3ZS7A

Crystal structure of pyridoxal kinase from trypanosoma brucei
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
299
structure length
277
Chain Sequence
MSEKTVLSIQSFVTHGYVGNKAATFPLQLHGFDVDGINTVCLSNHSGYPVIRGHRMSLQEYDELMEGVRANNFLSNYRYILTGYINNVDIIGRIRDTLKEVRELREKEDKKLTFICDPVMKEVLDAYRELVPLADIVTPNYFEASLLSGVTVNDLSSAILAADWFHNCGVAHVIIKSFRNPTHLRFLYSVKEGSEAAVRRFSGVVPYHEGRYTGTGDVFAACLLAFSHSHPMDVAIGKSMAVLQELIIATRKSRELRVVASPQVVLQPSTVVDVKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical, Genetic and Structural Assessment of Pyridoxal Kinase as a Drug Target in the African Trypanosome.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
molecule keywords PYRIDOXAL KINASE
total genus 94
structure length 277
sequence length 299
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2011-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3zs7A00
4XF7A 3IKHA 4LBGA 4E8YA 3DRWA 1RKSA 4KAHA 2QCVA 3NL3A 4DC3A 5CGEA 3CQDA 1LIJA 4O1GA 1TD2A 5F0ZA 4N09A 1C3QA 2C4EA 3BGKA 3VASA 4LC4A 2JG1A 1YGJA 1GQTA 2AWDA 1V19A 2I5BA 2PKKA 2VARA 3LKIA 4K8CA 5BYCA 1JXHA 4KBEA 1EKQA 1KYHA 3B1OA 5EY7A 3B1NA 2Q5RA 3W4SA 4E69A 5F11A 1L2LA 2YXUA 3B1PA 3HPDA 3NM3A 3RSFA 4K9CA 2AX3A 4EOHA 1RFVA 4K9IA 2PKNA 4KADA 3MBHA 4C5LA 3IE7A 4E8ZA 4K93A 3KEUA 4S1HA 5C3YA 5C40A 2PKFA 1LIIA 3RQ5A 2DDWA 2F7KA 5C41A 2PKMA 2QHPA 5TQIA 2I6AA 4O1LA 3RTDA 2I6BA 3RPZA 1VI9A 4U7XA 1V1BA 3GO6A 3HYOA 2A9ZA 3GBUA 3RU2A 5C3ZA 3IN1A 3RM5A 1U2XA 3PZSA 4DU5A 3RRFA 4XCKA 4YL5A 4E8WA 4GM6A 3RSGA 3RTAA 1UA4A 4K8KA 3OTXA 2DDMA 3UQEA 5BYEA 1GC5A 1YGKA 4X8FA 4XF6A 1WYEA 3QA2A 4XDAA 1RKAA 3HICA 3NC9A 3RQ2A 3QAIA 3VAQA 3RTCA 3KZHA 2AFBA 1UB0A 3RQHA 2HQQA 4UBEA 3RS9A 4C5NA 4JJPA 4C5KA 3NL5A 3NBVA 3B1RA 3FHYA 3RTEA 2JG5A 5BYFA 2JGVA 3NCAA 2YXTA 1RFTA 2R3BA 2AA0A 3NBWA 4KANA 1BX4A 1TYYA 2NWHA 1V1AA 3NL2A 3Q92A 3NL6A 4B8SA 4C5JA 1RK2A 4E84A 1V1SA 2AB8A 3B3LA 5BYDA 2FV7A 1VK4A 5COJA 5CGAA 3LOOA 2A9YA 4S1MA 1JXIA 4PVVA 1TZ3A 3RREA 4EN4A 4LBXA 3RQ6A 3UQDA 3UQ6A 3LJSA 3UQ9A 3MBJA 4KALA 1EKKA 3FHXA 3UMOA 1LHRA 3RQQA 3RO4A 4C5MA 1TZ6A 2V78A 3KD6A 4S1IB 3RTBA 3LHXA 5TRWA 2AJPA 1DGMA 3RTGA 1VM7A 