3BGKA

The crystal structure of hypothetic protein smu.573 from streptococcus mutans
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
277
structure length
276
Chain Sequence
MIIDDLLTKKIIKPRPLNSHKGTFGRVLLIGGNYPYGGAIIMAALACVNSGAGLVTVATHKDNITALHSHLPEAMAFDMVEKDRLSEQITAADVVLMGPGLAEDDLAQTTFDVVWQAIEPKQTLIIDGSAINLLAKRKAIWPTKQIILTPHQKEWERLSGLTIPEQIEAATQTALAHFPKETILVAKSHQTKIYQGQKIGHIQVGGPYQATGGMGDTLAGMIAGFVAQFHTDRFEVAAAAVFLHSYIADQLSKEAYVVLPTRISAEITRVMKEMSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Streptococcus mutans protein SMU.573 solved from the anomalous signal measured with in-house chromium radiation
rcsb
source organism Streptococcus mutans
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 72
structure length 276
sequence length 277
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3bgkA00
3UQ6A 3RSFA 1JXHA 1TD2A 2DDOA 3K9EA 1GC5A 3LHXA 2RBCA 3RQXA 1JXIA 1VI9A 2A9ZA 3VAQA 5EY7A 4LBGA 2ABSA 2AJPA 4K8TA 3ZS7A 5BYCA 4EUMA 1RFTA 2C49A 3HPDA 3NM1A 3MBJA 3UMOA 3VASA 5BYDA 5CM5A 4YWRA 4KALA 1YGJA 1TZ3A 3RTGA 3RTBA 2A9YA 2DDWA 2AFBA 2AJRA 2C4EA 2JGVA 3RQQA 3I3YA 3K5WA 3NC9A 3GO6A 3QAIA 4EOHA 5F0ZA 4KBEA 4O1LA 1EKKA 3LOOA 4XCKA 3RPHA 1EKQA 3N1CA 3Q1YA 3RQ8A 4K93A 4S1IA 5EYNA 3H74A 3RREA 3RO4A 3RU2A 3PZSA 1VM7A 4N08A 4WJMA 3RTAA 3LKIA 3RTEA 4S1MA 1ESQA 2AWDA 3NBWA 2Q5RA 4KANA 3UQ9A 1RKAA 4B8RA 4U7XA 4C5LA 3RSQA 2ABQA 4N09A 1V1BA 3CQDA 3B1OA 3BF5A 3RU3A 3RT9A 1LIOA 1WYEA 3RTCA 5TRWA 1LIKA 1RFVA 4E3AA 2XTBA 4LCAA 4S1HA 2QHPA 5C3YA 2PKNA 1KYHA 1V1SA 2VARA 2PKKA 3IKHA 4GM6A 3RPZA 1V19A 3NL3A 1C3QA 4XF6A 5B6AA 1LIJA 3NCAA 3W4SA 4K9CA 5C41A 3NL6A 3B1QA 3KEUA 3OTXA 2YXUA 3RSGA 3RSSA 1YGKA 1LIIA 4UBEA 3HICA 3NL2A 3RQ5A 1DGMA 2AX3A 3B3LA 3RRJA 3B1RA 3RQ6A 1TZ6A 3GO7A 2HQQA 5BYEA 1V1AA 3HYOA 4PVVA 5BYFA 3UQEA 2I5BA 3IN1A 3GBUA 4XF7A 4C5KA 2YXTA 3RS9A 1VK4A 2I6BA 2JG1A 3IQ0A 4X8FA 3IE7A 3UBOA 4JJPA 3PL2A 4S1IB 3FHXA 4E8ZA 2F7KA 3RRFA 3RS8A 2HLZA 4E84A 2AA0A 1LHRA 2I6AA 2DDMA 3NM3A 4KADA 4EN4A 4XDAA 3QA2A 4K8KA 2QCVA 3DZVA 5C3ZA 3B1PA 3IBQA 4DC3A 3FHYA 3B1NA 4K8CA 1BX4A 2PKMA 4B8SA 3RQHA 3DRWA 4YL5A 4O1GA 1UB0A 