3BGKA

The crystal structure of hypothetic protein smu.573 from streptococcus mutans
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
277
structure length
276
Chain Sequence
MIIDDLLTKKIIKPRPLNSHKGTFGRVLLIGGNYPYGGAIIMAALACVNSGAGLVTVATHKDNITALHSHLPEAMAFDMVEKDRLSEQITAADVVLMGPGLAEDDLAQTTFDVVWQAIEPKQTLIIDGSAINLLAKRKAIWPTKQIILTPHQKEWERLSGLTIPEQIEAATQTALAHFPKETILVAKSHQTKIYQGQKIGHIQVGGPYQATGGMGDTLAGMIAGFVAQFHTDRFEVAAAAVFLHSYIADQLSKEAYVVLPTRISAEITRVMKEMSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Streptococcus mutans protein SMU.573 solved from the anomalous signal measured with in-house chromium radiation
rcsb
source organism Streptococcus mutans
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 72
structure length 276
sequence length 277
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3bgkA00
1U2XA 3B1OA 4S1IB 4XF6A 2HLZA 3CQDA 3RTEA 2VARA 3I3YA 1V1BA 3RTBA 5TQIA 3ZS7A 5F0ZA 1BX4A 3NBVA 3GO7A 4K9IA 4N08A 2C4EA 2F02A 2JGVA 2QCVA 3UBOA 3UQDA 4EUMA 3NL3A 3NM3A 1YGJA 5CGAA 1TZ3A 1VK4A 4DU5A 1VI9A 4E69A 3IN1A 3OTXA 2ABSA 2NWHA 2I6BA 1ESJA 3MBHA 5BYDA 3LOOA 3RTDA 2QHPA 3EWMA 2DDWA 2I5BA 2DDOA 2JG5A 4E3AA 2DDMA 1EKQA 4KADA 3QA2A 1C3QA 4EBUA 3DRWA 3RSFA 3NL5A 3IBQA 3RSGA 3RRFA 3RM5A 2I6AA 3IKHA 1JXIA 3NL2A 3RREA 1KYHA 3K5WA 4XCKA 1RKDA 3Q92A 4GM6A 4K93A 3DZVA 1EKKA 4K8PA 1DGMA 4LC4A 2YXTA 1RFUA 2FV7A 4UBEA 5EYNA 3RU2A 5C41A 2AJRA 3H74A 4N09A 4DC3A 3H49A 3RY7A 1JXHA 4XDAA 3MBJA 4S1MA 3RTAA 3HICA 1LHRA 5C3YA 3LHXA 3RQQA 3RQXA 1RKAA 1LIOA 1LIIA 2V78A 2YXUA 1V1AA 3LJSA 3VAQA 2A9YA 4XF7A 4JKSA 1TZ6A 3HPDA 3GBUA 1GC5A 3NM1A 2ABQA 3IH0A 2F7KA 5CM5A 1RK2A 2PKMA 3B1NA 4K8TA 1YHJA 4KAHA 3QAIA 3UQEA 4E8ZA 3UQ6A 3RQ5A 3FHYA 1WYEA 2AA0A 2HQQA 4JKUA 3RTGA 1TYYA 3RT7A 3RSSA 4C5LA 3W4SA 5C40A 3K9EA 2R3EA 1RFTA 2HW1A 4LBGA 4X8FA 3RT9A 1RFVA 4C5JA 2R3BA 3GO6A 2JG1A 1V19A 4O1LA 4WJMA 3LKIA 4YL5A 5BYCA 2Q5RA 4S1HA 3KEUA 3RPZA 1RKSA 3B1RA 5TRWA 4LCAA 3NC9A 4JJPA 3RRJA 2AWDA 1L2LA 3RS9A 3UMOA 2DCNA 2XTBA 4C5NA 4S1IA 3IE7A 3RTCA 3PZSA 2PKFA 3NCAA 3RU3A 3UQ9A 4E84A 3RPHA 1LHPA 1VM7A 1UA4A 4LBXA 4U7XA 3RQ6A 3VASA 4K8KA 3HYOA 