3RS8A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with adp-ribose
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
490
structure length
490
Chain Sequence
b'HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 182
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rs8A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rs8A02
2O8NA 2YXUA 1UA4A 2HLZA 5CM5A 3UQDA 3RNOA 3FHXA 3NC9A 1EKQA 1JZTA 1V1AA 4K9IA 5CGAA 5COJA 2C49A 4EUMA 4C5LA 3RQXA 3RPZA 5B6AA 3KTNA 3RQ2A 3RQ8A 3ROXA 3RY7A 2DDOA 2I5BA 4O1LA 4U7XA 3UMPA 2AFBA 4EBUA 4KANA 4S1IA 4K8PA 2I6BA 2C4EA 4LC4A 1VM7A 3RREA 2PKFA 4XCKA 2NWHA 2AA0A 4E84A 3RTBA 1YHJA 4K8TA 3ROGA 3RSFA 5EYNA 3RTCA 3HYOA 3RT7A 1JXIA 3IN1A 4DC3A 1V19A 3RTGA 1L2LA 3BGKA 1WYEA 3ZS7A 1RFVA 4S1IB 4EOHA 3RO7A 3H49A 4LCAA 3NCAA 3NL6A 2R3BA 3QAIA 2DDWA 3B1QA 4KAHA 3LKIA 2JGVA 3NC2A 3PL2A 4K8KA 3GO7A 1RK2A 3GBUA 3I3YA 3RQ5A 1BX4A 1LIIA 4S1MA 4KBEA 2RBCA 2JG5A 3KEUA 3RSGA 1RKSA 4LBXA 3B1NA 3VASA 2AB8A 3H74A 5BYFA 5F0ZA 5F11A 3RM5A 3LOOA 3RTDA 3ROEA 3MBHA 2F7KA 2VARA 4WJMA 5EY7A 2QHPA 3HPDA 3RT9A 4O1GA 3RPHA 4C5KA 1LIOA 2FV7A 1RFUA 4UBEA 4YL5A 3RQ6A 3IE7A 2PKMA 3PZSA 2AJRA 2Q5RA 3HICA 3RTEA 4GM6A 4K9CA 1TYYA 3RSSA 2QCVA 4JKUA 1V1BA 3RSQA 5C3ZA 3NM1A 2XTBA 2HW1A 3B3LA 3UQEA 3NBWA 1ESJA 4XDAA 3RRBA 3Q1YA 3B1PA 3NL3A 4K8CA 3RU2A 3IH0A 4C5JA 1GQTA 4PVVA 5C41A 2DDMA 3RO4A 2AJPA 3K5WA 2YXTA 3QA2A 4S1HA 2PKKA 4B8RA 2V78A 1VI9A 2AWDA 4XF6A 4C5MA 5CGEA 1VK4A 3RTAA 1DGMA 3KZHA 2AX3A 1TD2A 1EKKA 3D3KA 3B1OA 3BF5A 4XF7A 5TRWA 3RQHA 3EWMA 4E3AA 2ABQA 3D3JA 4E8WA 1V1SA 1LHRA 2A9ZA 1LIJA 3RS9A 1RKAA 4E69A 4E8YA 3NM3A 3UQ9A 2R3EA 3ROZA 3VAQA 1YGJA 5BYDA 3IKHA 3IQ0A 4YWRA 4N09A 3RU3A 2HQQA 3MBJA 3OTXA 1GC5A 2DG2A 3NL5A 1TZ6A 2F02A 4KADA 4DU5A 4JJPA 5C3YA 2ABSA 3IBQA 3B1RA 3N1CA 3NBVA 3GO6A 4K93A 3DRWA 3DZVA 3JULA 4X8FA 1C3QA 1YGKA 1ESQA 2JG1A 4KALA 2DCNA 3NL2A 3RRFA 2PKNA 5BYCA 4N08A 3RQQA 5TQIA 1LIKA 1U2XA 3CQDA 3UMOA 4B8SA 1LHPA 3W4SA 3LJSA 1RFTA 4E8ZA 2A9YA 3Q92A 4EN4A 3RS8A 1KYHA 3FHYA 5C40A 3UQ6A 1UB0A 3LHXA 5BYEA 3K9EA 1RKDA 1TZ3A 4LBGA 3UBOA 1JXHA 3RRJA 4JKSA 3KD6A 4C5NA 2I6AA
chains in the Genus database with same CATH superfamily
2APJA 3T54A 1YQGA 3LSYA 4YJGB 4DMGA 1W5BA 5FBHA 2NYVA 3E8XA 4H1UA 2FAXA 4RJ2A 3S40A 4CMIA 1KVSA 2VAMA 1P3DA 2B8TA 2O5CA 4WNAB 1ORDA 1SZPA 3QLUC 4DR6B 3I6ZA 2AYXA 2LPMA 1B8NA 3FWZA 4OAPA 3AKCA 7MDHA 3IUEA 1W76A 3LCMA 3WG9A 2HJWA 1X15A 2NSJA 2COKA 3COWA 3E7FA 3GLHE 3AINA 3O8OA 3PRHA 4IIFA 1ZWLA 4TKUA 4XWOA 2NXNA 5ELLA 1C7ZA 3NATA 2QYOA 1NUAA 2KYRA 1ZG3A 2IEYA 3IUSA 4PQFA 3V8BA 1QVAA 4YAEA 1GTVA 4Z1OA 3W7AA 5E9WA 2CD9A 1DIHA 1ZVJA 3PUHA 5ENDA 1XE3A 2BDTA 2FPWA 4JYCA 4REQB 4WL0A 2V1UA 1KDRA 3IOBA 2C4NA 4EHLA 5FV7A 3KVOA 2H5JA 3M4ZA 2V3VA 4L0MA 1BA3A 1LK5A 2A7QA 2BDUA 1VI6A 2QGNA 2Z43A 1W87A 3ADPA 3N70A 3VMFA 3RJTA 1TQDA 1GCUA 2WF6A 4N82A 4YAUA 1FS4A 2O3TA 2PMWB 3HH8A 4ZVTA 2QTGA 2ZS9A 2PFSA 3AY3A 3DLIA 5AVQA 2DERA 1BHO1 2AOXA 5REQB 2QYHA 4HLCA 1I2MA 5B6IA 4RDHA 2VDVE 2FLWA 1KYIA 4V3BA 4QF5A 3HWSA 1NVWQ 5JCJA 2F7KA 4HEHA 2GFQA 3AJRA 4QUHA 4JX8A 1G5RA 5K4AA 1QQTA 1J21A 3GI1A 1K89A 2WW8A 4WN9B 3AF0A 2FFBA 3BWBA 3PD1A 5KTYA 4YP5A 1Q95A 3U9TA 3HBLA 2W0SA 3PDWA 3FOAA 4RK5A 1QYVA 2QZZA 4K6FA 1E5QA 2WKSA 4OQZA 5IJXA 3SZMA 3FNIA 4MGKR 1ZJ6A 2CMFA 5BQOA 5P8WA 3Q1YA 4XDAA 1WF6A 3TI9A 2RAUA 5B1EA 2WDZA 3S0JA 2WU3A 4PLCA 4CL2A 1L7EA 1XDZA 3B7WA 4BZPA 2H3EA 2DQ4A 5EJGA 2DUNA 1E9BA 1V26A 2X15A 3UGJA 1J2UA 2YXTA 3A6KA 3QPUA 1YAJA 3CS3A 2WE8A 2O23A 5JH7A 3ODPA 1YZVA 3NRBA 1XCGB 4O5AA 1ZVMA 3OMXA 4DVJA 1ZD2P 1PHRA 1NUTA 4C5MA 4FQ5A 4R2XA 2JD2A 2VH5R 1L9XA 4BO9A 2M1XA 1O77A 1QS0B 2ZTLA 3QJGA 1WUJS 2IYFA 2WOJA 3L9WA 2CB9A 3P9CA 3ZCRA 3TMYA 4D8VA 2OB2A 1P18A 1RADA 2CXPA 1PT8A 1LC3A 2OEPA 2X4IA 3LX6A 4UTVA 4CM4B 1WY5A 3EFOA 1N2SA 3OZGA 4PG5A 3WGNA 4YAFA 5AOCA 2FCRA 2YQ5A 4FFOA 4RD3A 4RE5A 3U4HA 5IM4F 2O8FB 3WLTA 1ZRSA 1XEFA 1ZW6A 2R1VB 2ORVA 2GZHA 3C3XA 3NHYA 4OKIA 4V39A 4WECA 3N2AA 3PFFA 1FYFA 3BB3A 3DUFA 2N0SA 2D7CA 5AXDA 1AS0A 2J9FA 2Q3CA 3CQDA 4RZ2A 1FP7A 1KAGA 2GZMA 2P11A 3N0RA 3ZHYA 2Y6VA 4M76B 1LZKA 1GG8A 5B4VA 2OZLB 5BYEA 2O8DB 1U3WA 2QMHA 4H16A 2EKZA 4KPGA 3V1NA 2JAHA 2ZRDA 4AWBA 2B94A 2VXBA 4KWIA 3LUJA 2OXIA 3AILA 5I51A 2YHBA 3SNKA 2ZVQX 3DEHA 2FPIA 2XTAA 1RI2A 2W6JA 3QYJA 4IDAA 3T7KA 1M1ZA 5G1PA 3UENA 4BVHA 1ADBA 2DOKA 5JE8A 1E2PA 4KCGA 3TLCA 2Z9BA 1SIWA 4RM3A 4E30A 3W4IA 3MOGA 1QIHA 3GWGA 5IJZA 1KBQA 2P7IA 3PQDA 5FB3A 3L1IA 5IAJA 1R8QA 2ZPTX 5HILA 2GKOA 2UXCB 4D0NA 5FYDA 1KQNA 4HOYA 3GPCA 5ANRB 1QK4A 1GSOA 5CFNA 4G5OA 3M4YA 1R27A 2PKYX 1NXPA 3IQFA 3BWYA 4LOLA 1DMRA 4OD0A 4FFNA 2OPHA 4A1OA 4B6OA 1AUVA 2SCUB 2WVGA 5EKUA 1C3JA 4PF1A 3HBFA 4A8JC 2BGLA 1V5WA 1J2EA 4FHEA 3WRXA 3NL6A 3UW3A 2C7RA 1Q0UA 4MUFA 4TS3A 2DE0X 4S2EA 4TTTS 1R15A 3ABOB 5ALQA 2B1IA 2C5BA 3HBJA 4FFSA 5CMLA 1SHKA 3R24A 4UREA 2Q21A 1T9GR 3BFXA 4OLBA 1KJ8A 1XAIA 2W6OA 1M8FA 3G1WA 3UC5A 2AE2A 2AMLA 4LCAA 3RRXA 5U4XA 2WLSA 1RZRA 2W9XA 5CTJA 3NBQA 1UP4A 4U5QA 5AP9A 4WWHA 3CSSA 5LWHA 4OI2A 3BRWD 1K5DA 2IXFA 