3ZS7A

Crystal structure of pyridoxal kinase from trypanosoma brucei
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
299
structure length
277
Chain Sequence
MSEKTVLSIQSFVTHGYVGNKAATFPLQLHGFDVDGINTVCLSNHSGYPVIRGHRMSLQEYDELMEGVRANNFLSNYRYILTGYINNVDIIGRIRDTLKEVRELREKEDKKLTFICDPVMKEVLDAYRELVPLADIVTPNYFEASLLSGVTVNDLSSAILAADWFHNCGVAHVIIKSFRNPTHLRFLYSVKEGSEAAVRRFSGVVPYHEGRYTGTGDVFAACLLAFSHSHPMDVAIGKSMAVLQELIIATRKSRELRVVASPQVVLQPSTVVDVKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical, Genetic and Structural Assessment of Pyridoxal Kinase as a Drug Target in the African Trypanosome.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
molecule keywords PYRIDOXAL KINASE
total genus 94
structure length 277
sequence length 299
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2011-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3zs7A00
5B6AA 2RBCA 1JXHA 1LIKA 2DCNA 2PKNA 5EY7A 3NC9A 4GM6A 3RM5A 1RKAA 4YWRA 5C3YA 3BF5A 4N09A 3GO7A 2AWDA 5BYCA 2JG1A 4EBUA 4K8KA 3UQEA 1TZ3A 2PKFA 3KTNA 3LOOA 3PZSA 3MBJA 4KANA 3RTBA 3JULA 2JG5A 2I6AA 5BYEA 3EWMA 4EN4A 2AFBA 3IH0A 3NL3A 4EUMA 3NC2A 3UBOA 2R3EA 3RSQA 2NWHA 4KALA 1V1SA 2JGVA 3LHXA 2FV7A 4C5JA 3RY7A 3RPHA 1RFTA 2C4EA 1GC5A 1GQTA 4XDAA 3RRBA 3RQHA 5CGAA 1ESQA 3UMPA 3HYOA 4DU5A 5F0ZA 3RSFA 3B1RA 3IQ0A 1BX4A 3QA2A 1TYYA 1LHPA 1U2XA 4E69A 3IN1A 4PVVA 3UMOA 3RTAA 1VK4A 2AX3A 2AJPA 4S1MA 1TZ6A 4E3AA 3DZVA 3IBQA 2DDMA 3GBUA 3OTXA 4S1HA 3RQ8A 3VAQA 3W4SA 4LBXA 3HPDA 3RREA 3FHXA 1UA4A 2AA0A 1EKQA 3I3YA 3NL5A 4DC3A 5CM5A 3UQDA 5C41A 4C5MA 3RT9A 2DDOA 2VARA 1LHRA 2ABSA 3KD6A 3B1QA 3B1OA 2YXTA 2C49A 2R3BA 3RQXA 2A9YA 3MBHA 4LC4A 3QAIA 3Q92A 4K93A 3NM3A 1RFVA 1RK2A 3CQDA 5TQIA 3RU3A 4LCAA 1JXIA 3HICA 3RQQA 3RRFA 2HW1A 3B3LA 4UBEA 2ABQA 4LBGA 3RTDA 2V78A 4E8WA 4C5LA 1V1AA 4N08A 5CGEA 3RO4A 4U7XA 2Q5RA 4KADA 3NCAA 3RS9A 1RKSA 3KZHA 2AJRA 3BGKA 4B8RA 4KAHA 1TD2A 3N1CA 3RQ2A 3RTGA 4YL5A 3LJSA 1V19A 5C40A 3VASA 3NM1A 4E84A 3K9EA 4O1LA 4JJPA 1EKKA 3H49A 1VI9A 1RFUA 3RT7A 4C5NA 3ZS7A 2F7KA 4EOHA 3B1NA 4WJMA 4JKSA 4C5KA 2I6BA 3RSSA 2A9ZA 1RKDA 2AB8A 4K8CA 3RQ6A 4B8SA 5BYFA 5BYDA 1VM7A 