1LIJA 4KANA 3IQ0A 2AFBA 5B6AA 2A9ZA 4KBEA 4B8SA 1ESQA 3UMPA 3BF5A 2C49A 5CGEA 3RSQA 2AX3A 1UB0A 3B3LA 3BGKA 3KZHA 4O1GA 2AJPA 3RRBA 2AB8A 4B8RA 1GQTA 5EY7A 3N1CA 3RQ2A 5BYFA 4E8WA 3RQHA 5C3ZA 4K9CA 2PKKA 4K8CA 5COJA 3PL2A 4C5MA 4EOHA 3JULA 3NBWA 4YWRA 4EN4A 3B1QA 3NC2A 5F11A 2PKNA 4C5KA 2RBCA 3KTNA 4KALA 3NL6A 3B1PA 3KD6A 3RQ8A 4PVVA 5BYEA 1V1SA 1YGKA 3FHXA 3Q1YA 3RS8A 3RO4A 4E8YA 1LIKA 1TD2A
chains in the Genus database with same CATH superfamily
1U2XA 3B1OA 4S1IB 4XF6A 2HLZA 3CQDA 3RTEA 2VARA 3I3YA 1V1BA 3RTBA 5TQIA 3ZS7A 5F0ZA 1BX4A 1J6UA 2JFFA 3GO7A 3N2AA 3NBVA 2C4EA 2F02A 2JGVA 2QCVA 4K9IA 3UBOA 3UQDA 4EUMA 3NL3A 3NM3A 1YGJA 1GQYA 5CGAA 1TZ3A 1VK4A 2GCAA 4BUCA 1VI9A 4DU5A 4E69A 3IN1A 1P31A 1O5ZA 3OTXA 2ABSA 2NWHA 2I6BA 1ESJA 3MBHA 5BYDA 3LOOA 3RTDA 2QHPA 3EWMA 2DDWA 2I5BA 2DDOA 2JG5A 4E3AA 2DDMA 1EKQA 1EEHA 4KADA 3QA2A 1C3QA 4EBUA 3DRWA 3RSFA 3NL5A 3IBQA 3RSGA 3RRFA 3RM5A 2I6AA 4UAGA 3IKHA 1JXIA 4C12A 3NL2A 3RREA 1KYHA 3VAQA 3K5WA 4XCKA 2JFHA 1W78A 1RKDA 3Q92A 4GM6A 4K93A 1UAGA 5A5FA 3DZVA 1EKKA 4K8PA 1DGMA 4LC4A 2YXTA 1RFUA 4C13A 2FV7A 4UBEA 5EYNA 3RU2A 5C41A 4BUBA 2AJRA 3H74A 4N09A 4DC3A 3H49A 3RY7A 1JXHA 2F00A 4XDAA 3MBJA 3EAGA 4S1MA 3RTAA 3HICA 1LHRA 5C3YA 3LHXA 3RQQA 3RQXA 3ZM5A 2VORA 1RKAA 1LIOA 1LIIA 2GCBA 2V78A 1V1AA 2YXUA 1E0DA 2A9YA 2Y1OA 3LJSA 3PYZA 4JKSA 2UAGA 1TZ6A 3HPDA 4XF7A 3GBUA 1JBWA 1GC5A 3NM1A 2ABQA 3IH0A 3UAGA 2F7KA 2JFGA 1GQQA 1RK2A 2PKMA 2UUOA 5CM5A 2VTDA 3B1NA 4K8TA 1YHJA 4KAHA 4QDIA 2Y66A 3QAIA 3UQEA 4E8ZA 3RQ5A 3FHYA 1WYEA 2AA0A 2HQQA 4JKUA 3RTGA 1TYYA 3RT7A 3RSSA 4C5LA 3W4SA 5C40A 3K9EA 2R3EA 1RFTA 2HW1A 4LBGA 4N08A 4X8FA 3RT9A 1RFVA 4C5JA 2R3BA 3GO6A 2JG1A 1V19A 4O1LA 4WJMA 4HV4A 2AM1A 3LKIA 3QCZA 4YL5A 2Q5RA 4ZIYA 4S1HA 3KEUA 5BYCA 3RPZA 1RKSA 3B1RA 5TRWA 4LCAA 3NC9A 4JJPA 3RRJA 4EOHA 2AWDA 1L2LA 3ZL8A 3RS9A 3UMOA 2DCNA 2XTBA 2XJAA 4C5NA 2Y68A 4S1IA 4CVKA 3IE7A 3RTCA 3PZSA 2PKFA 3NCAA 3RU3A 3UQ9A 4E84A 1P3DA 1JBVA 4QF5A 2VOSA 3RPHA 1LHPA 1VM7A 1UA4A 2UUPA 4LBXA 4U7XA 3RQ6A 2GC5A 2Y67A 3VASA 4K8KA 3HYOA 4CVLA 1LIJA 5A5EA 4KANA 4CVMA 3IQ0A 2AFBA 1E8CA 2A9ZA 4KBEA 4B8SA 5B6AA 1ESQA 