2K5UA 4REMA 2N1MA 1U0LA 1ENOA 3UHJA 5BN5A 1UAYA 3CX8A 3LHIA 4JDPA 1WSAA 2QW8A 1OUMA 4XUEA 1GOTA 2EBFX 3UQEA 3ANXA 5ELMA 1VHQA 1XTRA 1NXTA 2C77A 3N1UA 3ESCA 1JQDA 2C99A 2FR8C 2AJLI 3NNSA 3SR4A 4D6XA 2FETA 1IEQA 2B8JA 2PX6A 4UUPA 4Y1GA 3QKIA 4IIYA 5KYWA 1ZESA 5JJKA 2BHNA 3N2KA 3K0HA 4QGFA 4M9CA 1AKUA 1Z8DA 3EUFA 1RI5A 5CEJA 1EFPB 3OM8A 1VI9A 2E82A 1DKMA 4E88A 5ALMA 2C8JA 4G24A 4OXNA 5LLDA 2EW1A 2VCHA 5C1PA 2O54A 2C0QA 3RQHA 4N0DA 3QJ5A 2J9RA 5LA6B 1SKQA 2V9PA 2Z5LA 3C7TA 1JKFA 4Q1FA 1WTCA 2O19A 2P68A 1RPAA 3WLMA 1PS9A 5HF5A 1FVFA 2HZBA 4YMSA 1KYWA 1IN7A 1JVBA 5F7OA 4RPJA 1N36B 1R0YA 4IIGA 1Y6ZA 4CW7A 4GM0A 4JT8A 1T0BA 4C0HA 1BWQA 5A03A 5AVSA 3BOSA 4UHDA 4WK0B 3N1CA 4OHFA 4BNHA 1GAXA 2X0JA 4JL6A 3HYCA 3K8QA 3DMYA 3FZEA 3GPBA 3ZE0B 1UPCA 1WZIA 2Q27A 5LD2B 3UKOA 1QRTA 1WXIA 2JI4A 2QMUA 2IHYA 4JMPA 2XTJA 3OQIA 5ARCA 1H1DA 2RE8A 4HHEA 2H59A 1VLZA 2C61A 1A9RA 4MKHA 3TLJA 4BLQA 1DGQA 4PS1A 1ZH6A 2EV9A 5E4JA 2O8CB 4HNVA 1DWOA 3FPAA 4EI8A 3QF4B 2HZ7A 3JZDA 2HHHB 4MMXB 3PVSA 4L3VA 1Y8CA 3Q8MA 4PYIA 1JSCA 1IDN1 3BA6A 1C3VA 1RWBA 4J7XA 4KSCA 1V1RB 4QYMA 4Y2YA 3TXYA 4QUKA 3HJGA 1OX4B 1G5HA 1LBQA 3W1VA 2YY7A 5INTA 3CR8A 5CCBA 5A0FA 2W0MA 2Q50A 4KP7A 1DAFA 2JL1A 3KALA 4OGWA 5GP1A 4Q9AA 1LC0A 4OHCA 2DCMA 2QJTA 4QNMA 5LDDC 5E1BA 2EARA 5CYPA 5ALEA 3B7GA 5A4JA 4XCKA 2Z58A 4YX9A 3ZU5A 2FKNA 3KIPA 4BNNA 2GN6A 3W5UA 8ADHA 3HY6A 3JALB 3L4BA 1MT0A 3C74A 4GBJA 5CT6A 5I3ZA 2IIVA 2FSPA 3JVDA 4BUJA 4DA0A 3NIGB 1LLFA 1O8CA 4YCMA 4RFSB 1RWNA 2WKQA 4S1IB 3V97A 1BE1A 1IWOA 2HAEA 121PA 1IM5A 3RO7A 4MRVA 4NV1A 2DP4E 4PR3A 1U11A 1QU2A 1RDFA 2GBGA 2X0NA 4MRMA 3WYGA 2VNSA 1TEXA 1D2EA 4LE0A 4AJHA 4GP9A 4E6EA 5KTRA 5DN6A 2P5TB 5LDGA 2WC1A 2AM2A 4HB4A 2NMVA 1JE1A 1K8YB 4WLNA 5K3FB 3C3WA 2ET6A 3U9LA 2EL7A 2PRIA 4CL0A 3GJYA 5DISB 1WY7A 2JJ2D 4DCOA 2IY7A 3MERA 3TMKA 4DT1A 3KR0A 4GMHA 2OK7A 1IE3A 2HO4A 1WW2A 4LZOA 5IEBA 3VYVA 4QOEA 1CZUA 1E3QA 3DEZA 2WOOA 1JAZA 1JPUA 4O1HA 4JBXA 4Z8YA 1STOA 5EE3A 2IELA 3E5HA 3KUXA 2NYAA 4U2FA 2G70A 3OLCX 3ZN2A 2QLLA 5AW8A 2FPMA 5EUBA 1EM6A 3N75A 1J20A 3OFKA 3NBWA 1Z45A 4UVHA 4XWKA 5FWYA 2CT8A 5TQ2B 3ICCA 5EIBC 4BUBA 2BTQB 2H16A 5LMCA 5F98A 2Y1CA 3HJFA 2WWGA 5HK9A 5G0UA 3NTQA 3PV0A 1T26A 1FXUA 4FFLA 2ZSUA 1PFWA 1J0CA 3OJ0A 2HR1A 4WZAE 3EPLA 1QCCA 1N2CB 4RLHA 1UM9A 3NB0A 4TWJA 2W4MA 2BBWA 1C0IA 3IQHX 1UEIA 1WDMA 1EJ0A 2P6MA 2YH2A 5C7LO 3DKRA 5I7UA 3GJ5A 4QOIA 3ZTYA 3THXB 4MUHA 2R4QA 3O21A 1JHPA 1PEAA 4JBLA 3TH5A 4ZEWA 4US1R 4P53A 2ECQA 1G9TA 5G1NA 2H1FA 3AKZA 1DNPA 1U8ZA 2CLLB 1JN0A 4OHYA 2ZIVB 1NW9B 2CVZA 2JIDA 1M34B 4LXIA 3REGA 1UAAA 2HU5A 3F46A 1X9GA 3U39A 4EB8A 5KMGB 1EUCB 2GZ2A 2AI3A 1DAMA 3NL2A 1NLUA 5K0JA 3LHSA 1OBHA 3EFBA 4XB2A 2VAPA 4P5DA 5CVJA 4YP1A 3A9CA 1XOIA 5IXYA 1LI4A 4IIJA 1ISRA 4LJ9A 4B9AA 3ZHCA 3B78A 13PKA 4DADA 1W0JD 2HHLA 2IDZA 1U5AA 4UE2A 4RTSA 3AHGA 3KOXA 1JDVA 2Z8ZA 3JAWB 4XIYA 3RLFA 3LF2A 4KYIB 1S2OA 5KSPA 1DI0A 1WMFA 4AP5A 8OHMA 2BFCA 3ORSA 4L4ZA 5AI6A 5COJA 2QMQA 3JW8A 3M2TA 4KQWA 3X1XA 4C4ZA 3P5BA 3SWWA 3U26A 1KXZA 4WDRA 2H8KA 3CUWA 3DOCA 1ADYA 2XUGA 1QB7A 2Z8XA 4LKRA 1L8QA 1YC2A 2DTEA 1EVZA 3PF8A 4Q3NA 4Y0NA 1R3DA 4M8SA 3UMJA 1MVOA 3P9YA 3KSRA 4L78A 1H2RS 4F5EA 2B8EA 4F96A 2IRWA 5AKHA 2BFOA 4HXEB 3MUOA 3EPKA 4NDAA 2Y1OA 2WHEA 3PDCA 5EGSA 4HJRA 4BRWA 1IOLA 3SZGA 2JGNA 2X8BA 2J5QA 1WCIA 1FNBA 3C6MA 4Z9BA 2XYPA 3EK2A 2R7KA 3TGLA 1I30A 3AZQA 4JH0A 3ROFA 2A67A 3R5KA 1NBIA 1U4OA 2WJZB 2I2FA 3WAGA 2KPOA 5JDCC 3F73A 3MN1A 4LI0A 5AW2A 1O94D 1QRSA 3MOSA 4O4IF 4F92B 3EW7A 3AUSA 1J7JA 1L5LA 3DE0X 1Z9BA 1OLSB 1S0UA 5TS2A 4TVKA 2VTDA 4UATA 1SCJA 1YUNA 5FORA 2F2TA 4E6PA 5JNRA 3EGDB 4KNWA 3OPQA 5SZIA 1U2DC 4P4NA 4D9CA 3O83A 2EZ9A 3WNZA 4M1ZA 4IJVA 3C5VA 2PN1A 3DBIA 5EUMA 4UTPA 4YXWD 3QEAZ 3GX1A 5ITWA 2LKCA 1SCIA 1GGNA 4L8GA 4ZVNA 3UAOA 4FZ3A 4DV2B 3GBVA 5IC5A 5B1SA 3HICA 3HZRA 4PY2A 2X0RA 4P4UA 4D80A 2VJDA 1QKKA 3O8QA 5TGDA 2VS1A 3SK0A 4DMUB 3FDFA 4PAQA 2QP9X 1C7RA 4B35A 5COBA 4EVIA 3O8BA 2Y92A 2E1RA 1QO7A 1L5YA 3LE8A 3EZ6A 1DPGA 2JAXA 4ND1A 4WRRA 2Q1YA 2DWUA 2NN3C 4TTQA 1EFVB 5EZ6B 4KI7A 2D5BA 5KJ6A 4AY6A 2PXCA 2XDQA 4M0LA 4BATA 4W99A 5GOTA 3TL3A 1FW8A 1G20A 1H8EA 1ZAKA 3VBEA 3JQAA 1JE0A 1KI4A 1X7DA 3ENNA 3BF5A 3LLCA 4X60A 2WQ7A 2XHEA 3STYA 3KTFA 5K9ZA 1SVNA 1A2KC 2VVTA 3GLTA 2RH8A 3ITDA 2FRDC 2OB1A 4DMFA 3CX6A 1TVCA 1T2DA 2O9JA 3DDCA 3EIOA 3GGOA 4XLLA 5BSHA 1GNLA 1G1MA 2O7NA 1I6KA 3PEWA 2ZJAA 1BEEA 1NT2A 4B4KA 4LY6A 4M7PA 5GAJA 4BE9A 5F9FA 3FPFA 4HAIA 3U40A 3EC1A 3FIJA 3W2HA 1PGJA 4X8FA 1IXRC 3ONWA 1NXVA 3TEJA 1PF7E 1LBTA 3UTDA 3DD1A 2PJUA 5EESA 1PWXA 2H1CA 4K86A 4ECEA 4YLGA 2WWFA 1MIHA 1TKRA 4KH0A 5CT5A 4E8ZA 1WVMA 4A0GA 3ZD9A 5CDYA 3KEFA 3MZ0A 1EA5A 4BO2A 3DZIA 4F7WA 3ZY2A 3EASA 2PX8A 2QHXA 2XKKA 2X2PA 1X8JA 3UQDA 3TQQA 3U6BA 4C04A 3O47A 1I3LA 1EP2B 1YE8A 3SFTA 1Z2EA 4Q9JA 1N25A 4PLTA 3F9IA 4UBKA 3HM9A 5EMHA 4KKVA 4WVFA 3QWFA 1XIVA 3TX2A 1HQYE 2YWEA 3FSJX 5HKKA 2QIPA 1EPUA 5IG2A 1FFXB 3SPXA 3A6PC 1XSEA 2AN3A 1KFKB 3QI2A 3ERCA 5T4HA 2VP5A 2Z4SA 4D0SA 3AEYA 5HF8A 3QTBA 1YCDA 4XX0A 3RVBA 4YV7A 4MV1A 