1DGMA 3Q1YA 5F11A 1YHJA 2XTBA 3RRJA 2QCVA 4XF7A 3IE7A 2I5BA 3KEUA 4K9IA 3RQ5A 3NBVA 4K8PA 1WYEA 2PKKA 3GO6A 2HLZA 1ESJA 2PKMA 3DRWA 3FHYA 4S1IA 2DDWA 4JKUA 4X8FA 4E8YA 3UQ9A 4KBEA 4E8ZA 1C3QA 3RU2A 3B1PA 3NL2A 3RS8A 3IKHA 1V1BA 4S1IB 3LKIA 1KYHA 4K8TA 4O1GA 3NL6A 1LIJA 3RTEA 3UQ6A 4XCKA 5EYNA 4XF6A 1YGKA 3RTCA 3RPZA 3K5WA 1UB0A 3RSGA 5C3ZA 5COJA 1LIOA 2F02A 5TRWA 2YXUA 3H74A 3NBWA 1L2LA 1YGJA 2QHPA 2HQQA 3PL2A 4K9CA 1LIIA
chains in the Genus database with same CATH superfamily
3EAGA 1GG4A 2X5OA 4X8FA 2RBCA 3RM5A 1JXHA 4CVMA 1LIKA 2DCNA 2PKNA 2XJAA 3HN7A 3NC9A 4GM6A 1RKAA 5EY7A 4YWRA 3BF5A 4N09A 3GO7A 2AWDA 5BYCA 2GCBA 2JG1A 4EBUA 4K8KA 3UQEA 1TZ3A 2PKFA 3KTNA 1O5ZA 3LOOA 3MBJA 3PZSA 3ZM6A 4KANA 3RTBA 3JULA 2JG5A 2I6AA 4ZIYA 5BYEA 3EWMA 4EN4A 2AFBA 3IH0A 3NL3A 4EUMA 3NC2A 3UBOA 2R3EA 3RSQA 2NWHA 1JBVA 4KALA 1V1SA 2JGVA 1JBWA 3LHXA 2FV7A 4C5JA 3RY7A 2VOSA 3RPHA 3ZM5A 1J6UA 1RFTA 2C4EA 2VTEA 5B6AA 1GC5A 1GQTA 2UUOA 1P31A 2Y67A 4XDAA 4C12A 3RRBA 3RQHA 5CGAA 4BUCA 1ESQA 3UMPA 3HYOA 3PYZA 2WJPA 3RSFA 4DU5A 5F0ZA 3B1RA 3IQ0A 1BX4A 3QA2A 1TYYA 1LHPA 1U2XA 4E69A 3IN1A 2VORA 4PVVA 3UMOA 2VTDA 3RTAA 4BUBA 4CVKA 1VK4A 2AX3A 2AJPA 4S1MA 1TZ6A 4E3AA 3DZVA 3IBQA 2DDMA 3GBUA 3OTXA 4S1HA 3RQ8A 3VAQA 2JFGA 4LBXA 3HPDA 3W4SA 3RREA 3FHXA 1UA4A 2AA0A 1EKQA 3I3YA 3NL5A 4DC3A 2UAGA 5CM5A 3UQDA 5C41A 4C5MA 3RT9A 2DDOA 2AM1A 1LHRA 2ABSA 2VARA 2Y1OA 3B1QA 3KD6A 3B1OA 2YXTA 2C49A 2R3BA 3RQXA 2A9YA 3MBHA 4LC4A 3QAIA 3Q92A 4K93A 3ZL8A 3LK7A 3NM3A 1RFVA 1RK2A 3CQDA 5TQIA 3RU3A 4LCAA 1JXIA 3HICA 3RQQA 3RRFA 2HW1A 3B3LA 4UBEA 2ABQA 2AM2A 2JFFA 4LBGA 2V78A 4UAGA 3RTDA 4E8WA 2F00A 1V1AA 4N08A 4C5LA 5CGEA 3RO4A 4U7XA 2Q5RA 1W7KA 3NCAA 4KADA 1RKSA 3KZHA 2AJRA 2XPCA 3BGKA 3RS9A 4B8RA 3QCZA 4KAHA 1TD2A 3N1CA 3RQ2A 3RTGA 4YL5A 5A5EA 3LJSA 1V19A 5C3YA 4CVLA 3VASA 2GC5A 3NM1A 3K9EA 4E84A 5C40A 4O1LA 4JJPA 1EKKA 3H49A 1VI9A 1RFUA 3HJ6A 1E8CA 3RT7A 2F7KA 3ZS7A 3B1NA 4WJMA 4C5NA 4JKSA 4C5KA 4EOHA 1UAGA 2I6BA 1E0DA 3RSSA 2A9ZA 1RKDA 1FGSA 4C13A 4HV4A 5A5FA 2AB8A 4K8CA 3RQ6A 4B8SA 5BYFA 1P3DA 1VM7A 1DGMA 5BYDA 3Q1YA 5F11A 1YHJA 2XTBA 2GCAA 3RRJA 2QCVA 4XF7A 