4E3AA 3RT7A 4JKSA 2DCNA 3Q1YA 3RU3A 3K9EA 4YWRA 4N08A 1LIOA 3RRJA 3PL2A 3RSSA 2F02A 1ESJA 2HLZA 2RBCA 3DZVA 3H49A 3RQXA 3ZS7A 3N1CA 3K5WA 2C49A 3RY7A 4B8RA 3UMPA 3RQ8A 3B1QA 4EBUA 5EYNA 3JULA 5B6AA 1LHPA 3GO7A 1RKDA 3KTNA 3NC2A 4WJMA 3RPHA 3NM1A 3RT9A 3EWMA 3H74A 5CM5A 1RFUA 2ABSA 4LCAA 1LIKA 3UBOA 1YHJA 1ESQA 4JKUA 2AJRA 2XTBA 4K8PA 3IH0A 4S1IA 3BF5A 3IBQA 2DDOA 2R3EA 4K8TA 3I3YA 3RS8A 3RSQA 2HW1A 4EUMA 3IQ0A 2ABQA 3RRBA
chains in the Genus database with same CATH superfamily
1E0DA 5A5FA 4XF7A 3IKHA 3LK7A 4LBGA 4E8YA 2XPCA 1RKSA 3DRWA 4KAHA 5A5EA 2QCVA 3NL3A 4DC3A 5CGEA 3CQDA 1LIJA 1UAGA 1TD2A 4O1GA 4N09A 1C3QA 3ZM6A 2C4EA 3BGKA 3VASA 4LC4A 2JG1A 2WTZA 1YGJA 1GQTA 2AWDA 1V19A 2I5BA 2PKKA 2VARA 3LKIA 4K8CA 5BYCA 1JXHA 4KBEA 1EKQA 4BUCA 2UUOA 1KYHA 3B1OA 5EY7A 3B1NA 2Q5RA 3W4SA 4E69A 1P3DA 4HV4A 5F11A 1L2LA 2YXUA 3B1PA 3HPDA 3NM3A 3RSFA 4K9CA 2AX3A 4EOHA 1RFVA 4K9IA 2PKNA 4KADA 3MBHA 4C5LA 3IE7A 4E8ZA 4K93A 3KEUA 4S1HA 3ZL8A 5C3YA 5C40A 2PKFA 4BUBA 1LIIA 3RQ5A 2DDWA 2F7KA 5C41A 2PKMA 2QHPA 5TQIA 2I6AA 4O1LA 4ZIYA 3RTDA 2I6BA 2VTDA 3RPZA 1VI9A 4U7XA 1V1BA 3GO6A 3HYOA 2A9ZA 3GBUA 4QDIA 3RU2A 5C3ZA 3IN1A 3RM5A 1U2XA 3PZSA 2JFHA 4DU5A 3RRFA 4XCKA 4UAGA 4YL5A 2Y67A 4E8WA 2GCAA 4GM6A 3RSGA 3RTAA 4CVMA 1UA4A 2GC6A 4K8KA 3OTXA 4CVKA 2DDMA 2VORA 3UQEA 1GG4A 4C12A 5BYEA 1GC5A 1YGKA 3QCZA 4X8FA 4XF6A 1WYEA 3QA2A 4XDAA 1RKAA 3HICA 3NC9A 4CVLA 3RQ2A 3QAIA 3VAQA 3RTCA 3KZHA 2AFBA 1UB0A 3RQHA 2HQQA 2F00A 4UBEA 3RS9A 4JJPA 4C5KA 3NL5A 3NBVA 3B1RA 3FHYA 3RTEA 2JG5A 5BYFA 2JGVA 3NCAA 2YXTA 1RFTA 2R3BA 1J6UA 2AA0A 1GQYA 3NBWA 4KANA 1BX4A 1TYYA 2NWHA 1V1AA 1JBWA 3NL2A 3Q92A 3NL6A 4B8SA 4C5JA 1RK2A 4E84A 1V1SA 2AB8A 3B3LA 5BYDA 2FV7A 1VK4A 3NRSA 5COJA 5CGAA 3LOOA 2A9YA 4S1MA 1JXIA 1P31A 4PVVA 1TZ3A 3RREA 1O5ZA 4EN4A 4LBXA 3RQ6A 3UQDA 3UQ6A 3LJSA 3UQ9A 3MBJA 4KALA 1EKKA 2GCBA 4C5NA 3FHXA 1GQQA 2Y66A 3UMOA 1LHRA 2Y1OA 3RQQA 3RO4A 4C5MA 1TZ6A 1W7KA 1FGSA 2V78A 3KD6A 3PYZA 3RSSA 2X5OA 4S1IB 3RTBA 3LHXA 5TRWA 2AJPA 1DGMA 3RTGA 1VM7A 4E3AA 3RT7A 4JKSA 2DCNA 3Q1YA 2XJAA 3HJ6A 3RU3A 3K9EA 2UAGA 4N08A 4YWRA 1E8CA 2Y68A 1LIOA 3RRJA 3HN7A 3PL2A 