4OHPA 5KTMA 5C1OA 3B8HA 4HEQA 3ZLUA 3TLKA 4W5NA 1ZU5A 2ZIEA 2VQFB 1JHZA 4A0FA 2G4LA 3OIDA 3EIQA 2VPZA 2ALJA 1B0PA 3SP1A 3DA8A 3VSEA 4M53A 2H48A 2HLDD 3FNRA 2O0LA 3B1JA 4HFJA 1ZL2A 1GNRA 1P1RA 3RHSA 1KBZA 2KHZA 2V4UA 3IILA 3FHJA 2YFHA 1CIPA 1X1CA 1X1AA 5CVVA 4HAZA 3DYIA 4D3DA 4FGSA 1J07A 1CF9A 3KZ1E 5ER6A 4C7BA 4EHHA 2G09A 2G1KA 2VYQA 4AY4A 1HMPA 2ODAA 3LOOA 2VK4A 4XOUA 3EQ8A 1EI9A 1NPTO 4MUEA 3WKEA 3ECCA 5BV7A 2WYIA 1TC1A 2GETA 4MR8A 2QSZA 1SKUA 3DS8A 4OJNA 2Q99A 4PRYA 2HHJA 1UBNA 3OZRA 4IIXA 2VP4A 2VJAA 2YYYA 3PK0A 4H7JA 5TPWA 4L3WA 4F6CA 1YRBA 2RHHA 1T1SA 1Z4JA 1HURA 5BN1A 4IZIA 2ZAMA 1Q1ZA 3L7AA 2LZ0A 3WNVA 1KI2A 4CV2A 3NP9A 2XMCA 3B36A 3ET4A 2HDHA 1Z7YA 2SHKA 4KJZA 4GO1A 4YCCA 4LK2A 3N5KA 4JQCA 2ZIXB 3RM3A 3WGKA 1N5KA 2ZWAA 2VPQA 3GRRA 4FE3A 5EJFA 3UUEA 1XZLA 4KDCA 3EWAA 1SC4A 2DCUA 3UMRA 5AKXA 4KXVA 1JLSA 4TYWA 3IE0A 2PQMA 4XWGA 3ZZMA 1Y6RA 2PAFA 3P2EA 1R6AA 4KUHA 1RTTA 4D5GA 1NIJA 3Q1KA 5J1SB 4AN1A 4K6CA 1VFPA 1XN4A 1YVEI 2E18A 2WM3A 3A3NA 1EK0A 3KQTA 4JBHA 3SOZA 5FEMA 1TAHA 3VQTA 4LK3A 1BXRB 1L5MA 2CLIB 2Q3HA 4L75A 4C29A 2CN1A 2I7XA 2JEZA 1L8AA 2XIJA 2G4CA 2P91A 2Y0DA 4TZ6A 1IN1A 3KPJA 4LBZA 5DK6A 2NU9A 4ZAZA 5J3JA 3BSFA 1N8NA 4G0WA 3PNLA 3A6LA 2O7QA 5D84A 5ABPA 4FFDA 2BGGA 1PEDA 2IC5A 4KAFA 4WSOA 3BULA 6CHYA 1QVWA 1W0KA 3AERA 3H2HA 2ZR7A 5ERXA 1XV5A 3QV1A 3NHBA 4G1UC 2AC4A 3AR5A 3H8VA 3L7NA 4UUNA 1FFWA 3ROKA 5AQEA 1JHAA 3CRNA 3SU8A 4MQEB 3ASUA 2VF7A 2ATIA 4W8OA 1QE5A 3AKEA 3IURA 4Y2QA 5CURA 3W77A 3NKLA 4NMWA 4QJ5A 3JQCA 2WABA 4BKRA 4KR3A 3N7UA 1J23A 1UJBA 3GV0A 5AHOA 2PY6A 3HZOA 4X6UA 2JFOA 5HWSA 1KS2A 4KRGA 5FQOA 3M81A 3SLGA 4EELA 3AUKA 2VPYA 2V7BA 2GASA 4AQYB 1XELA 2HWYA 1ID8A 4DLAA 3ZVKA 3KQPA 4HGZA 1AKNA 3USES 4EB6B 1IN6A 3KBBA 1JG4A 1QC5B 4OHRA 5K99A 1FNNA 1FVXA 2IODA 2PBRA 3QEKA 3PX7A 1X7WB 4JI0B 1SVWA 1FBTA 1R0SA 1CJKC 4JX9A 3W8EA 5KSZA 4ZDJA 4CEHA 3WZMA 1DJOA 1Q11A 1WM1A 2ZI5A 4N0PA 4QUAA 5LP6B 4GSKA 4MZDA 3GLIE 6REQA 4ED9A 3LUDA 4TMWA 1W52X 3LPAA 1T5LA 2WAYA 4Q39A 1QFYA 4EO4A 4EJ6A 2VT2A 2C97A 2MDTA 2ZKIA 1ZOLA 3DW3X 3ST7A 4B4WA 2AN5A 5JCJD 4D26A 4KPFC 5KYGA 4ZT2A 1XKQA 4QXQA 4IYRA 4N48A 3KEMA 2JA2A 3DC7A 4G1FA 3SJCA 4JI2B 1ZM9A 1GN8A 1EQUA 3S8EA 1CY4A 1VOTA 2JIPA 4KNVA 3KCNA 3O3CA 1U2TA 4JAVC 3R3YA 4KBEA 1PIWA 4NPAA 1AV6A 1CLUA 4FJ1A 2PKFA 3RIHA 3RUPA 3E81A 3F47A 2H52A 3R1IA 4CM3A 1EHIA 3H65A 5EY7A 4OHKA 4O1IA 4Q4DA 3OZVA 3W2EA 2NO9A 2PVSA 1X1QA 5DLEA 4B3FX 4Q37A 5CA1A 4EUNA 2CFSA 5EE1A 3RGWS 2IWHA 5KNCH 1X7YA 4JC4A 3LGAA 4M37A 2RK4A 4HNAA 4Q21A 3JVEA 4G8DA 1IUOA 1JBEA 4LW8A 5DYIA 4UOZA 4BVKA 3A2KA 1ODSA 1MRSA 3N2NA 4XDGA 5E6RB 5G4KA 5HFJA 3L7OA 1T4DA 1OYOA 2RK6A 2YVAA 2YRXA 3JYPA 2C0CA 4IV0A 4LQLA 4EYKA 4JGBA 3GJTA 2AUMA 4KQMA 1RXSA 3VDQA 5KB3A 4DQXA 1Z47A 1IULA 3F1LA 3FNEA 2G63A 5JWOA 5J2UB 1MX3A 1QVRA 4GL2A 4I1RA 1CFJA 3GLHB 4NCJA 1BDHA 2D4AA 4MQUA 3DFFA 2C2YA 4ZHQA 5HS4A 5JYBA 2VSQA 4HLNA 1D1SA 3LUKA 5F4ZA 3G02A 1QFSA 3D43A 1Y3FE 5B37A 4HGOA 1HETA 4OREX 2DUWA 4D4GA 4FOTA 4FDLA 2A0YA 5CM2Z 2OGWA 1UWLA 4FZRA 4LC0A 4E5SA 2VAVA 1X1SA 3HYLA 2IIPA 3GT4A 1DTEA 1YJCA 2UAGA 3OEHA 3RC2A 3X43A 1ZHFA 1GKYA 2QTAA 1EK6A 5BYKA 3RG8A 4DOMA 3KJFA 3W6ZA 4C2BA 5IEJA 1B8PA 4R7GA 5A0VA 1ACMA 4IUYA 2ZSKA 4F3KA 3PVZA 4UMEA 1FTQA 3EEFA 2HMSA 2WZBA 1GNVA 1EQ2A 1JYEA 1IG3A 1Q83A 5F9MA 1CS4C 5M2QA 2JG1A 1U1FA 2N46A 3B3QA 4WQMA 1VK4A 2QSYA 2W6JD 4DDKA 1QLJA 1ND5A 1QTNA 3AYZB 4MTCA 1LLCA 1R16A 2BTOA 2AXEA 1M2VA 2OVFA 2BR5A 2XWJI 1ADFA 3ONNA 3OTIA 4WOCA 1N9ZA 3U4DA 1G66A 5ALIA 3CW9A 4GPIB 4LNAA 2FOLA 4IQ8A 3FYSA 1K08A 2O2ZA 3RJMA 4TLBA 2O8NA 3NBMA 1N2EA 4XGKA 2EZTA 3QKRA 4YALA 2IGBA 5C31A 4R41A 4BO5A 4IQGA 1XZNA 2P5SA 5FHQA 2R6CA 2H9YA 2BFEA 2AFRA 1NQTA 3WTCA 4DB4A 1CB7A 3CG0A 1VGRA 3GJ0A 3JD0A 5A4KA 5EJ9A 2YRFA 2ZRGA 3GN1A 1PEYA 4RFLA 3KKNA 5AHKA 3EHDA 1QLWA 1CZLA 3EXG1 5ESXA 1Y6JA 4HXYA 4WBNF 2Z8YM 5BW4A 3OQMA 3O4HA 2R7MA 2XTNA 5WRFA 5LC1A 3BGIA 2Y1DA 3NYWA 3HGQA 4BO7A 1NNSA 4ZT4A 1C50A 5H8WA 1FJGB 1F8UA 3AT1A 2C5EA 1ZVVA 1ZK3A 1RZRD 2C42A 1OI3A 4A23A 3A4LA 4P5EA 2WMDA 4I4CA 4IEIA 3NHLA 4HFMA 5CNKA 1KDZA 2NO1A 4MIYA 2EQBA 3DFUA 4Q4AB 4U2DA 1CS0A 4LEIA 3QVWA 1ODJA 1JFSA 5AVXA 1FLAA 1KI6B 1XTBA 5FT9A 4HT3B 4BV3A 5TE9A 2X5XA 3U3XA 1IPEA 3RSGA 4DDVA 2ZJOA 3CC8A 4TWBA 4H1WA 1DKQA 1RXWA 3WR5A 4JMLA 4M9XA 3IEPA 2X13A 4MJ3A 5IZCC 3C15C 4EDHA 2GH1A 2G71A 1CEQA 4RV5A 2HF9A 4DA4A 4GYKA 3EG9B 3A26A 2RAFA 2VOEA 2JRLA 2BISA 4YRPA 4XEHA 3UK1A 2I6QA 4FHDA 4LHWA 4MP8A 3C2QA 4GD3Q 4LVOA 1RAAA 4YROA 2YXLA 3OICA 1VB3A 4HCJA 4FWIB 1WZCA 1UQUA 4MJXA 3PYLA 2P9QA 3V4FA 4AJ9A 1IDOA 2F3SA 5L4LA 3QFRA 1IJKA 1MB9A 1X7HA 3CA8A 1E1LA 5DE3A 1DELA 1HRDA 3BL5A 4GLBA 1F2UB 1MAUA 3MW8A 3RYCA 2XQJA 2FPOA 5C7IO 2O3UA 4X7BA 521PA 2C9CA 5F2KA 5ALDA 3HACA 3ABZA 2NZUG 2RB4A 2IPXA 2YKGA 1I5OA 1QMGA 1XVAA 3ESYA 5A9RA 5CA0F 3EPPA 1LLDA 3F3MA 4C08A 3EXEA 2GBFA 5ALVA 4WXRA 2OO3A 1Q0LA 1ESCA 1KK1A 2XXJA 1WBJB 2ZJZA 1AUQA 4C6TB 3RYFB 4HDMA 3WJ7A 1ZCJA 3KRTA 4JI7B 3A31A 5F64A 4NEHB 3EH1A 4NNOA 3K8OE 3ZK8A 3S7TA 4I81A 1NY6A 3UG6A 1JDJA 1TW3A 2J4CA 1LIKA 