3IE7A 2Y68A 2I5BA 3KEUA 4K9IA 3RQ5A 3NBVA 1EEHA 1WYEA 4K8PA 2PKKA 3GO6A 2HLZA 1ESJA 2PKMA 3DRWA 3FHYA 3NRSA 2DDWA 4JKUA 2GC6A 4S1IA 1GQYA 3UQ9A 4E8YA 4KBEA 4E8ZA 1C3QA 4QDIA 3RU2A 3B1PA 3NL2A 3RS8A 3IKHA 1V1BA 4S1IB 3LKIA 1KYHA 4K8TA 4O1GA 3NL6A 1LIJA 3RTEA 3UQ6A 4XCKA 5EYNA 4XF6A 1YGKA 2WTZA 2Y66A 3UAGA 3RTCA 2JFHA 3K5WA 1UB0A 3RPZA 3RSGA 2UUPA 4QF5A 5C3ZA 5COJA 1LIOA 1W78A 2F02A 5TRWA 2YXUA 3H74A 3N2AA 3NBWA 1GQQA 1L2LA 1YGJA 2QHPA 2HQQA 3PL2A 4K9CA 1LIIA
chains in the Genus database with same CATH topology
5B6AA 2RBCA 1JXHA 1LIKA 2DCNA 2PKNA 5EY7A 3NC9A 4GM6A 3RM5A 1RKAA 4YWRA 5C3YA 3BF5A 4N09A 3GO7A 2AWDA 5BYCA 2JG1A 4EBUA 4K8KA 3UQEA 1TZ3A 2PKFA 3KTNA 3LOOA 3PZSA 3MBJA 4KANA 3RTBA 3JULA 2JG5A 2I6AA 5BYEA 3EWMA 4EN4A 2AFBA 3IH0A 3NL3A 4EUMA 3NC2A 3UBOA 2R3EA 3RSQA 2NWHA 4KALA 1V1SA 2JGVA 3LHXA 2FV7A 4C5JA 3RY7A 3RPHA 1RFTA 2C4EA 1GC5A 1GQTA 4XDAA 3RRBA 3RQHA 5CGAA 1ESQA 3UMPA 3HYOA 4DU5A 5F0ZA 3RSFA 3B1RA 3IQ0A 1BX4A 3QA2A 1TYYA 1LHPA 1U2XA 4E69A 3IN1A 4PVVA 3UMOA 3RTAA 1VK4A 2AX3A 2AJPA 4S1MA 1TZ6A 4E3AA 3DZVA 3IBQA 2DDMA 3GBUA 3OTXA 4S1HA 3RQ8A 3VAQA 3W4SA 4LBXA 3HPDA 3RREA 3FHXA 1UA4A 2AA0A 1EKQA 3I3YA 3NL5A 4DC3A 5CM5A 3UQDA 5C41A 4C5MA 3RT9A 2DDOA 2VARA 1LHRA 2ABSA 3KD6A 3B1QA 3B1OA 2YXTA 2C49A 2R3BA 3RQXA 2A9YA 3MBHA 4LC4A 3QAIA 3Q92A 4K93A 3NM3A 1RFVA 1RK2A 3CQDA 5TQIA 3RU3A 4LCAA 1JXIA 3HICA 3RQQA 3RRFA 2HW1A 3B3LA 4UBEA 2ABQA 4LBGA 3RTDA 2V78A 4E8WA 4C5LA 1V1AA 4N08A 5CGEA 3RO4A 4U7XA 2Q5RA 4KADA 3NCAA 3RS9A 1RKSA 3KZHA 2AJRA 3BGKA 4B8RA 4KAHA 1TD2A 3N1CA 3RQ2A 3RTGA 4YL5A 3LJSA 1V19A 5C40A 3VASA 3NM1A 4E84A 3K9EA 4O1LA 4JJPA 1EKKA 3H49A 1VI9A 1RFUA 3HJ6A 3RT7A 3ZS7A 2F7KA 4C5NA 3B1NA 4WJMA 4EOHA 4JKSA 4C5KA 2I6BA 3RSSA 2A9ZA 1RKDA 2AB8A 4K8CA 3RQ6A 4B8SA 5BYFA 5BYDA 1VM7A 1DGMA 3Q1YA 5F11A 1YHJA 2XTBA 3RRJA 2QCVA 4XF7A 3IE7A 2I5BA 3KEUA 4K9IA 3RQ5A 3NBVA 4K8PA 1WYEA 2PKKA 3GO6A 2HLZA 1ESJA 2PKMA 3DRWA 3FHYA 4S1IA 2DDWA 4JKUA 4X8FA 4E8YA 3UQ9A 4KBEA 4E8ZA 1C3QA 3RU2A 3B1PA 3NL2A 3RS8A 3IKHA 1V1BA 4S1IB 3LKIA 1KYHA 4K8TA 4O1GA 3NL6A 1LIJA 3RTEA 3UQ6A 4XCKA 5EYNA 4XF6A 1YGKA 3RTCA 3RPZA 3K5WA 1UB0A 3RSGA 5C3ZA 