2F02A 1ESJA 2HLZA 2RBCA 3DZVA 3H49A 3N2AA 2VOSA 1JBVA 3RQXA 3ZS7A 2GC5A 3N1CA 3K5WA 2C49A 3RY7A 4B8RA 1W78A 3RQ8A 3UMPA 3B1QA 2AM1A 4C13A 4EBUA 2AM2A 3JULA 5EYNA 5B6AA 1LHPA 3GO7A 1EEHA 1RKDA 3KTNA 3NC2A 4WJMA 3RPHA 3NM1A 3RT9A 3EWMA 2VTEA 3UAGA 3H74A 5CM5A 2WJPA 1RFUA 2ABSA 2UUPA 4QF5A 4LCAA 2JFFA 1LIKA 3UBOA 1YHJA 1ESQA 4JKUA 2AJRA 2XTBA 4K8PA 3IH0A 4S1IA 3BF5A 3IBQA 2DDOA 2R3EA 4K8TA 5F0ZA 3ZM5A 3I3YA 3RS8A 2JFGA 2HW1A 3EAGA 3RSQA 4EUMA 3IQ0A 2ABQA 3RRBA
chains in the Genus database with same CATH topology
4XF7A 3IKHA 4LBGA 4E8YA 3DRWA 1RKSA 4KAHA 2QCVA 3NL3A 4DC3A 5CGEA 3CQDA 1LIJA 4O1GA 1TD2A 5F0ZA 4N09A 1C3QA 2C4EA 3BGKA 3VASA 4LC4A 2JG1A 1YGJA 1GQTA 2AWDA 1V19A 2I5BA 2PKKA 2VARA 3LKIA 4K8CA 5BYCA 1JXHA 4KBEA 1EKQA 1KYHA 3B1OA 5EY7A 3B1NA 2Q5RA 3W4SA 4E69A 5F11A 1L2LA 2YXUA 3B1PA 3HPDA 3NM3A 3RSFA 4K9CA 2AX3A 4EOHA 1RFVA 4K9IA 2PKNA 4KADA 3MBHA 4C5LA 3IE7A 4E8ZA 4K93A 3KEUA 4S1HA 5C3YA 5C40A 2PKFA 1LIIA 3RQ5A 2DDWA 2F7KA 5C41A 2PKMA 2QHPA 5TQIA 2I6AA 4O1LA 3RTDA 2I6BA 3RPZA 1VI9A 4U7XA 1V1BA 3GO6A 3HYOA 2A9ZA 3GBUA 3RU2A 5C3ZA 3IN1A 3RM5A 1U2XA 3PZSA 4DU5A 3RRFA 4XCKA 4YL5A 4E8WA 4GM6A 3RSGA 3RTAA 1UA4A 4K8KA 3OTXA 2DDMA 3UQEA 5BYEA 1GC5A 1YGKA 4X8FA 4XF6A 1WYEA 3QA2A 4XDAA 1RKAA 3HICA 3NC9A 3RQ2A 3QAIA 3VAQA 3RTCA 3KZHA 2AFBA 1UB0A 3RQHA 2HQQA 4UBEA 3RS9A 4C5NA 4JJPA 4C5KA 3NL5A 3NBVA 3B1RA 3FHYA 3RTEA 2JG5A 5BYFA 2JGVA 3NCAA 2YXTA 1RFTA 2R3BA 2AA0A 3NBWA 4KANA 1BX4A 1TYYA 2NWHA 1V1AA 3NL2A 3Q92A 3NL6A 4B8SA 4C5JA 1RK2A 4E84A 1V1SA 2AB8A 3B3LA 5BYDA 2FV7A 1VK4A 5COJA 5CGAA 3LOOA 2A9YA 4S1MA 1JXIA 4PVVA 1TZ3A 3RREA 4EN4A 4LBXA 3RQ6A 3UQDA 3UQ6A 3LJSA 3UQ9A 3MBJA 4KALA 1EKKA 3FHXA 3UMOA 1LHRA 3RQQA 3RO4A 4C5MA 1TZ6A 2V78A 3KD6A 4S1IB 3RTBA 3LHXA 5TRWA 2AJPA 1DGMA 3RTGA 1VM7A 4E3AA 3RT7A 4JKSA 2DCNA 3Q1YA 3HJ6A 3RU3A 3K9EA 4YWRA 4N08A 1LIOA 3RRJA 3PL2A 3RSSA 2F02A 1ESJA 2HLZA 2RBCA 3DZVA 3H49A 3RQXA 3ZS7A 3N1CA 3K5WA 2C49A 3RY7A 4B8RA 3UMPA 3RQ8A 3B1QA 4EBUA 5EYNA 3JULA 5B6AA 1LHPA 3GO7A 1RKDA 3KTNA 3NC2A 4WJMA 3RPHA 3NM1A 3RT9A 3EWMA 3H74A 5CM5A 1RFUA 2ABSA 4LCAA 1LIKA 3UBOA 1YHJA 1ESQA 4JKUA 2AJRA 2XTBA 4K8PA 3IH0A 