4CMJA 3OKPA 4B6FA 3W4SA 1GSHA 4L4UA 3G9XA 3LLUA 4AJPA 4R1LA 5C40A 1DT5A 1W5TA 2H2WA 3I45A 5NLLA 1WMSA 1ZRNA 3IEVA 4FEAA 1A9TA 1WBBA 3ICPA 1DQPA 2AJCA 4EG5A 1RAEA 4E5PA 1FS6A 2QTLA 4AZVA 3QCZA 1YRHA 2BFDB 4OHOA 2VNJA 4NU5A 4IFBA 5E4FA 4RENA 1R0WA 5C8XA 1JT2A 2EKQA 3DD5A 3HDTA 4UZSA 1V7CA 2BI8A 3EE6A 5H1YA 2Q2OA 3H5OA 1HA3A 2GAFA 1UMDB 4X1YB 2PGAA 5JIBA 1KNXA 2YXBA 2VC2B 3BWVA 5GONF 2H5IA 4BDTA 4UU8A 1Q6YA 3RBVA 1MEEA 4GRIA 3NPAA 2ZBQA 4BMSA 4UUQA 2ZBVA 3CBQA 2G5PA 4C43A 1E0AA 5AVVA 1SCDA 3QPBA 4M6WA 1NG9A 1Y6QA 5FUBA 2D2XA 3EMKA 3CU5A 1Z83A 2HCFA 2VJYA 3ENQA 3II6X 4JUFA 3IHLA 1UFOA 4UBLA 4C07A 3ZJUA 1NWCA 3I04M 1Z8FA 4GX1A 4OOFA 1I4LD 2W93A 1OJLA 1V3VA 1KP3A 2X3UA 3Q10A 1OI7A 1MH1A 1J2TA 1FMCA 3SEQA 1X70A 2PKEA 4K9SA 1R5NA 1ST2A 2XE6A 5DBOA 2FZWA 3JYNA 3QOWA 1X7ZA 3GFTA 3GROA 1SCUB 2YXPX 3HXQA 2G9QA 3FNBA 1O57A 3G8YA 3OU2A 4FPXA 5E3HA 2G9ZA 3FUTA 3WWZA 2B7LA 2D0IA 2FX5A 2WHQA 2F4NA 2V65A 2QRVB 3IV9A 4ILKA 3TKYA 2CUTA 3CLUC 4WBNB 1MJGA 3BREA 4WCVA 1P74A 2G9VA 1WQ4A 2Y99A 4RW0A 1C9JA 4QLAA 4RHFA 2QQ5A 4TL9A 4XM1A 5CDUA 1Z0SA 3RPEA 2FP3A 3F9RA 3Q2IA 2N47A 4LGCA 3OIWA 4Y6QA 1Y7IA 2HSEA 1DZ3A 1K6JA 2PZJA 1LRKA 1NR1A 4ZP1A 5EIHA 1UBJS 4WBSA 2NVUB 4AG6A 1SIOA 5DM70 2GCEA 2YVKA 3EWIA 3MINA 4GFDA 1XZJA 2IUUA 2QCVA 3EVCA 3G6WA 4LHXA 2OXFA 5IJAA 4ROTA 3NUGA 3QLUA 3T4UA 3H5RA 4OB8A 1DC8A 2P9YA 1XNJA 2NZ8A 3H5NA 4DWOA 3WGVA 1DWPA 1V9LA 1NQVA 2FWJA 3PHLA 3PE4A 2IYQA 4LISA 1RWMA 1FDVA 1U0NA 4U2CA 4AF6A 5J2TA 1SEPA 1KHHA 1T3GA 4GMDA 4BQQA 4ER3A 5LXTA 4PGHA 4O1MA 3IT1A 1Z3IX 4V0SA 2X0FA 2ZQYA 4RKWA 3DDHA 4TV9B 5T8KC 3Q8XB 2IXTA 3KTAA 1DGMA 1X7GA 4WCDA 3QHAA 3U1BA 1H2ZA 3SY8A 4KKXB 3CCCA 3O4RA 4RVSA 1TZMA 3CNEA 3MC1A 2GEFA 5A05A 4DG5A 4D25A 3IBTA 5AKEA 1XKTA 2G7ZA 2NTNA 1UKBA 3EUEA 4YRTA 3HHEA 1E0JA 4Q01A 3TZCA 4ZHSA 5CLJA 4NE2A 1Z5PA 1FDIA 5D5PA 3DJFA 2H8GA 3QV2A 4HFNA 3KS9A 2Y05A 3RS7A 1TZ6A 1XTPA 4MKFA 4GZMA 1T29A 1WKCA 3BMCB 4ACBA 4NCBA 3DRWA 3GDGA 1J6UA 3NBXX 4MA5A 4JI3B 3WHIA 1MX5A 5FFMA 1D0IA 3RWOA 1Z15A 2Y76A 1D3AA 2PFGA 2EEPA 3HJ6A 1I2DA 1REQB 1UMBB 2Z4TA 3IP7A 3N07A 2IXBA 2VPWA 2XAUA 3QUAA 4L2IA 2V55B 4ER5A 2XH8A 1KJWA 1S2IA 4PO9A 1LV8A 3Q0IA 5B53A 2V45A 3TTYA 4WKGA 3CEAA 2VP2A 2SKDA 1IY0A 4K9DA 2A14A 2PV0A 4Y9UA 4KR9A 4NY1A 2C2WA 1N3YA 1PTJC 4M9RA 5IVDA 3R5JA 4N76A 2OYSA 1E2MA 1T9CA 4BQPA 1THZA 4EY4A 1FSPA 1AQLA 4IDQA 2QK4A 1BWPA 4W1QA 4LMAA 4CBVA 2PKQO 2QUZA 4IH4A 4CTMA 5LFAA 3FW1A 1IN5A 4IUBS 3I05A 4CM5A 1WUTA 4WZAB 3IA7A 4EARA 5GJWC 1WSDA 1N9GA 3AVYA 4UOEA 1ODCA 4IL5A 3ZE6A 3E0QA 2NUPA 3DBRB 4YREA 4PYJA 4D8TA 3ETGA 5IN5A 3EXAA 2ADOA 2FY8A 3F4LA 2TMGA 1FSGA 1V1MB 1ODTC 4MUAA 3MCTA 2I1WA 1PW7A 4I19A 4UBMA 4UXIA 2GBIA 4B71A 1A8PA 1R50A 4K9NA 5BORA 3ETJA 2Q5OA 5C32A 1NBEA 2VNHA 4KTVE 5GONB 5A4FS 1BHSA 4S1MA 3NG1A 3PXAA 2H17A 5JW6A 1EVJA 1W59A 4YDSA 4MB0A 4RD4A 2REBA 1GHTA 2P7HA 2HSWA 3CURA 1J1IA 5EQTA 2CJFA 3W5JA 4RVHA 4EFNA 1TUIA 1T6NA 5F7XA 4LSWA 4MWCA 3NNNA 3O3OB 4UZFA 5EAIA 5CITA 1P72A 2GD2A 2NT3A 9GPBA 4R01A 5H16A 3WL7A 5CFOA 1Y81A 2BGKA 3DFZA 4Z0NA 2NGRA 4Q6BA 2O5RA 1R4AA 2PCJA 2QWXA 3F98A 3LQQA 1H8ED 5JLJA 3JQAD 4OO3A 5SY6A 3KYIB 3ZV6A 5IKMA 5THXA 1N4DA 5IVPA 4A4DA 1XMSA 2M1ZA 1U8EA 3DE4X 5HBRA 1XF1A 1DBIA 1N5OX 5CLFA 4MQBA 4A6PA 3MCZA 5AVZA 3JYLA 3OJOA 4E2WA 1CJTC 4P2BA 3K20A 2HPHA 2KI5A 2PMDA 4E11A 4B9EA 3O1LA 4C7XA 5CBPA 4BBPA 2Q3EA 3I9V6 2GWRA 3P1JA 4A8HA 4EUKA 3IDAA 5ALKA 3HXPA 3GMSA 3TW6A 1JALA 1EVLA 1FDTA 5KVQA 1JLHA 4JKIA 3HY3A 3CNLA 2DKFA 4PSKA 3SG0A 1GAQA 1GO2A 1MHPA 2AI1A 2D5LA 1MVLA 2F3UA 4NBKA 3G17A 4FDAA 3B6EA 4EG7A 5LP1A 2CXQA 5D3ZA 1XKLA 1QHXA 3G1TA 1QIEA 1YHYA 2B4RO 2GVNA 2H7YA 5FL7A 4INJA 5HIJA 4O2LA 2ZPUA 5DTQA 5C51B 1O5TA 3BMQB 1EE1A 2IP4A 4PIPA 1VLLA 3MQFA 4OIFA 1DQZA 3UAXA 4JJ6A 1NHWA 1RBQA 1WCWA 4ER6A 8AT1A 1IHDA 3BB4A 2YMQA 5JY6A 3K6KA 1JDZA 3O6VA 1JLLA 1JXOA 4OSEA 4B8SA 5K3CA 1XRJA 2QTWB 5HKKD 2DQSA 4QFDA 4TXMA 2HRCA 2RHMA 2EC5A 2TS1A 3BH6A 1IK4A 3MNFA 3KJGA 3DEYX 4YDHB 5K5EA 4KWEA 3WL8A 3LDHA 3NM3A 3SDZA 3HCRA 3J81A 4O4HB 2KMLA 4F8YA 2ZZKA 4WOBA 3ADDA 2OENG 1GVNB 1UZAA 3VR6A 4DKJA 2GN4A 5CIQA 3N74A 1TIKA 2A3RA 2GUWA 3WLKX 5TC4A 3LWBA 4LVCA 4D4HA 4XPIA 4I7EA 3TIGA 2IHBA 4JFRA 2VXYA 3C7AA 3BD8A 3L0SA 1XDBA 3DCYA 4CUJA 4IGKA 4WFJA 3CEPB 3VOTA 1OXBB 1E9CA 1TJ5A 4J0GA 4OBEA 4GGPA 3QVVA 4H2DA 5K0EA 1C7IA 4BN5A 4H1VA 1KYYA 2J3LA 3QG5A 2R8XA 2PT7A 1EIWA 1F7VA 3JQ6A 3DVAB 1YS9A 1UZMA 4PZ0A 3R4CA 2QJOA 4WNCA 4IMIB 1JEQA 1QG4A 3H8JA 3JQ8B 1XVTA 2DWQA 2YBEA 2YXEA 3IC5A 3KJXA 4MV9A 3G8DA 5J5AA 2WUEA 3W5SA 3U61B 4OJMX 2DB3A 3JATB 3QVSA 1G8HA 4EFKA 1E3TA 3O2JA 5ICSA 1T8RA 2GJ8A 1WE2A 3E18A 5FEUA 2OCIA 2OD9A 3DCNA 3HXMA 4ZJUA 5FULA 1RMYA 2Q2QA 1H3FA 2DHRA 4YMVA 2QAGB 1SCQA 4MR9B 4H60A 2JBAA 1V6AA 1INLA 2RJOA 5FHRA 2CHUA 2UVDA 3ZVLA 5D00A 5I3CA 1E3DA 3BBPA 1QH8B 1Z08A 2GMWA 2IPMA 3AM5A 2I6FA 3OE1A 4FTWA 1GARA 2OGZA 1GRRA 2C9BA 2EFEB 3KAPA 4HDSB 4P92A 2Q9BA 1E8NA 5IW8A 2ZB8A 4I6EA 2YZ2A 3QBVA 4URUR 3FVWA 1GG9A 4JWTA 5LYJA 1QHGA 2V7TA 5MGNA 5L53A 3NV7A 2WHYA 4F8JA 4X6LA 4Q4JB 3FI9A 3C3MA 