5COJA 1LIOA 2F02A 5TRWA 2YXUA 3H74A 3NBWA 1L2LA 1YGJA 2QHPA 2HQQA 3PL2A 4K9CA 1LIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6A A;  2RBC A;  1JXH A;  1LIK A;  2DCN A;  2PKN A;  5EY7 A;  3NC9 A;  4GM6 A;  3RM5 A;  1RKA A;  4YWR A;  5C3Y A;  3BF5 A;  4N09 A;  3GO7 A;  2AWD A;  5BYC A;  2JG1 A;  4EBU A;  4K8K A;  3UQE A;  1TZ3 A;  2PKF A;  3KTN A;  3LOO A;  3PZS A;  3MBJ A;  4KAN A;  3RTB A;  3JUL A;  2JG5 A;  2I6A A;  5BYE A;  3EWM A;  4EN4 A;  2AFB A;  3IH0 A;  3NL3 A;  4EUM A;  3NC2 A;  3UBO A;  2R3E A;  3RSQ A;  2NWH A;  4KAL A;  1V1S A;  2JGV A;  3LHX A;  2FV7 A;  4C5J A;  3RY7 A;  3RPH A;  1RFT A;  2C4E A;  1GC5 A;  1GQT A;  4XDA A;  3RRB A;  3RQH A;  5CGA A;  1ESQ A;  3UMP A;  3HYO A;  4DU5 A;  5F0Z A;  3RSF A;  3B1R A;  3IQ0 A;  1BX4 A;  3QA2 A;  1TYY A;  1LHP A;  1U2X A;  4E69 A;  3IN1 A;  4PVV A;  3UMO A;  3RTA A;  1VK4 A;  2AX3 A;  2AJP A;  4S1M A;  1TZ6 A;  4E3A A;  3DZV A;  3IBQ A;  2DDM A;  3GBU A;  3OTX A;  4S1H A;  3RQ8 A;  3VAQ A;  3W4S A;  4LBX A;  3HPD A;  3RRE A;  3FHX A;  1UA4 A;  2AA0 A;  1EKQ A;  3I3Y A;  3NL5 A;  4DC3 A;  5CM5 A;  3UQD A;  5C41 A;  4C5M A;  3RT9 A;  2DDO A;  2VAR A;  1LHR A;  2ABS A;  3KD6 A;  3B1Q A;  3B1O A;  2YXT A;  2C49 A;  2R3B A;  3RQX A;  2A9Y A;  3MBH A;  4LC4 A;  3QAI A;  3Q92 A;  4K93 A;  3NM3 A;  1RFV A;  1RK2 A;  3CQD A;  5TQI A;  3RU3 A;  4LCA A;  1JXI A;  3HIC A;  3RQQ A;  3RRF A;  2HW1 A;  3B3L A;  4UBE A;  2ABQ A;  4LBG A;  3RTD A;  2V78 A;  4E8W A;  4C5L A;  1V1A A;  4N08 A;  5CGE A;  3RO4 A;  4U7X A;  2Q5R A;  4KAD A;  3NCA A;  3RS9 A;  1RKS A;  3KZH A;  2AJR A;  3BGK A;  4B8R A;  4KAH A;  1TD2 A;  3N1C A;  3RQ2 A;  3RTG A;  4YL5 A;  3LJS A;  1V19 A;  5C40 A;  3VAS A;  3NM1 A;  4E84 A;  3K9E A;  4O1L A;  4JJP A;  1EKK A;  3H49 A;  1VI9 A;  1RFU A;  3RT7 A;  4C5N A;  3ZS7 A;  2F7K A;  4EOH A;  3B1N A;  4WJM A;  4JKS A;  4C5K A;  2I6B A;  3RSS A;  2A9Z A;  1RKD A;  2AB8 A;  4K8C A;  3RQ6 A;  4B8S A;  5BYF A;  5BYD A;  1VM7 A;  1DGM A;  3Q1Y A;  5F11 A;  1YHJ A;  2XTB A;  3RRJ A;  2QCV A;  4XF7 A;  3IE7 A;  2I5B A;  3KEU A;  4K9I A;  3RQ5 A;  3NBV A;  