4S1IA 3BF5A 3IBQA 2DDOA 2R3EA 4K8TA 3I3YA 3RS8A 3RSQA 2HW1A 4EUMA 3IQ0A 2ABQA 3RRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XF7 A;  3IKH A;  4LBG A;  4E8Y A;  3DRW A;  1RKS A;  4KAH A;  2QCV A;  3NL3 A;  4DC3 A;  5CGE A;  3CQD A;  1LIJ A;  4O1G A;  1TD2 A;  5F0Z A;  4N09 A;  1C3Q A;  2C4E A;  3BGK A;  3VAS A;  4LC4 A;  2JG1 A;  1YGJ A;  1GQT A;  2AWD A;  1V19 A;  2I5B A;  2PKK A;  2VAR A;  3LKI A;  4K8C A;  5BYC A;  1JXH A;  4KBE A;  1EKQ A;  1KYH A;  3B1O A;  5EY7 A;  3B1N A;  2Q5R A;  3W4S A;  4E69 A;  5F11 A;  1L2L A;  2YXU A;  3B1P A;  3HPD A;  3NM3 A;  3RSF A;  4K9C A;  2AX3 A;  4EOH A;  1RFV A;  4K9I A;  2PKN A;  4KAD A;  3MBH A;  4C5L A;  3IE7 A;  4E8Z A;  4K93 A;  3KEU A;  4S1H A;  5C3Y A;  5C40 A;  2PKF A;  1LII A;  3RQ5 A;  2DDW A;  2F7K A;  5C41 A;  2PKM A;  2QHP A;  5TQI A;  2I6A A;  4O1L A;  3RTD A;  2I6B A;  3RPZ A;  1VI9 A;  4U7X A;  1V1B A;  3GO6 A;  3HYO A;  2A9Z A;  3GBU A;  3RU2 A;  5C3Z A;  3IN1 A;  3RM5 A;  1U2X A;  3PZS A;  4DU5 A;  3RRF A;  4XCK A;  4YL5 A;  4E8W A;  4GM6 A;  3RSG A;  3RTA A;  1UA4 A;  4K8K A;  3OTX A;  2DDM A;  3UQE A;  5BYE A;  1GC5 A;  1YGK A;  4X8F A;  4XF6 A;  1WYE A;  3QA2 A;  4XDA A;  1RKA A;  3HIC A;  3NC9 A;  3RQ2 A;  3QAI A;  3VAQ A;  3RTC A;  3KZH A;  2AFB A;  1UB0 A;  3RQH A;  2HQQ A;  4UBE A;  3RS9 A;  4C5N A;  4JJP A;  4C5K A;  3NL5 A;  3NBV A;  3B1R A;  3FHY A;  3RTE A;  2JG5 A;  5BYF A;  2JGV A;  3NCA A;  2YXT A;  1RFT A;  2R3B A;  2AA0 A;  3NBW A;  4KAN A;  1BX4 A;  1TYY A;  2NWH A;  1V1A A;  3NL2 A;  3Q92 A;  3NL6 A;  4B8S A;  4C5J A;  1RK2 A;  4E84 A;  1V1S A;  2AB8 A;  3B3L A;  5BYD A;  2FV7 A;  1VK4 A;  5COJ A;  5CGA A;  3LOO A;  2A9Y A;  4S1M A;  1JXI A;  4PVV A;  1TZ3 A;  3RRE A;  4EN4 A;  4LBX A;  3RQ6 A;  3UQD A;  3UQ6 A;  3LJS A;  3UQ9 A;  3MBJ A;  4KAL A;  1EKK A;  3FHX A;  3UMO A;  1LHR A;  3RQQ A;  3RO4 A;  4C5M A;  1TZ6 A;  2V78 A;  3KD6 A;  4S1I B;  3RTB A;  3LHX A;  5TRW A;  2AJP A;  1DGM A;  3RTG A;  1VM7 A;  4E3A A;  3RT7 A;  4JKS A;  2DCN A;  3Q1Y A;  3RU3 A;  3K9E A;  4YWR A;  4N08 A;  1LIO A;  3RRJ A;  3PL2 A;  3RSS A;  2F02 A;  