1GG4A 3UMPA 3UQ6A 3BF5A 2C49A 5CGEA 2AM2A 3RSQA 2AX3A 1UB0A 3B3LA 3BGKA 1FGSA 3KZHA 2AJPA 4O1GA 2AB8A 3RRBA 4B8RA 1GQTA 5EY7A 3N1CA 3RQ2A 2WJPA 1W7KA 3HJ6A 2VTEA 5BYFA 4E8WA 3RQHA 3HN7A 5C3ZA 4K9CA 2PKKA 4K8CA 5COJA 3PL2A 4C5MA 3LK7A 2X5OA 3JULA 3NBWA 4YWRA 3B1QA 3NC2A 4EN4A 2PKNA 5F11A 3ZM6A 4C5KA 2GC6A 2RBCA 3KTNA 4KALA 3NL6A 3B1PA 3KD6A 2XPCA 4PVVA 3RQ8A 1V1SA 1YGKA 2WTZA 3FHXA 3Q1YA 5BYEA 3NRSA 3RO4A 3RS8A 4E8YA 1LIKA 1TD2A
chains in the Genus database with same CATH topology
1U2XA 3B1OA 4S1IB 4XF6A 2HLZA 3CQDA 3RTEA 2VARA 3I3YA 1V1BA 3RTBA 5TQIA 3ZS7A 5F0ZA 1BX4A 3NBVA 3GO7A 4K9IA 4N08A 2C4EA 2F02A 2JGVA 2QCVA 3UBOA 3UQDA 4EUMA 3NL3A 3NM3A 1YGJA 5CGAA 1TZ3A 1VK4A 4DU5A 1VI9A 4E69A 3IN1A 3OTXA 2ABSA 2NWHA 2I6BA 1ESJA 3MBHA 5BYDA 3LOOA 3RTDA 2QHPA 3EWMA 2DDWA 2I5BA 2DDOA 2JG5A 4E3AA 2DDMA 1EKQA 4KADA 3QA2A 1C3QA 4EBUA 3DRWA 3RSFA 3NL5A 3IBQA 3RSGA 3RRFA 3RM5A 2I6AA 3IKHA 1JXIA 3NL2A 3RREA 1KYHA 3K5WA 4XCKA 1RKDA 3Q92A 4GM6A 4K93A 3DZVA 1EKKA 4K8PA 1DGMA 4LC4A 2YXTA 1RFUA 2FV7A 4UBEA 5EYNA 3RU2A 5C41A 2AJRA 3H74A 4N09A 4DC3A 3H49A 3RY7A 1JXHA 4XDAA 3MBJA 4S1MA 3RTAA 3HICA 1LHRA 5C3YA 3LHXA 3RQQA 3RQXA 1RKAA 1LIOA 1LIIA 2V78A 2YXUA 1V1AA 3LJSA 3VAQA 2A9YA 4XF7A 4JKSA 1TZ6A 3HPDA 3GBUA 1GC5A 3NM1A 2ABQA 3IH0A 2F7KA 5CM5A 1RK2A 2PKMA 3B1NA 4K8TA 1YHJA 4KAHA 3QAIA 3UQEA 4E8ZA 3UQ6A 3RQ5A 3FHYA 1WYEA 2AA0A 2HQQA 4JKUA 3RTGA 1TYYA 3RT7A 3RSSA 4C5LA 3W4SA 5C40A 3K9EA 2R3EA 1RFTA 2HW1A 4LBGA 4X8FA 3RT9A 1RFVA 4C5JA 2R3BA 3GO6A 2JG1A 1V19A 4O1LA 4WJMA 3LKIA 4YL5A 5BYCA 2Q5RA 4S1HA 3KEUA 3RPZA 1RKSA 3B1RA 5TRWA 4LCAA 3NC9A 4JJPA 3RRJA 2AWDA 1L2LA 3RS9A 3UMOA 2DCNA 2XTBA 4C5NA 4S1IA 3IE7A 3RTCA 3PZSA 2PKFA 3NCAA 3RU3A 3UQ9A 4E84A 3RPHA 1LHPA 1VM7A 1UA4A 4LBXA 4U7XA 3RQ6A 3VASA 4K8KA 3HYOA 1LIJA 4KANA 3IQ0A 2AFBA 5B6AA 2A9ZA 4KBEA 4B8SA 1ESQA 3UMPA 3BF5A 2C49A 5CGEA 3RSQA 2AX3A 1UB0A 3B3LA 3BGKA 3KZHA 4O1GA 2AJPA 3RRBA 2AB8A 4B8RA 1GQTA 5EY7A 3N1CA 3RQ2A 3HJ6A 5BYFA 4E8WA 3RQHA 5C3ZA 4K9CA 2PKKA 4K8CA 5COJA 3PL2A 4C5MA 4EOHA 3JULA 3NBWA 4YWRA 4EN4A 3B1QA 3NC2A 5F11A 2PKNA 4C5KA 2RBCA 3KTNA 4KALA 3NL6A 3B1PA 3KD6A 3RQ8A 