4K8P A;  1WYE A;  2PKK A;  3GO6 A;  2HLZ A;  1ESJ A;  2PKM A;  3DRW A;  3FHY A;  4S1I A;  2DDW A;  4JKU A;  4X8F A;  4E8Y A;  3UQ9 A;  4KBE A;  4E8Z A;  1C3Q A;  3RU2 A;  3B1P A;  3NL2 A;  3RS8 A;  3IKH A;  1V1B A;  4S1I B;  3LKI A;  1KYH A;  4K8T A;  4O1G A;  3NL6 A;  1LIJ A;  3RTE A;  3UQ6 A;  4XCK A;  5EYN A;  4XF6 A;  1YGK A;  3RTC A;  3RPZ A;  3K5W A;  1UB0 A;  3RSG A;  5C3Z A;  5COJ A;  1LIO A;  2F02 A;  5TRW A;  2YXU A;  3H74 A;  3NBW A;  1L2L A;  1YGJ A;  2QHP A;  2HQQ A;  3PL2 A;  4K9C A;  1LII A; 
#chains in the Genus database with same CATH topology
 3EAG A;  1GG4 A;  2X5O A;  4X8F A;  2RBC A;  3RM5 A;  1JXH A;  4CVM A;  1LIK A;  2DCN A;  2PKN A;  2XJA A;  3HN7 A;  3NC9 A;  4GM6 A;  1RKA A;  5EY7 A;  4YWR A;  3BF5 A;  4N09 A;  3GO7 A;  2AWD A;  5BYC A;  2GCB A;  2JG1 A;  4EBU A;  4K8K A;  3UQE A;  1TZ3 A;  2PKF A;  3KTN A;  1O5Z A;  3LOO A;  3MBJ A;  3PZS A;  3ZM6 A;  4KAN A;  3RTB A;  3JUL A;  2JG5 A;  2I6A A;  4ZIY A;  5BYE A;  3EWM A;  4EN4 A;  2AFB A;  3IH0 A;  3NL3 A;  4EUM A;  3NC2 A;  3UBO A;  2R3E A;  3RSQ A;  2NWH A;  1JBV A;  4KAL A;  1V1S A;  2JGV A;  1JBW A;  3LHX A;  2FV7 A;  4C5J A;  3RY7 A;  2VOS A;  3RPH A;  3ZM5 A;  1J6U A;  1RFT A;  2C4E A;  2VTE A;  5B6A A;  1GC5 A;  1GQT A;  2UUO A;  1P31 A;  2Y67 A;  4XDA A;  4C12 A;  3RRB A;  3RQH A;  5CGA A;  4BUC A;  1ESQ A;  3UMP A;  3HYO A;  3PYZ A;  2WJP A;  3RSF A;  4DU5 A;  5F0Z A;  3B1R A;  3IQ0 A;  1BX4 A;  3QA2 A;  1TYY A;  1LHP A;  1U2X A;  4E69 A;  3IN1 A;  2VOR A;  4PVV A;  3UMO A;  2VTD A;  3RTA A;  4BUB A;  4CVK A;  1VK4 A;  2AX3 A;  2AJP A;  4S1M A;  1TZ6 A;  4E3A A;  3DZV A;  3IBQ A;  2DDM A;  3GBU A;  3OTX A;  4S1H A;  3RQ8 A;  3VAQ A;  2JFG A;  4LBX A;  3HPD A;  3W4S A;  3RRE A;  3FHX A;  1UA4 A;  2AA0 A;  1EKQ A;  3I3Y A;  3NL5 A;  4DC3 A;  2UAG A;  5CM5 A;  3UQD A;  5C41 A;  4C5M A;  3RT9 A;  2DDO A;  2AM1 A;  1LHR A;  2ABS A;  2VAR A;  2Y1O A;  3B1Q A;  3KD6 A;  3B1O A;  2YXT A;  2C49 A;  2R3B A;  3RQX A;  2A9Y A;  3MBH A;  4LC4 A;  3QAI A;  3Q92 A;  4K93 A;  3ZL8 A;  3LK7 A;  3NM3 A;  1RFV A;  1RK2 A;  3CQD A;  5TQI A;  3RU3 A;  