4F0JA 5K01A 2XA2A 1FFAA 3QA2A 2RSLA 3MTEA 2G6BA 3K35A 4BN0A 3I9NA 4PE5B 3VH1A 1Q7BA 1QGOA 2PX2A 3ZG6A 2QZPA 3ANSA 1WW8A 1EMDA 1YZQA 2SICE 3BM5A 1ZONA 2JLRA 3C0KA 4G5RA 4J1QA 3C16C 3ND5A 4KACA 4DM7A 1W0KD 2F8SA 1QP0A 1BX0A 2WA1A 3C3DA 4I5GA 2BHSA 1AHNA 4C1BA 3D3WB 1NU6A 3LZ6A 1RC0A 3PQ6A 1UC9A 3CNQS 1ZW1A 2CNKA 4KYTA 4KADA 5DRYA 4J0IA 4MDFA 4EVQA 1RI1A 1K4MA 3TKAA 3PGXA 3RVDA 3KE8A 4D5EA 1J22A 1FQJA 3H97A 4F3NA 5MFZA 2HUPA 4GSLA 5HQTA 1F2TB 4OHMA 2IBTA 3ABRB 1G4HA 4TLCA 3K72B 1IPFA 4Y18A 4E70A 5EZYA 3KZVA 2I4RA 3K9QO 1MFZA 1XMJA 4ZODA 2Y0CA 1E3SA 1I3CA 4ERNA 3I8SA 2GT1A 3MS2A 1YBFA 3IVAA 2ZE6A 1NHGA 1FU4A 1T8UA 4CLRA 16PKA 2VEOA 1SBNE 3STWA 5LPNA 1ZHOA 4U0KA 5ICFA 3PITA 1G21A 2XQKA 4JKSA 1UBOS 3DO5A 3P2MA 2FWPA 2GZRA 3CNOA 3TDMA 1DBRA 4ZMRA 4OBWA 1FUUA 5K09A 3U5TA 1PV4A 4NJMA 5FUXA 4KR0A 1DDIA 3T7DA 1V1AA 2XMPA 3VTKA 4FLFA 2GDJA 2HJ9A 3DTVA 3ENKA 5BQPA 4D79A 5JVDA 4MITA 2AQKA 2DAPA 3QY0A 4UDXX 3ZEAA 5JZMA 1M6WA 3EAGA 1HH4A 1N8SA 1QRRA 4AM8A 3O03A 2H0QA 1RP1A 4ZAGA 2I6BA 4UZEA 4ZVSA 4D3SA 5HOQA 4YCNA 2H18A 3GFGA 2JZCA 1ODKA 4IXDA 4FC7A 1JHMA 1V4NA 2HMYB 2O4UX 3RV3A 3T1OA 2BWJA 1RQGA 3NTRA 1UKAA 1J49A 2P40A 3QBEA 4ZXPA 3VC1A 1YBHA 5GADl 4BVAA 1F12A 2V59A 2A30A 4DYVA 4QEDA 3HUUA 1ZIOA 2IEBA 2AG6A 3I92A 2OYCA 3RFFA 4CIWA 2G08A 2E87A 1BQ3A 5ESDA 3SC2B 5HIAA 1FZTA 1A71A 2KB0A 3I2IA 4CR7A 2XB2A 2ZJ3A 3HPQA 3IUMA 2H2AA 1MOPA 3DMTC 4P32A 2Q5EA 5KEIA 4MVXA 2MJLA 2QNIA 1OH7A 3VJKA 4TQ9A 3MGGA 1UT8A 4KYVA 4KUEA 3TG8A 1GN9A 1TFUA 2VP3A 1YU6A 4QSHA 1Z26A 4ER7A 2WWTA 4DLNA 1ZSNA 2ZYDA 1SXJD 2V03A 3ZZUA 2B1JA 3U44B 1VI2A 2WNIA 1QAQA 4Q1CA 2LCFA 1FP4B 2JKYA 1MP0A 4DBVO 1GDTA 4I1SA 1M0WA 4MRAA 3LYUA 4XYLA 3B2EA 1JDSA 4OBXA 4ND5A 5KNBH 3S1AA 2N75A 1CYEA 4PSCA 2RIPA 1VCHA 1ADJA 2YMMA 2X5JO 3KCQA 4JB3A 3V8EA 1XZFA 3GO7A 1FFBA 1Q1NA 3LGXA 3W90A 4W8GA 2G77B 4ENTA 1WUKS 2EOAA 2PWPA 1SZJG 1YONA 4F4JA 5A5GA 2D13A 3RE1A 4N9QA 3DOUA 1CC1S 1X8KA 1JDPA 3HMQA 3RG2A 5B55A 4D7AA 4EENA 1QR6A 1N5LA 2IZ7A 3OEHD 1YWGO 4DUYB 1I36A 1L3IA 1Y3DE 1WZ2A 2IQIA 3GFRA 2BFBA 1YL6A 3KT6A 1BMQA 1XTJA 1RJWA 4MWSA 1KFJB 3AR4A 3K70C 3LIPA 1M5TA 4G0YA 2MTBA 4ITVA 3I12A 3PFNA 4YK7A 3HE3A 5H82A 1RM5A 2QTHA 2MSKA 4L07A 4EA8A 5B3JC 5JDCA 5K8TA 2XGOA 2QRMA 3I2FA 4BP3A 3THWA 2RB5A 2DR0A 3W1EA 2XDYA 1SQ6A 1R4ZA 2C1EA 3FUXA 2FRVA 3I1YA 4NS4A 3G0CA 4O25A 2YHUA 3NYIA 1IY8A 4R8RA 4XQGA 3B1RA 4G84A 2RHBA 1LPMA 4P08A 1U2DA 3KQUA 1P2BA 1YR8A 4CGZA 2CHQA 1AXGA 1OLXA 1LLUA 2Q2NA 4ZV9A 1YFJA 3NDBB 1ZXBA 4X00A 5KQSA 2D62A 5HDQA 1O54A 2R11A 4Y67A 5KX5A 2ZCJA 2P2ZA 3L1KA 2DEUA 1KJYA 4NI5A 1U7ZA 5JSZA 1LDBA 1MIOB 2OZPA 4OF4A 3R2JA 7AT1A 1X74A 4KQ2A 1XGKA 3URKA 4D81A 4JU9A 3DOOA 5FI3A 5GV7A 2A0FA 4R40A 4UHCA 1WB6A 2PRSA 1PRYA 4G1MB 4EUEA 3LPNA 5GM1A 1YRWA 1QTIA 2ZYUX 3IIIA 1YZTA 3M1IA 4POOA 4YRMA 3C3AA 1J06A 4J0QA 3NHZA 2H1SA 3QEJA 5K45A 4OQQA 2C8LA 3KVNA 3OCYA 5JMTA 1XNGA 2A2ZA 3VH3A 2RONA 4C0LA 5I6DA 1TAGA 1TKCA 5DBHX 5HF9A 4MS4B 5CIYA 4PSUA 3RSZA 2ZCUA 5E9QA 4PZAA 4I5FA 3HI4A 2O05A 1V3TA 2FTKE 4HMQA 4ZVMA 3RTCA 2PA3A 1Y9AA 4FR2A 3ZVNA 2FRDA 2O6LA 3HKBB 2A0KA 3JD4A 1Y8RA 1NLYA 2GSDA 3LQ2A 5HCUA 1NR5A 1UWCA 1ZK2A 2ZBUA 3JQ9C 3Q7RA 4RELA 2ZRHA 4S1NA 1ZJZA 1RXUA 4UBNA 3C41J 4X93A 1IXKA 1O6GA 1S8NA 4IX9A 1I4DD 2FPKA 1UANA 3IE1A 1E9RA 1U0SY 2JAWA 4URXR 1UH5A 4YHBA 5FTKA 1EXVA 3V7WA 1GPWB 5DNUA 4RSGA 1NSTA 4IVQA 1H94A 5KINB 3UZUA 2HV8A 3QXXA 4I4TB 3PWZA 2PD3A 1U98A 3D54D 1YR9A 5CVDA 2IXEA 1FQOA 1QHNA 1UXOA 1Z0FA 5AXBA 3TZHA 1IB0A 2V6MA 3BEOA 2QR5A 3F5DA 1X38A 5E9AA 1YRQA 1OWPA 1N1GA 2HJHA 8LDHA 4KN8A 1AG9A 2YFQA 1AQYA 3B8EA 2XEXA 3D4IA 4NS1A 1S5PA 3EBPA 1RHUA 3Q3CA 3QXCA 3CH4B 4DQDA 5LJLA 2WD8A 4FYVA 3LQYA 3A0UA 3S7ZA 3RSSA 1KI1A 1G20E 5HDBB 1Y63A 1UFVA 3VHLB 4MMYB 5A4IS 4A36A 3K0KA 3DE2X 2H00A 1C1XB 3PRKE 4N5LA 5CAEA 1BN7A 3VR0A 3E27A 1UK7A 3E7PA 3RC1A 4BU0A 5BW5A 4PANA 2IL1A 5AWFC 2F62A 2QJFA 3UCEA 4DDUA 1A7KA 1GGMA 3KJQA 5JFGA 5BMVF 4YRGA 1T5IA 3EF3A 4BWFB 1P1JA 3VNQA 2CXOA 4ZCQA 1FW6A 4C0XA 5KKNB 3FYCA 3G9TA 3F6EX 1XC7A 1G5QA 2AR7A 4KPEC 1VSQA 2LE0A 4TTJA 3WGTA 1BVHA 3A0RB 4F7DA 2QRPA 4FS3A 1LNZA 4XFJA 4BQSA 2FN8A 4OYRA 5CFZA 1H1LA 2M32A 4LS3A 4TZKA 4PSAA 4UM9D 1MX1A 5DLQC 1KDYA 1A8SA 1G8JA 4FE4A 3V1LA 1G2OA 5K0GA 4S24A 2G0AA 3DHEA 4PYKA 2GN1A 2YOFA 4JEUA 1I2ZA 4HDKA 4QPJC 1DOAA 5C1DA 1VKHA 1VL1A 2FEXA 2ZTVA 4P7BA 4JDUA 4D41A 2YVUA 4Q3CA 4YRRA 3U3MA 1E69A 5EQJB 3R7FA 5EP2A 3ADCA 5F52A 3I83A 4DLUA 4HDNB 4OXQA 1VRWA 1A1VA 5EMMA 1AZTA 1DTWB 4X95A 1AH2A 3EXIB 3IAAA 3LDFA 1NUPA 2FJUA 2XEDA 3NVAA 4D4MA 4JOQA 4EQZA 2WM9B 3PXUA 1FDOA 3IKJA 3QBTA 5AD1A 3PFHA 3LI2A 4CU2A 3IVRA 3TK1A 1XQ1A 4GKKB 5CYOA 1S1CA 2FZKA 3KWLA 4A9AA 3DT9A 1Z4OA 4JLJA 2OCPA 3M3DA 3QFSA 2FDRA 1P31A 1NQ5A 1Z2OX 4MVJA 1FX0A 1T0PA 1QHHA 1WEHA 3HL0A 2L42A 2ZGVA 4GOXA 3LT5A 4LNUB 5CFQA 1KMCA 1Z7WA 2KBEA 3DE1X 3TBHA 3VR4D 4NBWA 3CN9A 3X2FA 4M9ZA 1V9CA 5J4KA 3DZBA 1YJXA 4GP7A 4XE5A 2JBWA 1Q0QA 4EW6A 2GFHA 3VPCA 5DN9A 2Q41A 3T95A 1R9NA 4PNHA 1TPZA 1VC2A 2QA5A 4IICA 1K7SN 1UMKA 2BEUB 2JCXA 4H35A 4TLLB 1ONSA 2NU6B 2R4UA 