4PVVA 5BYEA 1V1SA 1YGKA 3FHXA 3Q1YA 3RS8A 3RO4A 4E8YA 1LIKA 1TD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2X A;  3B1O A;  4S1I B;  4XF6 A;  2HLZ A;  3CQD A;  3RTE A;  2VAR A;  3I3Y A;  1V1B A;  3RTB A;  5TQI A;  3ZS7 A;  5F0Z A;  1BX4 A;  3NBV A;  3GO7 A;  4K9I A;  4N08 A;  2C4E A;  2F02 A;  2JGV A;  2QCV A;  3UBO A;  3UQD A;  4EUM A;  3NL3 A;  3NM3 A;  1YGJ A;  5CGA A;  1TZ3 A;  1VK4 A;  4DU5 A;  1VI9 A;  4E69 A;  3IN1 A;  3OTX A;  2ABS A;  2NWH A;  2I6B A;  1ESJ A;  3MBH A;  5BYD A;  3LOO A;  3RTD A;  2QHP A;  3EWM A;  2DDW A;  2I5B A;  2DDO A;  2JG5 A;  4E3A A;  2DDM A;  1EKQ A;  4KAD A;  3QA2 A;  1C3Q A;  4EBU A;  3DRW A;  3RSF A;  3NL5 A;  3IBQ A;  3RSG A;  3RRF A;  3RM5 A;  2I6A A;  3IKH A;  1JXI A;  3NL2 A;  3RRE A;  1KYH A;  3K5W A;  4XCK A;  1RKD A;  3Q92 A;  4GM6 A;  4K93 A;  3DZV A;  1EKK A;  4K8P A;  1DGM A;  4LC4 A;  2YXT A;  1RFU A;  2FV7 A;  4UBE A;  5EYN A;  3RU2 A;  5C41 A;  2AJR A;  3H74 A;  4N09 A;  4DC3 A;  3H49 A;  3RY7 A;  1JXH A;  4XDA A;  3MBJ A;  4S1M A;  3RTA A;  3HIC A;  1LHR A;  5C3Y A;  3LHX A;  3RQQ A;  3RQX A;  1RKA A;  1LIO A;  1LII A;  2V78 A;  2YXU A;  1V1A A;  3LJS A;  3VAQ A;  2A9Y A;  4XF7 A;  4JKS A;  1TZ6 A;  3HPD A;  3GBU A;  1GC5 A;  3NM1 A;  2ABQ A;  3IH0 A;  2F7K A;  5CM5 A;  1RK2 A;  2PKM A;  3B1N A;  4K8T A;  1YHJ A;  4KAH A;  3QAI A;  3UQE A;  4E8Z A;  3UQ6 A;  3RQ5 A;  3FHY A;  1WYE A;  2AA0 A;  2HQQ A;  4JKU A;  3RTG A;  1TYY A;  3RT7 A;  3RSS A;  4C5L A;  3W4S A;  5C40 A;  3K9E A;  2R3E A;  1RFT A;  2HW1 A;  4LBG A;  4X8F A;  3RT9 A;  1RFV A;  4C5J A;  2R3B A;  3GO6 A;  2JG1 A;  1V19 A;  4O1L A;  4WJM A;  3LKI A;  4YL5 A;  5BYC A;  2Q5R A;  4S1H A;  3KEU A;  3RPZ A;  1RKS A;  3B1R A;  5TRW A;  4LCA A;  3NC9 A;  4JJP A;  3RRJ A;  2AWD A;  1L2L A;  3RS9 A;  3UMO A;  2DCN A;  2XTB A;  4C5N A;  4S1I A;  3IE7 A;  3RTC A;  3PZS A;  2PKF A;  3NCA A;  3RU3 A;  3UQ9 A;  4E84 A;  3RPH A;  1LHP A;  1VM7 A;  1UA4 A;  4LBX A;  4U7X A;  3RQ6 A;  3VAS A;  4K8K A;  3HYO A;  1LIJ A;  4KAN A;  3IQ0 A;  2AFB A;  5B6A A;  2A9Z A;  4KBE A;  4B8S A;  1ESQ A;  3UMP A;  3BF5 