1ESJ A;  2HLZ A;  2RBC A;  3DZV A;  3H49 A;  3RQX A;  3ZS7 A;  3N1C A;  3K5W A;  2C49 A;  3RY7 A;  4B8R A;  3UMP A;  3RQ8 A;  3B1Q A;  4EBU A;  5EYN A;  3JUL A;  5B6A A;  1LHP A;  3GO7 A;  1RKD A;  3KTN A;  3NC2 A;  4WJM A;  3RPH A;  3NM1 A;  3RT9 A;  3EWM A;  3H74 A;  5CM5 A;  1RFU A;  2ABS A;  4LCA A;  1LIK A;  3UBO A;  1YHJ A;  1ESQ A;  4JKU A;  2AJR A;  2XTB A;  4K8P A;  3IH0 A;  4S1I A;  3BF5 A;  3IBQ A;  2DDO A;  2R3E A;  4K8T A;  3I3Y A;  3RS8 A;  3RSQ A;  2HW1 A;  4EUM A;  3IQ0 A;  2ABQ A;  3RRB A; 
#chains in the Genus database with same CATH topology
 1E0D A;  5A5F A;  4XF7 A;  3IKH A;  3LK7 A;  4LBG A;  4E8Y A;  2XPC A;  1RKS A;  3DRW A;  4KAH A;  5A5E A;  2QCV A;  3NL3 A;  4DC3 A;  5CGE A;  3CQD A;  1LIJ A;  1UAG A;  1TD2 A;  4O1G A;  4N09 A;  1C3Q A;  3ZM6 A;  2C4E A;  3BGK A;  3VAS A;  4LC4 A;  2JG1 A;  2WTZ A;  1YGJ A;  1GQT A;  2AWD A;  1V19 A;  2I5B A;  2PKK A;  2VAR A;  3LKI A;  4K8C A;  5BYC A;  1JXH A;  4KBE A;  1EKQ A;  4BUC A;  2UUO A;  1KYH A;  3B1O A;  5EY7 A;  3B1N A;  2Q5R A;  3W4S A;  4E69 A;  1P3D A;  4HV4 A;  5F11 A;  1L2L A;  2YXU A;  3B1P A;  3HPD A;  3NM3 A;  3RSF A;  4K9C A;  2AX3 A;  4EOH A;  1RFV A;  4K9I A;  2PKN A;  4KAD A;  3MBH A;  4C5L A;  3IE7 A;  4E8Z A;  4K93 A;  3KEU A;  4S1H A;  3ZL8 A;  5C3Y A;  5C40 A;  2PKF A;  4BUB A;  1LII A;  3RQ5 A;  2DDW A;  2F7K A;  5C41 A;  2PKM A;  2QHP A;  5TQI A;  2I6A A;  4O1L A;  4ZIY A;  3RTD A;  2I6B A;  2VTD A;  3RPZ A;  1VI9 A;  4U7X A;  1V1B A;  3GO6 A;  3HYO A;  2A9Z A;  3GBU A;  4QDI A;  3RU2 A;  5C3Z A;  3IN1 A;  3RM5 A;  1U2X A;  3PZS A;  2JFH A;  4DU5 A;  3RRF A;  4XCK A;  4UAG A;  4YL5 A;  2Y67 A;  4E8W A;  2GCA A;  4GM6 A;  3RSG A;  3RTA A;  4CVM A;  1UA4 A;  2GC6 A;  4K8K A;  3OTX A;  4CVK A;  2DDM A;  2VOR A;  3UQE A;  1GG4 A;  4C12 A;  5BYE A;  1GC5 A;  1YGK A;  3QCZ A;  4X8F A;  4XF6 A;  1WYE A;  3QA2 A;  4XDA A;  1RKA A;  3HIC A;  3NC9 A;  4CVL A;  3RQ2 A;  3QAI A;  3VAQ A;  3RTC A;  3KZH A;  2AFB A;  1UB0 A;  3RQH A;  2HQQ A;  2F00 A;  4UBE A;  3RS9 A;  4JJP A;  4C5K A;  3NL5 A;  3NBV A;  3B1R A;  3FHY A;  3RTE A;  2JG5 