4E69A 3RT7A 2DCNA 5COJA 2F02A 3KTNA 2FV7A 5F11A 5TQIA 2R3BA 3UQDA 3RY7A 5CGAA 3NBVA 5CGEA 4JKSA 1GQTA 4E8WA 3Q92A 3RTDA 2HW1A 1RK2A 3RQ2A 4C5NA 1RKSA 1L2LA 4C5JA 3UMPA 2NWHA 3MBHA 2V78A 1UA4A 2AB8A 3NL5A 3KD6A 1LHPA 5C40A 3IH0A 4LC4A 4C5MA 4K9IA 3RM5A 3JULA 4JKUA 4LBXA 1RFUA 3RRBA 3KZHA 4DU5A 4E8YA 3NC2A 1YHJA 3LJSA 2PKFA 2JG5A 1RKDA 1U2XA 2R3EA 3EWMA 4KAHA 1TYYA 4K8PA 3H49A 4EBUA 3BGKA 1ESJA
chains in the Genus database with same CATH superfamily
3UQ6A 3RSFA 1JXHA 1TD2A 2DDOA 3K9EA 2AM1A 1GC5A 3LHXA 2RBCA 3RQXA 1JXIA 1VI9A 2VTDA 2A9ZA 3VAQA 5EY7A 4LBGA 2ABSA 2AJPA 4K8TA 3ZL8A 3ZS7A 4HV4A 5BYCA 4EUMA 1GG4A 1RFTA 2C49A 3HPDA 3NM1A 3MBJA 3UMOA 3VASA 5BYDA 5CM5A 3NRSA 4YWRA 4KALA 1YGJA 1TZ3A 2XPCA 3RTGA 2Y67A 3RTBA 2A9YA 2DDWA 2AFBA 2Y66A 4CVMA 2AJRA 2C4EA 2GCAA 2JGVA 3I3YA 3K5WA 3N2AA 3GO6A 3NC9A 2JFFA 3QAIA 4EOHA 1P31A 5F0ZA 1JBVA 2WTZA 1EKKA 3LOOA 4KBEA 4O1LA 4XCKA 3RPHA 1EKQA 3N1CA 3Q1YA 3RQ8A 4BUBA 4K93A 4S1IA 5EYNA 3H74A 2JFGA 3RREA 3RO4A 3RU2A 4UAGA 3ZM6A 3PZSA 1VM7A 4N08A 4WJMA 3RTAA 3LKIA 3RTEA 4S1MA 1ESQA 2AWDA 3NBWA 2Q5RA 4KANA 3UQ9A 1RKAA 4B8RA 4U7XA 4C5LA 2VTEA 3RSQA 2ABQA 4N09A 1V1BA 3CQDA 4ZIYA 3B1OA 3BF5A 3RU3A 4C12A 3RT9A 1LIOA 1WYEA 3RTCA 5TRWA 1LIKA 1RFVA 4E3AA 2XTBA 4LCAA 4S1HA 1GQYA 2QHPA 2PKNA 1KYHA 1V1SA 2VARA 2VORA 2X5OA 2PKKA 5C3YA 3IKHA 2XJAA 4GM6A 1JBWA 3RPZA 1V19A 3NL3A 1C3QA 4XF6A 5B6AA 1LIJA 3NCAA 2UUPA 4K9CA 3W4SA 3NL6A 3B1QA 5C41A 3KEUA 3OTXA 1FGSA 2YXUA 2VOSA 3RSGA 3RSSA 1YGKA 1LIIA 4UBEA 3HICA 3NL2A 3RQ5A 5A5EA 1DGMA 2AX3A 3B3LA 3RQQA 1W78A 2Y1OA 3B1RA 1TZ6A 3GO7A 3RQ6A 3RRJA 3UAGA 2HQQA 4CVLA 5BYEA 1V1AA 2F00A 3HYOA 4PVVA 3UQEA 2I5BA 3IN1A 5BYFA 3GBUA 4XF7A 4C5KA 2YXTA 3RS9A 1VK4A 2I6BA 4QDIA 2JG1A 3IQ0A 4X8FA 2AM2A 3IE7A 3UBOA 4JJPA 1GQQA 3PL2A 4S1IB 3FHXA 4E8ZA 2F7KA 3RRFA 3RS8A 2HLZA 4E84A 2AA0A 1LHRA 2I6AA 2DDMA 3NM3A 4KADA 4EN4A 4XDAA 1W7KA 2Y68A 3QA2A 2QCVA 3DZVA 1UAGA 4K8KA 5C3ZA 3PYZA 3B1PA 1O5ZA 2UUOA 2WJPA 3IBQA 4DC3A 3FHYA 3B1NA 4K8CA 3HN7A 4BUCA 1BX4A 1EEHA 2PKMA 4B8SA 5A5FA 3RQHA 1J6UA 3DRWA 4YL5A 4O1GA 1UB0A 4E69A 3RT7A 2DCNA 5COJA 2F02A 3KTNA 2FV7A 5F11A 5TQIA 2R3BA 