A;  2C49 A;  5CGE A;  3RSQ A;  2AX3 A;  1UB0 A;  3B3L A;  3BGK A;  3KZH A;  4O1G A;  2AJP A;  3RRB A;  2AB8 A;  4B8R A;  1GQT A;  5EY7 A;  3N1C A;  3RQ2 A;  5BYF A;  4E8W A;  3RQH A;  5C3Z A;  4K9C A;  2PKK A;  4K8C A;  5COJ A;  3PL2 A;  4C5M A;  4EOH A;  3JUL A;  3NBW A;  4YWR A;  4EN4 A;  3B1Q A;  3NC2 A;  5F11 A;  2PKN A;  4C5K A;  2RBC A;  3KTN A;  4KAL A;  3NL6 A;  3B1P A;  3KD6 A;  3RQ8 A;  4PVV A;  5BYE A;  1V1S A;  1YGK A;  3FHX A;  3Q1Y A;  3RS8 A;  3RO4 A;  4E8Y A;  1LIK A;  1TD2 A; 
#chains in the Genus database with same CATH topology
 1U2X A;  3B1O A;  4S1I B;  4XF6 A;  2HLZ A;  3CQD A;  3RTE A;  2VAR A;  3I3Y A;  1V1B A;  3RTB A;  5TQI A;  3ZS7 A;  5F0Z A;  1BX4 A;  1J6U A;  2JFF A;  3GO7 A;  3N2A A;  3NBV A;  2C4E A;  2F02 A;  2JGV A;  2QCV A;  4K9I A;  3UBO A;  3UQD A;  4EUM A;  3NL3 A;  3NM3 A;  1YGJ A;  1GQY A;  5CGA A;  1TZ3 A;  1VK4 A;  2GCA A;  4BUC A;  1VI9 A;  4DU5 A;  4E69 A;  3IN1 A;  1P31 A;  1O5Z A;  3OTX A;  2ABS A;  2NWH A;  2I6B A;  1ESJ A;  3MBH A;  5BYD A;  3LOO A;  3RTD A;  2QHP A;  3EWM A;  2DDW A;  2I5B A;  2DDO A;  2JG5 A;  4E3A A;  2DDM A;  1EKQ A;  1EEH A;  4KAD A;  3QA2 A;  1C3Q A;  4EBU A;  3DRW A;  3RSF A;  3NL5 A;  3IBQ A;  3RSG A;  3RRF A;  3RM5 A;  2I6A A;  4UAG A;  3IKH A;  1JXI A;  4C12 A;  3NL2 A;  3RRE A;  1KYH A;  3VAQ A;  3K5W A;  4XCK A;  2JFH A;  1W78 A;  1RKD A;  3Q92 A;  4GM6 A;  4K93 A;  1UAG A;  5A5F A;  3DZV A;  1EKK A;  4K8P A;  1DGM A;  4LC4 A;  2YXT A;  1RFU A;  4C13 A;  2FV7 A;  4UBE A;  5EYN A;  3RU2 A;  5C41 A;  4BUB A;  2AJR A;  3H74 A;  4N09 A;  4DC3 A;  3H49 A;  3RY7 A;  1JXH A;  2F00 A;  4XDA A;  3MBJ A;  3EAG A;  4S1M A;  3RTA A;  3HIC A;  1LHR A;  5C3Y A;  3LHX A;  3RQQ A;  3RQX A;  3ZM5 A;  2VOR A;  1RKA A;  1LIO A;  1LII A;  2GCB A;  2V78 A;  1V1A A;  2YXU A;  1E0D A;  2A9Y A;  2Y1O A;  3LJS A;  3PYZ A;  4JKS A;  2UAG A;  1TZ6 A;  3HPD A;  4XF7 A;  3GBU A;  1JBW A;  1GC5 A;  3NM1 A;  2ABQ A;  3IH0 A;  3UAG A;  2F7K A;  2JFG A;  1GQQ A;  1RK2 A;  2PKM A;  2UUO A;  5CM5 A;  2VTD A;  3B1N A;  4K8T A;  1YHJ A;  4KAH A;  4QDI A;  2Y66 A;  3QAI A;  