A;  5BYF A;  2JGV A;  3NCA A;  2YXT A;  1RFT A;  2R3B A;  1J6U A;  2AA0 A;  1GQY A;  3NBW A;  4KAN A;  1BX4 A;  1TYY A;  2NWH A;  1V1A A;  1JBW A;  3NL2 A;  3Q92 A;  3NL6 A;  4B8S A;  4C5J A;  1RK2 A;  4E84 A;  1V1S A;  2AB8 A;  3B3L A;  5BYD A;  2FV7 A;  1VK4 A;  3NRS A;  5COJ A;  5CGA A;  3LOO A;  2A9Y A;  4S1M A;  1JXI A;  1P31 A;  4PVV A;  1TZ3 A;  3RRE A;  1O5Z A;  4EN4 A;  4LBX A;  3RQ6 A;  3UQD A;  3UQ6 A;  3LJS A;  3UQ9 A;  3MBJ A;  4KAL A;  1EKK A;  2GCB A;  4C5N A;  3FHX A;  1GQQ A;  2Y66 A;  3UMO A;  1LHR A;  2Y1O A;  3RQQ A;  3RO4 A;  4C5M A;  1TZ6 A;  1W7K A;  1FGS A;  2V78 A;  3KD6 A;  3PYZ A;  3RSS A;  2X5O A;  4S1I B;  3RTB A;  3LHX A;  5TRW A;  2AJP A;  1DGM A;  3RTG A;  1VM7 A;  4E3A A;  3RT7 A;  4JKS A;  2DCN A;  3Q1Y A;  2XJA A;  3HJ6 A;  3RU3 A;  3K9E A;  2UAG A;  4N08 A;  4YWR A;  1E8C A;  2Y68 A;  1LIO A;  3RRJ A;  3HN7 A;  3PL2 A;  2F02 A;  1ESJ A;  2HLZ A;  2RBC A;  3DZV A;  3H49 A;  3N2A A;  2VOS A;  1JBV A;  3RQX A;  3ZS7 A;  2GC5 A;  3N1C A;  3K5W A;  2C49 A;  3RY7 A;  4B8R A;  1W78 A;  3RQ8 A;  3UMP A;  3B1Q A;  2AM1 A;  4C13 A;  4EBU A;  2AM2 A;  3JUL A;  5EYN A;  5B6A A;  1LHP A;  3GO7 A;  1EEH A;  1RKD A;  3KTN A;  3NC2 A;  4WJM A;  3RPH A;  3NM1 A;  3RT9 A;  3EWM A;  2VTE A;  3UAG A;  3H74 A;  5CM5 A;  2WJP A;  1RFU A;  2ABS A;  2UUP A;  4QF5 A;  4LCA A;  2JFF A;  1LIK A;  3UBO A;  1YHJ A;  1ESQ A;  4JKU A;  2AJR A;  2XTB A;  4K8P A;  3IH0 A;  4S1I A;  3BF5 A;  3IBQ A;  2DDO A;  2R3E A;  4K8T A;  5F0Z A;  3ZM5 A;  3I3Y A;  3RS8 A;  2JFG A;  2HW1 A;  3EAG A;  3RSQ A;  4EUM A;  3IQ0 A;  2ABQ A;  3RRB A; 
#chains in the Genus database with same CATH homology
 4XF7 A;  3IKH A;  4LBG A;  4E8Y A;  3DRW A;  1RKS A;  4KAH A;  2QCV A;  3NL3 A;  4DC3 A;  5CGE A;  3CQD A;  1LIJ A;  4O1G A;  1TD2 A;  5F0Z A;  4N09 A;  1C3Q A;  2C4E A;  3BGK A;  3VAS A;  4LC4 A;  2JG1 A;  1YGJ A;  1GQT A;  2AWD A;  1V19 A;  2I5B A;  2PKK A;  2VAR A;  3LKI A;  4K8C A;  5BYC A;  1JXH A;  4KBE A;  1EKQ A;  1KYH A;  3B1O A;  5EY7 A;  3B1N A;  2Q5R A;  3W4S A;  4E69 A;  5F11 A;  1L2L A;  2YXU A;  3B1P A;  3HPD A;  3NM3 