3UQDA 3RY7A 2JFHA 4QF5A 2GC6A 5CGAA 3LK7A 3NBVA 3QCZA 5CGEA 4JKSA 1GQTA 4E8WA 3Q92A 3RTDA 2HW1A 1RK2A 1P3DA 2UAGA 3RQ2A 4C5NA 4CVKA 1RKSA 1L2LA 1E8CA 2GCBA 4C5JA 3UMPA 2NWHA 3MBHA 2V78A 3ZM5A 1UA4A 2AB8A 3NL5A 4C13A 3KD6A 1LHPA 5C40A 3HJ6A 3IH0A 4LC4A 4C5MA 4K9IA 3RM5A 3JULA 4JKUA 4LBXA 1E0DA 1RFUA 3KZHA 3RRBA 4DU5A 4E8YA 3NC2A 1YHJA 3LJSA 2PKFA 3EAGA 2GC5A 2JG5A 1RKDA 1U2XA 2R3EA 3EWMA 4KAHA 1TYYA 4K8PA 3H49A 4EBUA 3BGKA 1ESJA
chains in the Genus database with same CATH topology
3UQ6A 3RSFA 1JXHA 1TD2A 2DDOA 3K9EA 1GC5A 3LHXA 2RBCA 3RQXA 1JXIA 1VI9A 2A9ZA 3VAQA 5EY7A 4LBGA 2ABSA 2AJPA 4K8TA 3ZS7A 5BYCA 4EUMA 1RFTA 2C49A 3HPDA 3NM1A 3MBJA 3UMOA 3VASA 5BYDA 5CM5A 4YWRA 4KALA 1YGJA 1TZ3A 3RTGA 3RTBA 2A9YA 2DDWA 2AFBA 2AJRA 2C4EA 2JGVA 3RQQA 3I3YA 3K5WA 3NC9A 3GO6A 3QAIA 4EOHA 5F0ZA 4KBEA 4O1LA 1EKKA 3LOOA 4XCKA 3RPHA 1EKQA 3N1CA 3Q1YA 3RQ8A 4K93A 4S1IA 5EYNA 3H74A 3RREA 3RO4A 3RU2A 3PZSA 1VM7A 4N08A 4WJMA 3RTAA 3LKIA 3RTEA 4S1MA 1ESQA 2AWDA 3NBWA 2Q5RA 4KANA 3UQ9A 1RKAA 4B8RA 4U7XA 4C5LA 3RSQA 2ABQA 4N09A 1V1BA 3CQDA 3B1OA 3BF5A 3RU3A 3RT9A 1LIOA 1WYEA 3RTCA 5TRWA 1LIKA 1RFVA 4E3AA 2XTBA 4LCAA 4S1HA 2QHPA 5C3YA 2PKNA 1KYHA 1V1SA 2VARA 2PKKA 3IKHA 4GM6A 3RPZA 1V19A 3NL3A 1C3QA 4XF6A 5B6AA 1LIJA 3NCAA 3W4SA 4K9CA 5C41A 3NL6A 3B1QA 3KEUA 3OTXA 2YXUA 3RSGA 3RSSA 1YGKA 1LIIA 4UBEA 3HICA 3NL2A 3RQ5A 1DGMA 2AX3A 3B3LA 3RRJA 3B1RA 3RQ6A 1TZ6A 3GO7A 2HQQA 5BYEA 1V1AA 3HYOA 4PVVA 5BYFA 3UQEA 2I5BA 3IN1A 3GBUA 4XF7A 4C5KA 2YXTA 3RS9A 1VK4A 2I6BA 2JG1A 3IQ0A 4X8FA 3IE7A 3UBOA 4JJPA 3PL2A 4S1IB 3FHXA 4E8ZA 2F7KA 3RRFA 3RS8A 2HLZA 4E84A 2AA0A 1LHRA 2I6AA 2DDMA 3NM3A 4KADA 4EN4A 4XDAA 3QA2A 4K8KA 2QCVA 3DZVA 5C3ZA 3B1PA 3IBQA 4DC3A 3FHYA 3B1NA 4K8CA 1BX4A 2PKMA 4B8SA 3RQHA 3DRWA 4YL5A 4O1GA 1UB0A 4E69A 3RT7A 2DCNA 5COJA 2F02A 3KTNA 2FV7A 5F11A 5TQIA 2R3BA 3UQDA 3RY7A 5CGAA 3NBVA 5CGEA 4JKSA 1GQTA 4E8WA 3Q92A 3RTDA 2HW1A 1RK2A 3RQ2A 4C5NA 1RKSA 1L2LA 4C5JA 3UMPA 2NWHA 3MBHA 2V78A 1UA4A 2AB8A 3NL5A 3KD6A 1LHPA 5C40A 3HJ6A 3IH0A 4LC4A 4C5MA 4K9IA 3RM5A 3JULA 4JKUA 4LBXA 1RFUA 3RRBA 3KZHA 4DU5A 4E8YA 3NC2A 1YHJA 3LJSA 2PKFA 2JG5A 