1R10A 1U65A 2LCQA 1J09A 1NC1A 4PZZA 2ZTSA 1BTOA 1L2LA 5JRJA 4I3GA 5L51A 1FNMA 1QGAA 2VWQA 1UXKA 2JH8A 2YMPA 3GRKA 4NARA 1Z8HA 3FCXA 2VHQA 2W71A 4P2GA 4F2GA 5J58A 3TPCA 3L7DA 4URZR 2A94A 3WLRA 2VUSA 3L40A 4P31A 4EB0A 3B3AA 4HX9A 3D6UA 4N5IX 3QHPA 3EJWA 4GE0A 1NTRA 2WP8J 4YT2A 1FGSA 2WIKA 5B3KA 3OWHA 1XP8A 4NE7A 1ESMA 1PT5A 2NNLD 3PQ7A 4GMFA 4R1OA 1CRLA 1CETA 3ECAA 4HQFA 3SXUB 4C14A 1K75A 3MAAC 3EVZA 1EIZA 3F7OA 1TUBB 2FVXA 3I2YX 3LPCA 1GG2A 2CFIA 1NFQA 2PJZA 4MO2A 1K9SA 4GOLD 3AHJA 4G89A 1L5SA 4TPKA 3PPWA 4NJEB 2GLXA 3GGSA 3NFRA 1LSJA 3IAS1 3W9SA 5JNUA 3WFZA 3MRVA 4GWLA 4PPFA 3FMGA 1U9YA 3ORRA 3VKFA 2R8EA 3NOOA 2WTMA 3GF4A 4IIHA 1OFUX 1LBSA 4E94A 3D02A 4MPDA 2AH5A 1WMEA 2OZVA 2QXYA 4I9NA 4KN6A 5CX1A 1GLNA 4AUNA 2ZCVA 1FTNA 5GWXA 4DMRA 4JJEA 3AHIA 4UQLA 5EKTA 4KQFA 4YTEA 1KO4A 1ZR2A 2HW8A 2JIBA 4Z9XA 3D2LA 4RIIA 3FOBA 2G36A 2REQA 3MT8A 1HE3A 1TTHA 4KGVA 1HYQA 3DV0B 2O2DA 1E2NA 3FMOB 3C70A 1PV1A 2C98A 2V8OA 4HNQA 4ACAA 4CV3A 1ZVKA 1T4CA 2CFCA 2QF7A 3GDOA 1LH0A 1P1BA 4GNKA 4H4EA 4K3UA 4KQCA 1SN7A 1K98A 3P9XA 4BMPB 2PH3A 3KR2A 3H5LA 4JGGA 3UQ9A 4ARBA 3THYB 2YC4C 1QTRA 1UMCB 1QGUA 2FJPA 3CGGA 3DHNA 4QUBA 4B75A 3RNLA 1R8XA 4DLBA 2WJJA 3I6BA 4I1PA 3L7YA 2D7JA 4GI2A 4H0NA 2VF2A 3G5MA 3LOQA 4YIHA 4X5OA 4CDRA 4N3GA 4WY8A 5IULC 1PO7A 3PRJA 1WHSA 2QVBA 3WGMA 1XMPA 1Q2UA 5CLGA 1QP4A 1EFRA 2DH6A 1Z18A 2CK3A 3ZOKA 1K86A 1XDUA 2J59A 1T3ZA 3WL6A 1PUIA 4Z7JA 3LJSA 4CT0A 5DCWA 1ZWKA 1JJFA 2EKLA 3BXZA 4LXYA 3FHYA 4D3FA 3HN7A 3DAPA 3OI7A 4E2FA 1FYXA 2BEKA 2C88A 4Q7QA 2CXSA 4Y9RA 5CU7A 2JGLA 4I9HA 4BFUA 4LV5B 4KWHA 3D4PA 1EX7A 4RACA 3NPMA 2W6CX 3BVPA 1DJMA 2A1UB 1CUHA 4KVZA 4JQYA 5KVVA 1WPXA 4D0RA 1P9WA 2J3EA 5IUKC 4C6RA 4F97A 1ZIDA 3RQ2A 4MICA 3N28A 1TKAA 1NSYA 1TA4A 5DH9A 1CT9A 1YB1A 3TNLA 3KHUA 1L5WA 3EFHA 4XIJA 3RUEA 4CM6A 2XMGA 4QG7A 4DG9A 2O2XA 4N9WA 4JLOA 1H9BA 1LV7A 4K6KA 2O3JA 1Y82A 4WLVA 5EIAA 2JVIA 3RT1A 5HRAA 1XZDA 4V24A 5LNK1 1NONA 3E6AA 3C6KA 2EFDB 2PO7A 4EM6A 2I2BA 1O7JA 2Q3FA 2VSFA 5JQGA 2FSVC 1PEKE 4J1TC 4JYBA 3ILYA 2D1RA 1O9BA 1SOUA 3PFGA 4WMLA 2C57A 1U1IA 2P8SA 4RAOA 1BWRA 3B38A 4XIFA 3TLXA 1DO2A 4BLVA 4PZPA 1Z07A 1H05A 3DLPX 1G3UA 2ZYIA 3FF4A 3WBBA 1TM1E 3TNDA 2C29D 3RUIA 1YHZA 3TZ6A 1OCEA 4CDGA 3EZYA 1F5SA 2EFYA 2AGVA 4IW3B 4S0XA 4L7QA 4HNGA 4DV6B 2PL9A 1G60A 2ZWPA 4G36A 1QHFA 3HVIA 1BH2A 1C0LA 2E89A 4NFSA 3JWGA 3UIEA 3UATA 1SXJE 2BBSA 5JDIA 3P96A 1VIAA 4HX2A 3A05A 2XGSA 4F72A 3GFQA 5J4VA 1CDEA 3U7IA 4XQEA 5I5GA 2I76A 5EJ7A 2YJZA 4PO1A 3TW0A 3ASYA 4ETMA 2G5CA 1WAMA 1QH1A 4PV7A 3TGPA 1I3MA 2J9ZB 3IDSA 4QASA 4Z7OB 3ZLTA 2QRJA 2R8ZA 1GZ6A 2GZ3A 2NZJA 1S2MA 2IU6A 2WFAA 3AVOA 1PUJA 3B82A 1BXGB 3HA2A 4M49A 1XZEA 1WKVA 2PSJA 2EWMA 5LQNA 1N0IA 4QYTA 5EWLA 2GNAA 3T94A 3THRA 4AKTA 4C88A 1Y4AE 4BP9A 2XJAA 1W48A 4R69A 4X1OA 1XDDA 2O2JA 5HTKA 3D6JA 2PUAA 3H9QA 4ARZB 2WAAA 2J07A 5FL7D 3N0WA 3DEJA 5IM5A 1DV2A 4XF7A 3N7AA 3DPUA 3PQ4A 2XMZA 4MMZB 4XGIA 3FCYA 3VNVA 2HBZA 3TBKA 3EWNA 3IEMA 4E69A 4ITUA 3KD3A 4W7IA 4B7CA 1ZOSA 1TFRA 2XYQA 4RGVA 2IF2A 2IV2X 4P81A 5EHIA 3I2HA 4CLOA 4LCJA 1E4OA 1FYWA 3P32A 2IZZA 3A28A 2GJ4A 5I8WA 5EKSA 1C4OA 3ZQ6A 5KO2A 1U7PA 4QNNA 1NI3A 3R75A 4K6MA 9LDTA 4PYLA 3H5TA 3LS2A 4HATA 4RJTA 5BW8A 1XAJA 5AVJA 4U6QA 4YUXA 1OB2A 2QD4A 4MKXA 2NT4A 4PONA 3KQSA 3ZNOA 4B44A 1KI8A 5IZCA 4YJ2A 1SBHA 1J00A 2QVYX 1JQLB 4E08A 1MT3A 2VHYA 4WW0A 2P2DA 3OQ1A 5HP4A 1NW4A 2HMAA 1RI4A 5GQSA 5IARA 2HA2A 3VR6D 4A10A 2F9FA 5HRUA 2V5UA 4WI1A 3L6BA 1U7OA 1LD3A 3QYFA 2VJPA 2TMKA 4EYQA 4YJFB 1AS2A 2HRBA 3E7XA 4PPGA 3TTTA 5EQDA 3OCWA 5JH7B 5JZ9A 1JBVA 4HG2A 2H4FA 3I76A 1A7JA 3AF6A 3HKCA 3KPWA 3L7MA 3UT6A 2FWRA 4IJ5A 4TRMA 2PCLA 3B53X 2HA6A 2LCIA 4JA2A 2FHPA 5A2GA 4JLUA 2WFZA 1NVMB 1K6IA 3CCBA 4Q34A 4O1LA 4XR4A 1SR8A 4RK4A 4MI6A 3LUPA 4O0LA 2HREA 4ZVOA 5C4GB 3DDZX 4MJ7A 2DC1A 2H85A 3EGWA 1Q12A 5JXGA 2NU8A 2ESRA 4S1PA 4PHHA 4F5DA 3W5IA 1Q17A 4PNEA 1ZXXA 5IK2D 5MDHA 5A04A 2VH1A 3WGYA 5LMNB 1NN0A 5AUPB 3GLGA 3RODA 1DADA 1Z38A 3NAMA 4CNQA 4J16C 1JR2A 5AIBA 3G89A 2C5LA 3IJPA 3T9BA 4IF6A 4X45A 3WO0A 4K9LA 4MB2A 5SZKB 4HZIA 9ATCA 1XRRA 2VZEA 1NXSA 3EJ6A 3DNMA 3QIAA 4D0LB 5FTLA 2HTEA 3O4GA 4QOFA 5J4LA 4TWAA 4OQMA 5BYFA 4FXOA 2NX2A 3N3AC 5F0ZA 5F11A 2FPIB 1FYEA 2FSSA 4JV5B 3WGQA 3BF7A 4YRLA 5CTAA 1CUYA 4JSTA 3ZGNA 4LY0A 2JC3A 4FN4A 2RHGB 3QA3E 3DWIA 1JVNA 1OI2A 4EDFA 1XJWA 1ZCZA 3KLOA 4R1NA 4BC1A 2P69A 5IFLA 3S81A 3VU0A 1AA9A 1T5TA 5C1BA 2GK3A 2JFHA 5D3MB 3TR0A 1SOVA 1ZMXA 5DMHA 2JGKA 1E6EA 2MSNA 1KH2A 3WSTA 5DNEA 3ID6C 1E4EA 1XMXA 1ESJA 2Q6LA 4W7SA 4Z2AA 3S5UA 5FWNA 3ICEA 2QTZA 3H75A 4Q3OA 1NNUA 2E4YA 2CNWA 3GEEA 4A27A 4BQRA 3DOEA 3EVTA 1TKBA 5KHOC 1WETA 1HFKA 4ZJPA 3JSXA 4O59O 3K0CC 3KAKA 2RKWA 2P9HA 3KC2A 3RJ5A 3TAUA 3CT4A 2FQYA 4LDQA 2D2FA 4YC7A 2XE8A 1S7GA 2POQX 2YWFA 3U7GA 3GLUA 4L6AA 2HRQA 2IXGA 3UMBA 4DDWA 1L5FA 3IQGX 1TQ2A 4CEJA 1JEDA 3AUAA 2UUAB 1SU6A 2WYOA 3BZWA 3JRNA 4OHBA 4GDMA 4B3DA 4JJ4A 3ZHZA 9ABPA 1JFRA 1ZM3A 3ZXYA 4D96A 4E5NA 1JEOA 3TQIA 1S7CA 1O1YA 5AJTA 4QPDA 2O7VA 5A9SB 1LRLA 2FZ4A 4L8YA 1MBZA 2QTFA 3EMBA 4O4LA 