4LCA A;  1JXI A;  3HIC A;  3RQQ A;  3RRF A;  2HW1 A;  3B3L A;  4UBE A;  2ABQ A;  2AM2 A;  2JFF A;  4LBG A;  2V78 A;  4UAG A;  3RTD A;  4E8W A;  2F00 A;  1V1A A;  4N08 A;  4C5L A;  5CGE A;  3RO4 A;  4U7X A;  2Q5R A;  1W7K A;  3NCA A;  4KAD A;  1RKS A;  3KZH A;  2AJR A;  2XPC A;  3BGK A;  3RS9 A;  4B8R A;  3QCZ A;  4KAH A;  1TD2 A;  3N1C A;  3RQ2 A;  3RTG A;  4YL5 A;  5A5E A;  3LJS A;  1V19 A;  5C3Y A;  4CVL A;  3VAS A;  2GC5 A;  3NM1 A;  3K9E A;  4E84 A;  5C40 A;  4O1L A;  4JJP A;  1EKK A;  3H49 A;  1VI9 A;  1RFU A;  3HJ6 A;  1E8C A;  3RT7 A;  2F7K A;  3ZS7 A;  3B1N A;  4WJM A;  4C5N A;  4JKS A;  4C5K A;  4EOH A;  1UAG A;  2I6B A;  1E0D A;  3RSS A;  2A9Z A;  1RKD A;  1FGS A;  4C13 A;  4HV4 A;  5A5F A;  2AB8 A;  4K8C A;  3RQ6 A;  4B8S A;  5BYF A;  1P3D A;  1VM7 A;  1DGM A;  5BYD A;  3Q1Y A;  5F11 A;  1YHJ A;  2XTB A;  2GCA A;  3RRJ A;  2QCV A;  4XF7 A;  3IE7 A;  2Y68 A;  2I5B A;  3KEU A;  4K9I A;  3RQ5 A;  3NBV A;  1EEH A;  1WYE A;  4K8P A;  2PKK A;  3GO6 A;  2HLZ A;  1ESJ A;  2PKM A;  3DRW A;  3FHY A;  3NRS A;  2DDW A;  4JKU A;  2GC6 A;  4S1I A;  1GQY A;  3UQ9 A;  4E8Y A;  4KBE A;  4E8Z A;  1C3Q A;  4QDI A;  3RU2 A;  3B1P A;  3NL2 A;  3RS8 A;  3IKH A;  1V1B A;  4S1I B;  3LKI A;  1KYH A;  4K8T A;  4O1G A;  3NL6 A;  1LIJ A;  3RTE A;  3UQ6 A;  4XCK A;  5EYN A;  4XF6 A;  1YGK A;  2WTZ A;  2Y66 A;  3UAG A;  3RTC A;  2JFH A;  3K5W A;  1UB0 A;  3RPZ A;  3RSG A;  2UUP A;  4QF5 A;  5C3Z A;  5COJ A;  1LIO A;  1W78 A;  2F02 A;  5TRW A;  2YXU A;  3H74 A;  3N2A A;  3NBW A;  1GQQ A;  1L2L A;  1YGJ A;  2QHP A;  2HQQ A;  3PL2 A;  4K9C A;  1LII A; 
#chains in the Genus database with same CATH homology
 5B6A A;  2RBC A;  1JXH A;  1LIK A;  2DCN A;  2PKN A;  5EY7 A;  3NC9 A;  4GM6 A;  3RM5 A;  1RKA A;  4YWR A;  5C3Y A;  3BF5 A;  4N09 A;  3GO7 A;  2AWD A;  5BYC A;  2JG1 A;  4EBU A;  4K8K A;  3UQE A;  1TZ3 A;  2PKF A;  3KTN A;  3LOO A;  3PZS A;  3MBJ A;  4KAN A;  3RTB A;  3JUL A;  2JG5 A;  2I6A A;  5BYE A;  3EWM A;  4EN4 A;  2AFB A;  3IH0 A;  3NL3 A;  4EUM A;  3NC2 A;  3UBO A;  2R3E A;  3RSQ A;  2NWH A;  4KAL A;  1V1S A;  2JGV A;  3LHX