1RKDA 1U2XA 2R3EA 3EWMA 4KAHA 1TYYA 4K8PA 3H49A 4EBUA 3BGKA 1ESJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQ6 A;  3RSF A;  1JXH A;  1TD2 A;  2DDO A;  3K9E A;  1GC5 A;  3LHX A;  2RBC A;  3RQX A;  1JXI A;  1VI9 A;  2A9Z A;  3VAQ A;  5EY7 A;  4LBG A;  2ABS A;  2AJP A;  4K8T A;  3ZS7 A;  5BYC A;  4EUM A;  1RFT A;  2C49 A;  3HPD A;  3NM1 A;  3MBJ A;  3UMO A;  3VAS A;  5BYD A;  5CM5 A;  4YWR A;  4KAL A;  1YGJ A;  1TZ3 A;  3RTG A;  3RTB A;  2A9Y A;  2DDW A;  2AFB A;  2AJR A;  2C4E A;  2JGV A;  3RQQ A;  3I3Y A;  3K5W A;  3NC9 A;  3GO6 A;  3QAI A;  4EOH A;  5F0Z A;  4KBE A;  4O1L A;  1EKK A;  3LOO A;  4XCK A;  3RPH A;  1EKQ A;  3N1C A;  3Q1Y A;  3RQ8 A;  4K93 A;  4S1I A;  5EYN A;  3H74 A;  3RRE A;  3RO4 A;  3RU2 A;  3PZS A;  1VM7 A;  4N08 A;  4WJM A;  3RTA A;  3LKI A;  3RTE A;  4S1M A;  1ESQ A;  2AWD A;  3NBW A;  2Q5R A;  4KAN A;  3UQ9 A;  1RKA A;  4B8R A;  4U7X A;  4C5L A;  3RSQ A;  2ABQ A;  4N09 A;  1V1B A;  3CQD A;  3B1O A;  3BF5 A;  3RU3 A;  3RT9 A;  1LIO A;  1WYE A;  3RTC A;  5TRW A;  1LIK A;  1RFV A;  4E3A A;  2XTB A;  4LCA A;  4S1H A;  2QHP A;  5C3Y A;  2PKN A;  1KYH A;  1V1S A;  2VAR A;  2PKK A;  3IKH A;  4GM6 A;  3RPZ A;  1V19 A;  3NL3 A;  1C3Q A;  4XF6 A;  5B6A A;  1LIJ A;  3NCA A;  3W4S A;  4K9C A;  5C41 A;  3NL6 A;  3B1Q A;  3KEU A;  3OTX A;  2YXU A;  3RSG A;  3RSS A;  1YGK A;  1LII A;  4UBE A;  3HIC A;  3NL2 A;  3RQ5 A;  1DGM A;  2AX3 A;  3B3L A;  3RRJ A;  3B1R A;  3RQ6 A;  1TZ6 A;  3GO7 A;  2HQQ A;  5BYE A;  1V1A A;  3HYO A;  4PVV A;  5BYF A;  3UQE A;  2I5B A;  3IN1 A;  3GBU A;  4XF7 A;  4C5K A;  2YXT A;  3RS9 A;  1VK4 A;  2I6B A;  2JG1 A;  3IQ0 A;  4X8F A;  3IE7 A;  3UBO A;  4JJP A;  3PL2 A;  4S1I B;  3FHX A;  4E8Z A;  2F7K A;  3RRF A;  3RS8 A;  2HLZ A;  4E84 A;  2AA0 A;  1LHR A;  2I6A A;  2DDM A;  3NM3 A;  4KAD A;  4EN4 A;  4XDA A;  3QA2 A;  4K8K A;  2QCV A;  3DZV A;  5C3Z A;  3B1P A;  3IBQ A;  4DC3 A;  3FHY A;  3B1N A;  4K8C A;  1BX4 A;  2PKM A;  4B8S A;  3RQH A;  3DRW A;  4YL5 A;  4O1G A;  1UB0 A;  4E69 A;  3RT7 A;  2DCN A;  5COJ A;  2F02 A;  3KTN A;  2FV7 A;  5F11 A;  5TQI A;  2R3B A;  3UQD A;  