A;  3RSF A;  4K9C A;  2AX3 A;  4EOH A;  1RFV A;  4K9I A;  2PKN A;  4KAD A;  3MBH A;  4C5L A;  3IE7 A;  4E8Z A;  4K93 A;  3KEU A;  4S1H A;  5C3Y A;  5C40 A;  2PKF A;  1LII A;  3RQ5 A;  2DDW A;  2F7K A;  5C41 A;  2PKM A;  2QHP A;  5TQI A;  2I6A A;  4O1L A;  3RTD A;  2I6B A;  3RPZ A;  1VI9 A;  4U7X A;  1V1B A;  3GO6 A;  3HYO A;  2A9Z A;  3GBU A;  3RU2 A;  5C3Z A;  3IN1 A;  3RM5 A;  1U2X A;  3PZS A;  4DU5 A;  3RRF A;  4XCK A;  4YL5 A;  4E8W A;  4GM6 A;  3RSG A;  3RTA A;  1UA4 A;  4K8K A;  3OTX A;  2DDM A;  3UQE A;  5BYE A;  1GC5 A;  1YGK A;  4X8F A;  4XF6 A;  1WYE A;  3QA2 A;  4XDA A;  1RKA A;  3HIC A;  3NC9 A;  3RQ2 A;  3QAI A;  3VAQ A;  3RTC A;  3KZH A;  2AFB A;  1UB0 A;  3RQH A;  2HQQ A;  4UBE A;  3RS9 A;  4C5N A;  4JJP A;  4C5K A;  3NL5 A;  3NBV A;  3B1R A;  3FHY A;  3RTE A;  2JG5 A;  5BYF A;  2JGV A;  3NCA A;  2YXT A;  1RFT A;  2R3B A;  2AA0 A;  3NBW A;  4KAN A;  1BX4 A;  1TYY A;  2NWH A;  1V1A A;  3NL2 A;  3Q92 A;  3NL6 A;  4B8S A;  4C5J A;  1RK2 A;  4E84 A;  1V1S A;  2AB8 A;  3B3L A;  5BYD A;  2FV7 A;  1VK4 A;  5COJ A;  5CGA A;  3LOO A;  2A9Y A;  4S1M A;  1JXI A;  4PVV A;  1TZ3 A;  3RRE A;  4EN4 A;  4LBX A;  3RQ6 A;  3UQD A;  3UQ6 A;  3LJS A;  3UQ9 A;  3MBJ A;  4KAL A;  1EKK A;  3FHX A;  3UMO A;  1LHR A;  3RQQ A;  3RO4 A;  4C5M A;  1TZ6 A;  2V78 A;  3KD6 A;  4S1I B;  3RTB A;  3LHX A;  5TRW A;  2AJP A;  1DGM A;  3RTG A;  1VM7 A;  4E3A A;  3RT7 A;  4JKS A;  2DCN A;  3Q1Y A;  3HJ6 A;  3RU3 A;  3K9E A;  4YWR A;  4N08 A;  1LIO A;  3RRJ A;  3PL2 A;  3RSS A;  2F02 A;  1ESJ A;  2HLZ A;  2RBC A;  3DZV A;  3H49 A;  3RQX A;  3ZS7 A;  3N1C A;  3K5W A;  2C49 A;  3RY7 A;  4B8R A;  3UMP A;  3RQ8 A;  3B1Q A;  4EBU A;  5EYN A;  3JUL A;  5B6A A;  1LHP A;  3GO7 A;  1RKD A;  3KTN A;  3NC2 A;  4WJM A;  3RPH A;  3NM1 A;  3RT9 A;  3EWM A;  3H74 A;  5CM5 A;  1RFU A;  2ABS A;  4LCA A;  1LIK A;  3UBO A;  1YHJ A;  1ESQ A;  4JKU A;  2AJR A;  2XTB A;  4K8P A;  3IH0 A;  4S1I A;  3BF5 A;  3IBQ A;  2DDO A;  2R3E A;  4K8T A;  3I3Y A;  3RS8 A;  3RSQ A;  2HW1 A;  4EUM A;  3IQ0 A;  2ABQ A;  3RRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...