1OIVA 1FTSA 3MMSA 2J6IA 2OOKA 3CVJA 4N7MA 2OHVA 1QPGA 5BN5B 1YIDA 3B3JA 5K3DA 3RS4A 3LQRA 3HABA 1M5UA 5JLAA 4YPVA 4WZBE 3PP8A 4N8DA 4J1NA 4Q1BA 3D8SA 3SEFA 4JXXA 3MILA 1T6YA 5DHFA 2R85A 2WJGA 5TQIA 4JSYA 1LFDB 1G2IA 2WWIA 3FBWA 3LGSA 5F73A 1EFDN 4DCMA 3LC1O 2GARA 2WZCA 2ZSIA 4PSVA 5FDFA 3Q9NA 3DO6A 3QTLA 3LQ1A 3AH8A 1CE8A 4G25A 4GI3A 3SIXA 1MW8X 3HWWA 1Q0TA 4MWBA 2ZWOA 6YASA 3E1GA 5HUHA 1PDVA 2NV6A 1ZSVA 2VQDA 1NNI1 4NPHA 1NN3A 3U16A 4IIJF 1IBSA 1OY1A 4NZZA 3KP1A 3FGOA 3PDIA 5FR1A 2Z4RA 3PX3A 2MSLA 4IYJA 3S1SA 3D5EA 1J0BA 5T8KA 2V0GA 2EBWA 2P3QA 2B2CA 4PG4A 4PPQA 1CWUA 2ZIFA 1XAGA 2XHZA 2ZE5A 3NHAA 4KE6A 5J9FA 5B30A 5K8UA 3DLBA 2YIVX 2NADA 3M6IA 2QVCA 2XCTB 1K88A 2D74A 2ZEJA 2ZVPX 1XTQA 4DCGA 3NJ8A 4HQNA 3OPYI 4EHAA 3WISA 5CNJA 4IFIA 3RRNA 3ZWNA 1NZJA 4DL9A 4P3OA 3BBLA 4PGFA 4GG1A 5FTNA 3W5HA 4XGQA 4BNYA 4NYMR 2HV9A 4ZZ2A 3BQ9A 3SLRA 2HQ1A 2N1BA 3W7BA 5EXEA 1PW5A 3AVUA 3NIBA 1MC5A 2ZB2A 1WX1A 3RREA 4Y2XA 4TYQA 1EJ6A 1I9GA 3A06A 3BF8A 4EA6A 1NNEA 2ECKA 4BS9A 1B43A 3DWFA 4UNPA 1TE2A 4W82A 2WPDA 2VARA 1CJSA 5JMOA 2GPTA 3QI7A 1WLYA 3PKJA 5K4GA 3UVEA 3ELBA 1FX1A 5IM4A 2B5OA 2VF5X 5AW1A 5FX2A 3ONDA 4K26A 1O58A 4R2LA 2ODBA 4J4TA 1PJ2A 2GM9A 1PTJA 1R0ZA 2HCRA 1QK3A 4B6GA 1QFJA 2CHVA 1MG0A 1NMYA 1QZXA 3PNPA 4TM7A 5BVHB 2VXOA 3TRJA 3LG2A 4BGDA 3WGHA 1Y8QB 1GRQA 3FETA 4LHZA 1B8UA 4AJEA 4XFDA 1R4NA 2YZMA 2Z83A 1IQRA 4K9OA 4FB5A 4Y2UA 2HMUA 4LRQA 4BNKA 2PZBA 2QZJA 3E3AA 1Q0RA 3FFWA 3GRZA 1BAPA 1L7DA 4UFOA 4WKCA 2AKYA 2O57A 3PC7A 1JMKC 4RK1A 1Q57A 3DGFC 3VYUB 2ATVA 1NPYA 3CVOA 2CF6A 1UXIA 1RXCA 4MRMB 3M1AA 5AICA 4PWZA 1AM4D 3AP2A 5IU6A 4HH1A 3K30A 1SCAA 1ZRMA 4WV3A 4ZQIA 3C98A 2NVBA 1XBTA 4CM8A 4RMGA 4GICA 3UV7A 1ISSA 4QARA 2N42A 1FMJA 2CW5A 4ZEVA 1P29A 2D54A 3W04A 4W4TA 3C1TA 3FJYA 4QHSA 3VDNB 5CR9A 4OQEA 2YQZA 1Q0HA 2PUVA 4UBIA 5ECGC 3A36A 2OP0A 4PLZA 1ILEA 2ABSA 4HYTA 4PLYA 3UJ3X 2BEWA 1EFLA 1PZHA 5A1JA 2B20A 3FTQA 4UAJA 5EMNA 3KQKA 4KQGA 1TZ2A 1PJCA 2ZU0C 1NXQA 1RYBA 2GGSA 2Z6VA 4FBGA 4ZDKA 4HZGA 5FWYB 4N6OA 3HCDA 3G2OA 2LV8A 4XVRA 5AI0A 2G76A 4JT9A 4LJ7A 4RPCA 4OQDA 1AMOA 1HQDA 3TM5A 1NR7A 2GYVA 5K3BA 4BAGA 3GGJA 3RH0A 2X7HA 4WY2A 3DTNA 1EDDA 1ESNA 4IX1A 1NV9A 2V4ZA 1JXHA 2NVWA 3VZSA 4N0MA 5T3UA 3JQBC 4FGJA 2IHVA 2B25A 1DAIA 2ZAIA 2XCRB 1UM9B 2EL9A 4UHJA 1UEXC 3IA2A 5B64A 3OLVA 1F0KA 4A0SA 2R5WA 2W42A 1LNQA 2QGZA 1S4QA 3ONVA 2GRAA 1EGMB 2N9UA 2EZ8A 3CWQA 1S8AA 4PAMA 4CVKA 2CMKA 4JITA 1C7JA 1YB7A 1NI4A 4RS3A 3NOXA 1BW9A 1KH1A 2IOFK 2JHAA 5L3QA 1QWSA 4NLLA 3CUSA 1AF7A 1ENZA 3ZDXB 2X4LA 1Y3CE 3N8KA 1RP7A 2IXDA 4R2HA 2D1TA 4K8RB 4N3NA 3IV7A 4S1WA 2G9UA 1NURA 1PSWA 1DRVA 3IVMA 4QULA 3H2KA 1YTUA 1RHMA 3OCUA 5E7JA 2ICAA 3FKQA 2G83A 2Z30A 3KXPA 2OO5C 4FSXA 1X3SA 3VYTB 3EXHC 5EUCA 1KRWA 1Z5UA 3I01M 3FOWA 1QZ3A 2JVJA 4G1EB 3I8OA 3IVGA 4MYRA 1LQ2A 4X63A 3UXHA 4XJVA 1MD9A 2VKTA 3GR6A 4E5DA 1WDLA 4RABA 5K3OA 1IHOA 3RVOA 2W2KA 1QO0A 4DJDC 3FUUA 1H2EA 2O2YA 4PZYA 4KOEC 1AGPA 2Q5IA 3IRUA 1U0OC 2BBTA 3OLQA 4L28A 4G26A 1Y5LA 5DW3A 5C8YA 2BFCB 1Z2DA 4RVFA 1ECJA 1SWVA 4P33A 3W8DA 3PEUA 3FFXA 4DC9A 1HDOA 3P94A 5DZSA 1HYEA 2QPAA 3OA2A 4KLAA 1WUIS 1ZNZA 5LB2A 3G0OA 1RWOA 3KFVA 2AC7A 1WB5A 1UP7A 2VA9A 3AGQA 3HZZA 4AFNA 2VORA 2F4VB 2BGMA 5TGZA 3ZHOA 2QXUA 3B1PA 3IVXA 4EYSA 5IUJC 1P4SA 3D2BA 3A9RA 2HL6A 1BJTA 2CJYA 5BXYA 5D5HA 3V7NA 4ENUA 3HU2A 4NENA 3AUJB 4BNFA 1ADCA 1GQFA 1WCIB 1Y3IA 2AHOA 5A6VA 1OLUB 1KORA 2FMUA 4M1YA 4P3NA 3H84A 4C20A 1V45E 1NXWA 1XX6A 4GPD1 5AI4A 5DTEA 4BRUA 4ZI7B 1UPBA 1Z2CA 2J4FA 1TEZA 1G8FA 1T0HB 1CF4A 4N6GA 2OHJA 3QPVA 1PJQA 4LTMA 2NUTA 2GS9A 2XZPA 3ZPXA 2ABQA 2RCNA 2XKBA 5FOTA 3C8UA 2QRKA 3G68A 3H9JA 1VE9A 3NQ41 1E1KA 3W3ZB 3NTUA 4NFLA 5D01A 3IUYA 1H6AA 3GEMA 5GJVC 3SE0A 4K6GA 3WKBA 2EKPA 4BVJA 3LDGA 5BWLA 2HEGA 3A1DA 3DFMA 3O9ZA 4I55A 1A4UA 2FSGA 1L7XA 3PCTA 1GU1A 1M8JA 4LJYA 3ESDA 4RH3A 1WV0A 4V2IA 3HSSA 3UBTA 3T9FA 1HX7A 3LH5A 3AWIA 4XARA 3UYKA 3UT0A 3A7DA 5TY0A 4E4RA 1OU0A 3HK2A 4MVJD 5FJIA 3I9MA 3RC9A 2C5GA 2GAJA 1D1QA 3VAYA 1N2JA 4RF3A 5FWXA 3NANA 2J6CA 1ZC3A 4BCCA 2WYUA 1KE2A 3JQQA 1U2PA 1GD1O 4X1IB 1FFSA 3BEDA 5KVCA 2PVPA 3IEXA 1ISPA 3MYYA 4FMCB 4FVTA 4DW8A 3V4RA 2XDQB 3KBOA 1SHJA 5A3JA 1CZKA 2PYIA 4N3CA 3TXXA 3UMMA 1G20B 3TQCA 3BTSA 4LJLA 3FRHA 3A10A 3JQAB 3Q0EA 2ODEA 2XVMA 4B4DA 2P67A 1RIIA 1SBTA 3L93A 4JZKA 4RJLA 4QM6A 1JMVA 1AB5A 5E8JA 4MQFB 3L8ZA 3A4IA 5GY7A 4WXMA 3U7HB 3AL0C 2DDOA 3UMPA 2BMVA 3W5AA 4EGAA 5E6UB 1ISMA 3EVEA 3KQLA 1ISFA 3WKCA 3OQOA 4EI9A 3PSHA 4FEGA 1VXOA 4DLVA 5KYUA 5F1OA 3PQEA 4D56A 4US2R 2IYNA 1UBGA 3IP9A 3FF1A 3VPDA 2GD6A 3ZE7A 4NYJR 3AW8A 3QOYA 3CKLA 4HUQB 3NLLA 3ZDCA 1A04A 2NXWA 3PC3A 1Y48E 4QJBA 1R64A 3C4JA 3IQZA 1NUHA 2EX0A 2RGGA 4RU1A 5JJLA 2QYTA 5D6NA 1YJ5A 5ALZA 4P54A 3UC9A 2EJCA 2XQFA 1XDGA 2BF7A 4E5MA 2LP4Y 2C4UA 3H1EA 2G8LA 1HK7A 2ODNA 3IB3A 4IOKA 5FXMA 3T5TA 3UJHA 3EPHA 1B1AA 1EP9A 5EQFA 1P1KA 1QF9A 1Z17A 2Q6IA 2W5UA 3IIMA 5CFPA 4HXFB 1P1CA 2SKCA 4JJFA 2COEA 4G9BA 3AETA 5DTJA 5GVRA 4RF2A 5I9MA 2F9MA 2ZP1A 3DYBA 3FTNA 4NU0A 3BXHA 1AKWA 2ILVA 2Z09A 3C1UA 1DEKA 1CFZA 