3RY7 A;  5CGA A;  3NBV A;  5CGE A;  4JKS A;  1GQT A;  4E8W A;  3Q92 A;  3RTD A;  2HW1 A;  1RK2 A;  3RQ2 A;  4C5N A;  1RKS A;  1L2L A;  4C5J A;  3UMP A;  2NWH A;  3MBH A;  2V78 A;  1UA4 A;  2AB8 A;  3NL5 A;  3KD6 A;  1LHP A;  5C40 A;  3IH0 A;  4LC4 A;  4C5M A;  4K9I A;  3RM5 A;  3JUL A;  4JKU A;  4LBX A;  1RFU A;  3RRB A;  3KZH A;  4DU5 A;  4E8Y A;  3NC2 A;  1YHJ A;  3LJS A;  2PKF A;  2JG5 A;  1RKD A;  1U2X A;  2R3E A;  3EWM A;  4KAH A;  1TYY A;  4K8P A;  3H49 A;  4EBU A;  3BGK A;  1ESJ A; 
#chains in the Genus database with same CATH topology
 3UQ6 A;  3RSF A;  1JXH A;  1TD2 A;  2DDO A;  3K9E A;  2AM1 A;  1GC5 A;  3LHX A;  2RBC A;  3RQX A;  1JXI A;  1VI9 A;  2VTD A;  2A9Z A;  3VAQ A;  5EY7 A;  4LBG A;  2ABS A;  2AJP A;  4K8T A;  3ZL8 A;  3ZS7 A;  4HV4 A;  5BYC A;  4EUM A;  1GG4 A;  1RFT A;  2C49 A;  3HPD A;  3NM1 A;  3MBJ A;  3UMO A;  3VAS A;  5BYD A;  5CM5 A;  3NRS A;  4YWR A;  4KAL A;  1YGJ A;  1TZ3 A;  2XPC A;  3RTG A;  2Y67 A;  3RTB A;  2A9Y A;  2DDW A;  2AFB A;  2Y66 A;  4CVM A;  2AJR A;  2C4E A;  2GCA A;  2JGV A;  3I3Y A;  3K5W A;  3N2A A;  3GO6 A;  3NC9 A;  2JFF A;  3QAI A;  4EOH A;  1P31 A;  5F0Z A;  1JBV A;  2WTZ A;  1EKK A;  3LOO A;  4KBE A;  4O1L A;  4XCK A;  3RPH A;  1EKQ A;  3N1C A;  3Q1Y A;  3RQ8 A;  4BUB A;  4K93 A;  4S1I A;  5EYN A;  3H74 A;  2JFG A;  3RRE A;  3RO4 A;  3RU2 A;  4UAG A;  3ZM6 A;  3PZS A;  1VM7 A;  4N08 A;  4WJM A;  3RTA A;  3LKI A;  3RTE A;  4S1M A;  1ESQ A;  2AWD A;  3NBW A;  2Q5R A;  4KAN A;  3UQ9 A;  1RKA A;  4B8R A;  4U7X A;  4C5L A;  2VTE A;  3RSQ A;  2ABQ A;  4N09 A;  1V1B A;  3CQD A;  4ZIY A;  3B1O A;  3BF5 A;  3RU3 A;  4C12 A;  3RT9 A;  1LIO A;  1WYE A;  3RTC A;  5TRW A;  1LIK A;  1RFV A;  4E3A A;  2XTB A;  4LCA A;  4S1H A;  1GQY A;  2QHP A;  2PKN A;  1KYH A;  1V1S A;  2VAR A;  2VOR A;  2X5O A;  2PKK A;  5C3Y A;  3IKH A;  2XJA A;  4GM6 A;  1JBW A;  3RPZ A;  1V19 A;  3NL3 A;  1C3Q A;  4XF6 A;  5B6A A;  1LIJ A;  3NCA A;  2UUP A;  4K9C A;  3W4S A;  3NL6 A;  3B1Q A;  5C41 A;  3KEU A;  3OTX A;  1FGS A;  2YXU A;  2VOS A;  3RSG A;  3RSS A;  1YGK A;  1LII A;  4UBE A;  3HIC A;  