 1IXZA 3G49A 4M76B 1R0XA 3TM4A 3WFJA 4KFUA 3H5OA 5B7PA 4LOKA 2JGVA 3DL0A 3EA0A 1M1ZA 4DREA 2OQ2A 5BQXA 4PQYA 5BUZA 3CG0A 1NHGA 3OMLA 2MSCB 3DGEC 2ZWOA 5EUMA 2ZETA 1P39A 3DBRB 4EKIA 3I61A 3EJ6A 1LV7A 1Z4PX 2F9LA 4MEAA 4XQGA 4BP3A 4IKPA 1VKHA 2DHQA 1XTKA 1T3LA 3J81A 2HUNA 1KEEA 1OXUA 1A2BA 1EAYA 4L15A 5L3RA 3AUUA 3OCCA 1JLLB 4TMTA 3GFGA 1P7WA 4NBKA 1Y7IA 3EDQA 3R77A 4E15A 4S1TA 2XE4A 3N53A 5I5EA 1YUBA 1WO8A 5KWIA 4L8YA 3UQZA 1NOJA 3EBLA 5LMZA 1WULS 1II0A 2YZ7A 3AQIA 2R7NA 4KWIA 2DWPA 2AFIA 2F3TA 1LK7A 2VPYA 4HEJA 5DZSA 4BO5A 4F2WA 1EP3B 3DE6X 3PTLA 2OV2A 1K6JA 2BDTA 1JU3A 1R27A 5AI0A 2W6ID 4JZKA 2ZDHA 4LRSB 1OPXA 1MXHA 1Q95A 1AM4D 1NYRA 1MGPA 3M34A 4HHEA 2W4QA 4HPXB 3TN7A 2XNJA 4D43A 4UNNA 5C7YA 1WXFA 2ZYSA 4ILEA 1JDTA 3A0RB 1DTWA 1W88B 2EZ4A 2IZ6A 2ZS8A 4YC7A 5BXYA 5K99A 4YECA 3V8VA 3DLCA 5EJGA 3H99A 1H2BA 3EPKA 3N2AA 3NNDA 5IXSA 1FVOA 3UMSA 3MRXA 3MRVA 4C6TB 3H3FA 3B1VA 4U63A 4UUQA 2HCFA 3AU9A 3MT7A 4V0ME 5JVDB 4FYHA 2QT1A 2NMVA 4TYYA 3N7UA 1VSTA 4DM4A 2GD0A 4BJ3A 3LIIA 2H63A 1TW2A 1XCGB 2QGFA 2WF7A 1XQWA 1R15A 1ORIA 4DCGA 1GLNA 3THXA 2C5BA 4MKIA 2PXAA 2IC5A 1NIPA 2OFPA 3NC1C 4I9NA 4NZMA 4S1OA 2C9DA 3B1JA 4TMVA 4BUCA 3U3MA 5JAUA 4C6TA 3B1PA 3KR1A 5COAA 4AS2A 3WG9A 1VIMA 4CMHA 4R1PA 1D2AA 4R40A 4D9FA 5DIFA 4HV4A 4LCAA 5ESDA 2D8AA 3PIIA 2HTFA 2A1UA 5CFMA 2B37A 2QYHA 1NNI1 3ORQA 2ECPA 4HWGA 1YDGA 3QEOA 4GQAA 2VVTA 1HQDA 4RIEA 4TQ9A 2WAMA 3CWQA 1GRVA 1P1FA 2OC4A 3IQXA 3AF1A 3CEMA 5DMXA 3OLWA 4JIGA 2QENA 2PH7A 1NMYA 2YOHA 4WX2B 4X8FA 3JQ9A 4L0QA 1KI8A 1CEYA 1IL0A 1ES9A 1XD2A 4TV8F 5IDWA 1NR1A 4JJGA 4P54A 3TECE 5LZ9A 4WK6A 4DMLA 3W8FA 2INGX 3M5CA 4ZJZA 3T1YB 4KGDA 2FWIA 4NLLA 3S1LA 1ICIA 3TFOA 1XD2B 3UQ6A 6AT1A 4O6VA 3SZMA 1CEEA 4HWRA 4FJ0A 4FYKA 3NHSA 4A1OA 2MINB 2QTLA 2VYCA 2VOJA 1DDOA 3OICA 3ROZA 1CFZA 4R1OA 1Q1EA 3SKVA 2PEYA 2ZAMA 3T9CA 3EIHA 4CQMD 4W5HA 3TGWA 1OYYA 2ZEJA 5F77A 4ER0A 3ADBA 4CDRA 2ODWA 1CU1A 2H1SA 3FYTA 4P2BA 3D4NA 3R24A 1E3IA 4F8JA 4P4TA 5IEBA 4RD3A 2RHHA 1AGXA 4BIIA 2BEWB 1YNOA 3HLKA 3O2SB 3T41A 1QGZA 1RXYA 1AJEA 1UXOA 1KO7A 1T5OA 3A27A 2FW7A 3RDPA 3WHPA 2ZBVA 3FCUB 1VOTA 2G1UA 2GAAA 2PX5A 4MVJP 4LVNA 4B7UA 5L40A 1QO0D 2QLMA 2KLBA 3EXG1 5DE3A 5EXTA 1SC4A 4FEAA