3UQE A;  4E8Z A;  3RQ5 A;  3FHY A;  1WYE A;  2AA0 A;  2HQQ A;  4JKU A;  3RTG A;  1TYY A;  3RT7 A;  3RSS A;  4C5L A;  3W4S A;  5C40 A;  3K9E A;  2R3E A;  1RFT A;  2HW1 A;  4LBG A;  4N08 A;  4X8F A;  3RT9 A;  1RFV A;  4C5J A;  2R3B A;  3GO6 A;  2JG1 A;  1V19 A;  4O1L A;  4WJM A;  4HV4 A;  2AM1 A;  3LKI A;  3QCZ A;  4YL5 A;  2Q5R A;  4ZIY A;  4S1H A;  3KEU A;  5BYC A;  3RPZ A;  1RKS A;  3B1R A;  5TRW A;  4LCA A;  3NC9 A;  4JJP A;  3RRJ A;  4EOH A;  2AWD A;  1L2L A;  3ZL8 A;  3RS9 A;  3UMO A;  2DCN A;  2XTB A;  2XJA A;  4C5N A;  2Y68 A;  4S1I A;  4CVK A;  3IE7 A;  3RTC A;  3PZS A;  2PKF A;  3NCA A;  3RU3 A;  3UQ9 A;  4E84 A;  1P3D A;  1JBV A;  4QF5 A;  2VOS A;  3RPH A;  1LHP A;  1VM7 A;  1UA4 A;  2UUP A;  4LBX A;  4U7X A;  3RQ6 A;  2GC5 A;  2Y67 A;  3VAS A;  4K8K A;  3HYO A;  4CVL A;  1LIJ A;  5A5E A;  4KAN A;  4CVM A;  3IQ0 A;  2AFB A;  1E8C A;  2A9Z A;  4KBE A;  4B8S A;  5B6A A;  1ESQ A;  1GG4 A;  3UMP A;  3UQ6 A;  3BF5 A;  2C49 A;  5CGE A;  2AM2 A;  3RSQ A;  2AX3 A;  1UB0 A;  3B3L A;  3BGK A;  1FGS A;  3KZH A;  2AJP A;  4O1G A;  2AB8 A;  3RRB A;  4B8R A;  1GQT A;  5EY7 A;  3N1C A;  3RQ2 A;  2WJP A;  1W7K A;  3HJ6 A;  2VTE A;  5BYF A;  4E8W A;  3RQH A;  3HN7 A;  5C3Z A;  4K9C A;  2PKK A;  4K8C A;  5COJ A;  3PL2 A;  4C5M A;  3LK7 A;  2X5O A;  3JUL A;  3NBW A;  4YWR A;  3B1Q A;  3NC2 A;  4EN4 A;  2PKN A;  5F11 A;  3ZM6 A;  4C5K A;  2GC6 A;  2RBC A;  3KTN A;  4KAL A;  3NL6 A;  3B1P A;  3KD6 A;  2XPC A;  4PVV A;  3RQ8 A;  1V1S A;  1YGK A;  2WTZ A;  3FHX A;  3Q1Y A;  5BYE A;  3NRS A;  3RO4 A;  3RS8 A;  4E8Y A;  1LIK A;  1TD2 A; 
#chains in the Genus database with same CATH homology
 1U2X A;  3B1O A;  4S1I B;  4XF6 A;  2HLZ A;  3CQD A;  3RTE A;  2VAR A;  3I3Y A;  1V1B A;  3RTB A;  5TQI A;  3ZS7 A;  5F0Z A;  1BX4 A;  3NBV A;  3GO7 A;  4K9I A;  4N08 A;  2C4E A;  2F02 A;  2JGV A;  2QCV A;  3UBO A;  3UQD A;  4EUM A;  3NL3 A;  3NM3 A;  1YGJ A;  5CGA A;  1TZ3 A;  1VK4 A;  4DU5 A;  1VI9 A;  4E69 A;  3IN1 A;  3OTX A;  2ABS A;  2NWH A;  2I6B A;  1ESJ A;  3MBH A;  5BYD A;  3LOO A;  3RTD A;  2QHP A;  3EWM A;  2DDW A;  2I5B A;  