3NL2 A;  3RQ5 A;  5A5E A;  1DGM A;  2AX3 A;  3B3L A;  3RQQ A;  1W78 A;  2Y1O A;  3B1R A;  1TZ6 A;  3GO7 A;  3RQ6 A;  3RRJ A;  3UAG A;  2HQQ A;  4CVL A;  5BYE A;  1V1A A;  2F00 A;  3HYO A;  4PVV A;  3UQE A;  2I5B A;  3IN1 A;  5BYF A;  3GBU A;  4XF7 A;  4C5K A;  2YXT A;  3RS9 A;  1VK4 A;  2I6B A;  4QDI A;  2JG1 A;  3IQ0 A;  4X8F A;  2AM2 A;  3IE7 A;  3UBO A;  4JJP A;  1GQQ A;  3PL2 A;  4S1I B;  3FHX A;  4E8Z A;  2F7K A;  3RRF A;  3RS8 A;  2HLZ A;  4E84 A;  2AA0 A;  1LHR A;  2I6A A;  2DDM A;  3NM3 A;  4KAD A;  4EN4 A;  4XDA A;  1W7K A;  2Y68 A;  3QA2 A;  2QCV A;  3DZV A;  1UAG A;  4K8K A;  5C3Z A;  3PYZ A;  3B1P A;  1O5Z A;  2UUO A;  2WJP A;  3IBQ A;  4DC3 A;  3FHY A;  3B1N A;  4K8C A;  3HN7 A;  4BUC A;  1BX4 A;  1EEH A;  2PKM A;  4B8S A;  5A5F A;  3RQH A;  1J6U A;  3DRW A;  4YL5 A;  4O1G A;  1UB0 A;  4E69 A;  3RT7 A;  2DCN A;  5COJ A;  2F02 A;  3KTN A;  2FV7 A;  5F11 A;  5TQI A;  2R3B A;  3UQD A;  3RY7 A;  2JFH A;  4QF5 A;  2GC6 A;  5CGA A;  3LK7 A;  3NBV A;  3QCZ A;  5CGE A;  4JKS A;  1GQT A;  4E8W A;  3Q92 A;  3RTD A;  2HW1 A;  1RK2 A;  1P3D A;  2UAG A;  3RQ2 A;  4C5N A;  4CVK A;  1RKS A;  1L2L A;  1E8C A;  2GCB A;  4C5J A;  3UMP A;  2NWH A;  3MBH A;  2V78 A;  3ZM5 A;  1UA4 A;  2AB8 A;  3NL5 A;  4C13 A;  3KD6 A;  1LHP A;  5C40 A;  3HJ6 A;  3IH0 A;  4LC4 A;  4C5M A;  4K9I A;  3RM5 A;  3JUL A;  4JKU A;  4LBX A;  1E0D A;  1RFU A;  3KZH A;  3RRB A;  4DU5 A;  4E8Y A;  3NC2 A;  1YHJ A;  3LJS A;  2PKF A;  3EAG A;  2GC5 A;  2JG5 A;  1RKD A;  1U2X A;  2R3E A;  3EWM A;  4KAH A;  1TYY A;  4K8P A;  3H49 A;  4EBU A;  3BGK A;  1ESJ A; 
#chains in the Genus database with same CATH homology
 3UQ6 A;  3RSF A;  1JXH A;  1TD2 A;  2DDO A;  3K9E A;  1GC5 A;  3LHX A;  2RBC A;  3RQX A;  1JXI A;  1VI9 A;  2A9Z A;  3VAQ A;  5EY7 A;  4LBG A;  2ABS A;  2AJP A;  4K8T A;  3ZS7 A;  5BYC A;  4EUM A;  1RFT A;  2C49 A;  3HPD A;  3NM1 A;  3MBJ A;  3UMO A;  3VAS A;  5BYD A;  5CM5 A;  4YWR A;  4KAL A;  1YGJ A;  1TZ3 A;  3RTG A;  3RTB A;  2A9Y A;  2DDW A;  2AFB A;  2AJR A;  2C4E A;  2JGV A;  3RQQ A;  3I3Y A;  3K5W A;  3NC9 A;  3GO6 A;  3QAI A;  4EOH