3HEAA 5M3BA 4M4SA 4U0JA 5ALTA 2R1ZA 1JEYB 4H0CA 1V16A 1TQ8A 1WCV1 4FZVA 1YZNA 4ZYXA 1JHDA 1OKKD 2P5YA 5CA1F 5LJIA 3B1FA 2FMTA 4CFZA 4JBWA 4JVSB 1MJGM 1AUPA 1BFDA 2PD4A 1E3IA 4G81A 5TNXA 1LPSA 5HPYB 2PZGA 1E3WB 4OH1A 4QODA 5CGEA 1C7QA 2QDKA 1J9ZA 3R76A 4Q3EA 5FPPA 5FOVA 4B17A 3DWGA 3VPXA 4AY2A 2MINA 1RYMA 3PUKA 3LWZA 4MRNA 1G55A 4H15A 3JQFC 1OAAA 4QDOA 5BPFA 4FSHA 3MRXA 1JU4A 2CK3D 2FWNA 5KOYA 5ULLA 2H2FA 2AFIA 3BMXA 1HTBA 3F8SA 2E37A 4OXYA 3DMTA 4RF5A 2WWVD 3DVQX 2P9GA 4O4JA 4MR8B 3I09A 3B1ZA 4DU5A 1ENYA 2C00A 3A9WA 2UZ0A 5IX8A 2I3GA 1OQAA 2ATEA 4RS4A 5TPWB 4GEGA 3AF3A 3BGDA 3S55A 1B6SA 1N77A 1JIKA 3OZXA 3D6MA 4ZQHA 5HRCA 4UPVA 3VHQA 1YQUA 1JTEA 3CSUA 1BRTA 1KMHA 1KJNA 3OJLA 2PK3A 4ZAXA 3WBJA 2VDRB 5JXWA 3RS8A 3MQ2A 1U4NA 4O4IA 1S3SA 1IVSA 4IFTA 1JR3A 4YT4A 5JBQA 3VZCA 3ZBUA 4N7JA 1QYWA 1O6BA 4JR1A 3O73A 5AT1A 5FWAA 1M66A 4BO1A 4EL5A 1OH6A 3R7AA 1MCZA 5LDHA 4BASA 1ZK0A 4ZI5A 3G85A 2QPOA 1TL7C 4WAUA 1ZGGA 2VXCA 3VZDA 3Q40A 1X80A 3EYWA 5CVEA 4EYEA 3U5ZB 5D7NA 2XZDA 5CJJA 3QKSA 4XSHA 2WHXA 1DV1A 5AI8A 3FMVA 2MYPA 4P3PA 1OW3B 5BOSA 5DT2A 3T3NA 1RMQA 1ZO8A 1O6ZA 5HX7A 2ODWA 2Y1KA 4GYWA 2NU9B 2WWHA 3AVVA 2QTCA 3SZOA 1NVEA 2BKAA 3AERB 5L3VA 5B3JA 3RSOA 4B5KA 1DTSA 4TWRA 5DOVA 3WNQA 3OOHA 3BJMA 4C0JA 3TR6A 2BSQA 4B6PA 3M4XA 4GQBA 4C4SA 1ISJA 1D2AA 1GGFA 3HRIA 3D4BA 4QEZA 3FR8A 2M6LA 1T1RA 4IIVA 4KIUA 3TZEA 2HNAA 3BMNA 1TO2E 4ZOLA 5FNVF 3A58B 4CODB 4NOLA 2GCOA 3LC0A 2K87A 3FUCA 5IH3A 4BNGA 5I5EA 3TG2A 2NSHA 4WFIA 1FE8A 1EGHA 4M46A 1OWOA 1U7HA 4TYPA 5BSGA 5E2BA 1B0AA 1L7MA 1TRHA 2FW0A 1H69A 3NRSA 4YONB 1HYGA 2WIAA 1LS1A 2JIRA 1X13A 2VT6A 3B7PA 4JD5A 5HKLA 4X64B 4H7PA 4AWXA 1RKXA 1BH6A 5HJ7A 3LW8A 3K5IA 5AK6A 1B16A 1EVEA 3IMGA 5JZSA 1MABA 4LYHA 1SKAA 4S05A 1XPOA 2XZLA 1Y8ZA 1Q21A 2P9EA 1CXZA 2BGIA 3WGOA 1ONOA 4CEHB 5JWRA 2RHTA 1M2GA 3B9QA 4ZOEA 2EG5A 1YGPA 2DBVO 2QTBA 3AFNA 4LOKA 5E1OA 6REQB 1RNLA 4OMFG 1ECFA 3OF2A 1P8AA 4AD8A 1RLOA 3EF0A 1SG0A 2XCIA 3AGPA 3X1MA 2X8LA 3SJZA 1SWWA 4AECA 2IS2A 4BVLA 3H11A 4UPDA 2PHZA 2R66A 3B85A 5TQJA 2I7DA 2Z08A 4C03A 3Q1LA 2QPLA 1JAYA 2CLHB 1FMLA 1QIMA 1TJNA 4NATA 4P7GA 5B58C 1RKAA 3E9ZA 3T5PA 2HC9A 3BDIA 2GRJA 1T8SA 3F96A 3MJDA 4EJSB 3MTIA 4OB7A 1ZH8A 3KUDA 3C39A 2IU4A 5I4BA 3ZWVA 2DUMA 3DLTA 1XZIA 3FHLA 1H2HA 2P9TA 3ILHA 3KKEA 4KK3A 2QVLA 2H4XA 4P22A 4G4GA 2FPGA 3T34A 4H6XA 3WNDA 1HFWA 1X7YB 2MWMA 2XUKA 2XIQA 3NJ4A 4HNAB 3ZCTA 1AMUA 3TVTA 2HU8A 1C8KA 3E9RA 2ZQZA 3A1TA 5EG5A 3TIIA 2R79A 9LDBA 3WL3A 4C4AA 3PLAE 2WICA 4GL4A 4RH1A 5G4KB 4OFBA 1L0BA 2LBPA 1OBCA 4EKGA 1SXJB 5AKYA 1PUXA 4TRJA 1XZCA 4CDNA 3KJEA 3FYHA 3L4EA 3IR5A 3ROPA 4AX8A 3OPYB 4IWNA 5JZOA 1ZUHA 2OC4A 4LYDA 5B1IA 1DEXA 1DFHA 2Z04A 1UOPA 4IDHA 4M0FA 4BDSA 4JC0A 4N3AA 1OU4A 2J5RA 1U28C 1VJTA 2NPIA 2FG7C 4Q9IA 4ZHQB 5CM5A 1XO1A 3C5EA 3PNQA 1DBVO 1POWA 3AHCA 1DL5A 2P2LA 2Y0BA 2PBZA 3QEMB 5DKFA 2PSSA 2UZ1B 1UWKA 3F2VA 3WQSB 1W7KA 3X2SA 1FSZA 1TUGA 4L6CA 5AHRA 4QPPA 4DTIA 4E3AA 2C3OA 5F5NA 2XMDA 4FOPA 1OROA 4CTNA 1E18A 1DKPA 4F9EA 3N86A 2BE7A 5EJMA 1N0UA 1O9GA 4R54A 4X61A 1JEEA 2DKNA 3OIFA 4I50A 4GLOA 1IBMB 1JA1A 3H16A 4MARA 1P7PA 5AW3A 1J56A 3GVCA 1RQ2A 3P2JA 2XB4A 2FE1A 1NVGA 4WXPA 4EBFA 1IJEA 3NEJA 3Q12A 2D5CA 1IZ0A 2R62A 4B83A 2AD5A 3NDIA 1UBFA 1BX3A 3R41A 4NKRA 5HIMA 2PU7A 2WUWE 3ZI7A 1SVLA 1C1YA 4F8EA 1B23P 1YDGA 2Z2XA 4GYYA 5B2ZA 2RJ3A 4G5QA 1RJ9A 4DSAA 1BQ4A 5B3LA 1NBAA 3AL3A 4B80A 2CKMA 2Q4TA 4ND8A 1ORIA 3IT2A 4G3XA 2LIVA 1U8TA 2B69A 4HLDA 5AM0A 2H7XA 1Y8AA 3LOUA 4BOYA 4A8JA 1W2GA 3FMIA 1BX4A 2WTAA 2OFXA 1ZD9A 4NBLA 5ITZB 2XECA 5KQRA 3QXGA 5DPMA 5EXSA 4ZD6A 4Z7QB 2VUTA 5CB4F 1R6UA 3BD7A 3QKRB 3S2UA 2CFRA 1UPTA 3DZ8A 4WOKA 2VP6A 3LRPA 1BZYA 3UJ8A 2ZDHA 4N5NA 3GW8A 5BNTA 2W4IA 2BFEB 2VRBA 2ISSD 4A2CA 2CNWD 3J7TA 5AM1A 4WGFA 3ODGA 4Z99A 4ESEA 5JSUA 1AN0A 2JLUA 1V11B 3GEHA 4WY5A 2PXAA 3ZXIA 4G65A 4KK4A 2Z6AA 4CIAA 4UEQA 4L27A 4FSDA 2VR1A 4RORA 4FFBA 4URYR 2QY6A 4RX1A 4KIGA 3FLBA 1TA0A 2NZWA 2ORWA 4JODA 3BXFA 3MMPA 4BEBA 5IJ9A 3DB1A 2JPDA 2GZSA 5CB4A 2FUG1 1PJ4A 3ZE9A 5FLEX 3B52X 4QU8A 3ZR4B 5E4YA 1XTIA 5CFMA 5JMWA 2A9KA 4M0EA 3F49S 4DLRA 3R3XA 4O8ZA 1GZVA 1D1TA 4XGRA 3NFYA 4QG3A 3B9PA 3JARA 4NP6A 1CS0B 1ONPA 1WOYA 1UDCA 2D3TA 3OCZA 8ABPA 4OEHA 1PFGA 4FWBA 1HDGO 2GEBA 1CKEA 3PNOA 3CLUD 4QGGA 4UU7A 1AA6A 3ZLVA 4Y6RA 1ZNYA 5J2TF 3ZDQA 1AD2A 1G5PA 2H7VA 4L0CA 2J0UB 2P9BA 1ULHA 4P9NA 5LXTF 3HLYA 5ESWA 3A3YA 4OQPA 4B48A 6NULA 4EUSA 3AO0B 4JCCA 1RQRA 3KHKA 3UJ6A 4G8CA 4ARSA 1IRXA 2BFPA 3GRPA 5HFNA 1EVYA 3U1TA 1G16A 3MM4A 3UXMA 4F46A 1S02A 4L5JA 1EBFA 3BE4A 1CUAA 1CUWA 3QE3A 3AWDA 3M4JA 4MVJE 4Y9SA 1V5EA 2Q6OA 3LPDA 1JAIA 2Q3MA 1UBCA 1WR8A 1XTTA 3QELA 4YIKA 3ZGYA 1MKYA 1W35A 2YJ3A 5KJ1A 1QB8A 1E59A 1A5BB 1RLUA 2ZJBA 3X44A 1QF7A 2XT6A 3H9CA 1Z6PA 4O2AF 4ND7A 3B51X 5LQKA 4AYWA 2UU9B 2OGSA 2RI6A 4P35A 2C92A 3I9JA 1F8FA 3KJNA 3RYCB 1C2YA 2EG9A 3OHMA 4PCAA 3BQNB 3L8YA 1GA1A 4ENVA 1I14A 4NC9A 4ND2A 5EJ6A 1U6KA 2IH4A 5CGAA 4BJ3A 3UJAA 1LX6A 4DWJA 3EWSA 3IV6A 4RETA 4EUMA 4MLPA 3I4FA 5BR4A 4JVNA 3FNFA 1GGKA 5CNMA 1EKXA 5BQ5A 5EJ5A