2DDO A;  2JG5 A;  4E3A A;  2DDM A;  1EKQ A;  4KAD A;  3QA2 A;  1C3Q A;  4EBU A;  3DRW A;  3RSF A;  3NL5 A;  3IBQ A;  3RSG A;  3RRF A;  3RM5 A;  2I6A A;  3IKH A;  1JXI A;  3NL2 A;  3RRE A;  1KYH A;  3K5W A;  4XCK A;  1RKD A;  3Q92 A;  4GM6 A;  4K93 A;  3DZV A;  1EKK A;  4K8P A;  1DGM A;  4LC4 A;  2YXT A;  1RFU A;  2FV7 A;  4UBE A;  5EYN A;  3RU2 A;  5C41 A;  2AJR A;  3H74 A;  4N09 A;  4DC3 A;  3H49 A;  3RY7 A;  1JXH A;  4XDA A;  3MBJ A;  4S1M A;  3RTA A;  3HIC A;  1LHR A;  5C3Y A;  3LHX A;  3RQQ A;  3RQX A;  1RKA A;  1LIO A;  1LII A;  2V78 A;  2YXU A;  1V1A A;  3LJS A;  3VAQ A;  2A9Y A;  4XF7 A;  4JKS A;  1TZ6 A;  3HPD A;  3GBU A;  1GC5 A;  3NM1 A;  2ABQ A;  3IH0 A;  2F7K A;  5CM5 A;  1RK2 A;  2PKM A;  3B1N A;  4K8T A;  1YHJ A;  4KAH A;  3QAI A;  3UQE A;  4E8Z A;  3UQ6 A;  3RQ5 A;  3FHY A;  1WYE A;  2AA0 A;  2HQQ A;  4JKU A;  3RTG A;  1TYY A;  3RT7 A;  3RSS A;  4C5L A;  3W4S A;  5C40 A;  3K9E A;  2R3E A;  1RFT A;  2HW1 A;  4LBG A;  4X8F A;  3RT9 A;  1RFV A;  4C5J A;  2R3B A;  3GO6 A;  2JG1 A;  1V19 A;  4O1L A;  4WJM A;  3LKI A;  4YL5 A;  5BYC A;  2Q5R A;  4S1H A;  3KEU A;  3RPZ A;  1RKS A;  3B1R A;  5TRW A;  4LCA A;  3NC9 A;  4JJP A;  3RRJ A;  2AWD A;  1L2L A;  3RS9 A;  3UMO A;  2DCN A;  2XTB A;  4C5N A;  4S1I A;  3IE7 A;  3RTC A;  3PZS A;  2PKF A;  3NCA A;  3RU3 A;  3UQ9 A;  4E84 A;  3RPH A;  1LHP A;  1VM7 A;  1UA4 A;  4LBX A;  4U7X A;  3RQ6 A;  3VAS A;  4K8K A;  3HYO A;  1LIJ A;  4KAN A;  3IQ0 A;  2AFB A;  5B6A A;  2A9Z A;  4KBE A;  4B8S A;  1ESQ A;  3UMP A;  3BF5 A;  2C49 A;  5CGE A;  3RSQ A;  2AX3 A;  1UB0 A;  3B3L A;  3BGK A;  3KZH A;  4O1G A;  2AJP A;  3RRB A;  2AB8 A;  4B8R A;  1GQT A;  5EY7 A;  3N1C A;  3RQ2 A;  3HJ6 A;  5BYF A;  4E8W A;  3RQH A;  5C3Z A;  4K9C A;  2PKK A;  4K8C A;  5COJ A;  3PL2 A;  4C5M A;  4EOH A;  3JUL A;  3NBW A;  4YWR A;  4EN4 A;  3B1Q A;  3NC2 A;  5F11 A;  2PKN A;  4C5K A;  2RBC A;  3KTN A;  4KAL A;  3NL6 A;  3B1P A;  3KD6 A;  3RQ8 A;  4PVV A;  5BYE A;  1V1S A;  1YGK A;  3FHX A;  3Q1Y A;  3RS8 A;  3RO4 A;  4E8Y A;  1LIK A;  1TD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...