A;  5F0Z A;  4KBE A;  4O1L A;  1EKK A;  3LOO A;  4XCK A;  3RPH A;  1EKQ A;  3N1C A;  3Q1Y A;  3RQ8 A;  4K93 A;  4S1I A;  5EYN A;  3H74 A;  3RRE A;  3RO4 A;  3RU2 A;  3PZS A;  1VM7 A;  4N08 A;  4WJM A;  3RTA A;  3LKI A;  3RTE A;  4S1M A;  1ESQ A;  2AWD A;  3NBW A;  2Q5R A;  4KAN A;  3UQ9 A;  1RKA A;  4B8R A;  4U7X A;  4C5L A;  3RSQ A;  2ABQ A;  4N09 A;  1V1B A;  3CQD A;  3B1O A;  3BF5 A;  3RU3 A;  3RT9 A;  1LIO A;  1WYE A;  3RTC A;  5TRW A;  1LIK A;  1RFV A;  4E3A A;  2XTB A;  4LCA A;  4S1H A;  2QHP A;  5C3Y A;  2PKN A;  1KYH A;  1V1S A;  2VAR A;  2PKK A;  3IKH A;  4GM6 A;  3RPZ A;  1V19 A;  3NL3 A;  1C3Q A;  4XF6 A;  5B6A A;  1LIJ A;  3NCA A;  3W4S A;  4K9C A;  5C41 A;  3NL6 A;  3B1Q A;  3KEU A;  3OTX A;  2YXU A;  3RSG A;  3RSS A;  1YGK A;  1LII A;  4UBE A;  3HIC A;  3NL2 A;  3RQ5 A;  1DGM A;  2AX3 A;  3B3L A;  3RRJ A;  3B1R A;  3RQ6 A;  1TZ6 A;  3GO7 A;  2HQQ A;  5BYE A;  1V1A A;  3HYO A;  4PVV A;  5BYF A;  3UQE A;  2I5B A;  3IN1 A;  3GBU A;  4XF7 A;  4C5K A;  2YXT A;  3RS9 A;  1VK4 A;  2I6B A;  2JG1 A;  3IQ0 A;  4X8F A;  3IE7 A;  3UBO A;  4JJP A;  3PL2 A;  4S1I B;  3FHX A;  4E8Z A;  2F7K A;  3RRF A;  3RS8 A;  2HLZ A;  4E84 A;  2AA0 A;  1LHR A;  2I6A A;  2DDM A;  3NM3 A;  4KAD A;  4EN4 A;  4XDA A;  3QA2 A;  4K8K A;  2QCV A;  3DZV A;  5C3Z A;  3B1P A;  3IBQ A;  4DC3 A;  3FHY A;  3B1N A;  4K8C A;  1BX4 A;  2PKM A;  4B8S A;  3RQH A;  3DRW A;  4YL5 A;  4O1G A;  1UB0 A;  4E69 A;  3RT7 A;  2DCN A;  5COJ A;  2F02 A;  3KTN A;  2FV7 A;  5F11 A;  5TQI A;  2R3B A;  3UQD A;  3RY7 A;  5CGA A;  3NBV A;  5CGE A;  4JKS A;  1GQT A;  4E8W A;  3Q92 A;  3RTD A;  2HW1 A;  1RK2 A;  3RQ2 A;  4C5N A;  1RKS A;  1L2L A;  4C5J A;  3UMP A;  2NWH A;  3MBH A;  2V78 A;  1UA4 A;  2AB8 A;  3NL5 A;  3KD6 A;  1LHP A;  5C40 A;  3HJ6 A;  3IH0 A;  4LC4 A;  4C5M A;  4K9I A;  3RM5 A;  3JUL A;  4JKU A;  4LBX A;  1RFU A;  3RRB A;  3KZH A;  4DU5 A;  4E8Y A;  3NC2 A;  1YHJ A;  3LJS A;  2PKF A;  2JG5 A;  1RKD A;  1U2X A;  2R3E A;  3EWM A;  4KAH A;  1TYY A;  4K8P A;  3H49 A;  4EBU A;  3BGK A;  1ESJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...