A;  2FV7 A;  4C5J A;  3RY7 A;  3RPH A;  1RFT A;  2C4E A;  1GC5 A;  1GQT A;  4XDA A;  3RRB A;  3RQH A;  5CGA A;  1ESQ A;  3UMP A;  3HYO A;  4DU5 A;  5F0Z A;  3RSF A;  3B1R A;  3IQ0 A;  1BX4 A;  3QA2 A;  1TYY A;  1LHP A;  1U2X A;  4E69 A;  3IN1 A;  4PVV A;  3UMO A;  3RTA A;  1VK4 A;  2AX3 A;  2AJP A;  4S1M A;  1TZ6 A;  4E3A A;  3DZV A;  3IBQ A;  2DDM A;  3GBU A;  3OTX A;  4S1H A;  3RQ8 A;  3VAQ A;  3W4S A;  4LBX A;  3HPD A;  3RRE A;  3FHX A;  1UA4 A;  2AA0 A;  1EKQ A;  3I3Y A;  3NL5 A;  4DC3 A;  5CM5 A;  3UQD A;  5C41 A;  4C5M A;  3RT9 A;  2DDO A;  2VAR A;  1LHR A;  2ABS A;  3KD6 A;  3B1Q A;  3B1O A;  2YXT A;  2C49 A;  2R3B A;  3RQX A;  2A9Y A;  3MBH A;  4LC4 A;  3QAI A;  3Q92 A;  4K93 A;  3NM3 A;  1RFV A;  1RK2 A;  3CQD A;  5TQI A;  3RU3 A;  4LCA A;  1JXI A;  3HIC A;  3RQQ A;  3RRF A;  2HW1 A;  3B3L A;  4UBE A;  2ABQ A;  4LBG A;  3RTD A;  2V78 A;  4E8W A;  4C5L A;  1V1A A;  4N08 A;  5CGE A;  3RO4 A;  4U7X A;  2Q5R A;  4KAD A;  3NCA A;  3RS9 A;  1RKS A;  3KZH A;  2AJR A;  3BGK A;  4B8R A;  4KAH A;  1TD2 A;  3N1C A;  3RQ2 A;  3RTG A;  4YL5 A;  3LJS A;  1V19 A;  5C40 A;  3VAS A;  3NM1 A;  4E84 A;  3K9E A;  4O1L A;  4JJP A;  1EKK A;  3H49 A;  1VI9 A;  1RFU A;  3HJ6 A;  3RT7 A;  3ZS7 A;  2F7K A;  4C5N A;  3B1N A;  4WJM A;  4EOH A;  4JKS A;  4C5K A;  2I6B A;  3RSS A;  2A9Z A;  1RKD A;  2AB8 A;  4K8C A;  3RQ6 A;  4B8S A;  5BYF A;  5BYD A;  1VM7 A;  1DGM A;  3Q1Y A;  5F11 A;  1YHJ A;  2XTB A;  3RRJ A;  2QCV A;  4XF7 A;  3IE7 A;  2I5B A;  3KEU A;  4K9I A;  3RQ5 A;  3NBV A;  4K8P A;  1WYE A;  2PKK A;  3GO6 A;  2HLZ A;  1ESJ A;  2PKM A;  3DRW A;  3FHY A;  4S1I A;  2DDW A;  4JKU A;  4X8F A;  4E8Y A;  3UQ9 A;  4KBE A;  4E8Z A;  1C3Q A;  3RU2 A;  3B1P A;  3NL2 A;  3RS8 A;  3IKH A;  1V1B A;  4S1I B;  3LKI A;  1KYH A;  4K8T A;  4O1G A;  3NL6 A;  1LIJ A;  3RTE A;  3UQ6 A;  4XCK A;  5EYN A;  4XF6 A;  1YGK A;  3RTC A;  3RPZ A;  3K5W A;  1UB0 A;  3RSG A;  5C3Z A;  5COJ A;  1LIO A;  2F02 A;  5TRW A;  2YXU A;  3H74 A;  3NBW A;  1L2L A;  1YGJ A;  2QHP A;  2HQQ A;  3PL2 A;  4K9C A;  1LII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...