3RRBA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with amp
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 177
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrbA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrbA02
4C5MA 1KYHA 5C3YA 3DZVA 3RREA 3NC9A 4KBEA 4KANA 2HW1A 3QA2A 3RSFA 2NWHA 4U7XA 3IQ0A 2AJRA 4X8FA 3NBVA 4JKSA 3VAQA 3GBUA 3HYOA 1ESJA 3RS9A 2PKNA 3UMPA 3VASA 2I6AA 5C40A 3RNOA 2V78A 5B6AA 4EOHA 1L2LA 3RSSA 2ABSA 3RQHA 2DDWA 1LIKA 4K8PA 1VK4A 5TRWA 3LOOA 2HLZA 4LBXA 3UMOA 4KADA 3B1QA 4LC4A 3RO4A 1V1SA 4DU5A 5C3ZA 2F7KA 3MBJA 4LCAA 2AA0A 1JZTA 3W4SA 3UQ9A 3PZSA 1LHPA 2C49A 2F02A 2QHPA 2Q5RA 3RTAA 3GO7A 3RPZA 2YXTA 3PL2A 1YHJA 1ESQA 1RKDA 3D3KA 3UBOA 3RY7A 3UQEA 2DG2A 1U2XA 3ROEA 3RSQA 2VARA 3B3LA 3FHXA 5BYEA 3DRWA 4JKUA 3FHYA 3IBQA 3CQDA 3HPDA 4XF7A 2QCVA 3GO6A 5CGEA 3B1OA 3D3JA 3BGKA 4E8YA 3MBHA 3LHXA 1VI9A 1VM7A 3RT9A 3ROXA 3RSGA 1GC5A 3QAIA 3RQQA 5F11A 3B1PA 3IN1A 4K9CA 3RQXA 3NM1A 3NM3A 4N09A 3N1CA 4YL5A 2AFBA 3ZS7A 4KALA 3IKHA 1UB0A 4EBUA 3KZHA 5TQIA 3NL3A 2A9ZA 5BYDA 1RKSA 3B1RA 4K93A 4XDAA 4E3AA 3I3YA 3LJSA 4JJPA 3ROZA 1TZ3A 3RQ5A 4XCKA 3RQ6A 2C4EA 2AJPA 4UBEA 3Q1YA 4WJMA 4E8WA 3NC2A 2DDMA 4O1GA 1V19A 2AWDA 3RS8A 2XTBA 3RRBA 1JXIA 3H74A 1BX4A 2R3BA 1RFUA 4S1IB 1RK2A 1RFVA 3KTNA 3NL6A 4K8TA 2R3EA 4YWRA 3RT7A 1LHRA 1UA4A 1WYEA 3BF5A 5CGAA 2I5BA 4C5NA 3RTDA 2DDOA 4GM6A 1TD2A 3UQ6A 5F0ZA 3IH0A 3KEUA 2PKFA 1LIOA 3K9EA 1RFTA 3LKIA 3JULA 4S1HA 2A9YA 4B8SA 3NL2A 4K8KA 1GQTA 1EKKA 4N08A 1EKQA 2AB8A 4KAHA 3RM5A 4C5JA 3RU2A 3IE7A 5CM5A 4E84A 2JG5A 5BYFA 3RO7A 3RTEA 3RTBA 4S1MA 2AX3A 3UQDA 4C5KA 3RTCA 5EY7A 1TZ6A 3OTXA 2JG1A 5BYCA 3RPHA 2PKMA 4EN4A 2ABQA 4K8CA 2YXUA 2HQQA 3NCAA 4DC3A 1TYYA 2JGVA 2I6BA 3RQ2A 4XF6A 2FV7A 3RRJA 4K9IA 3RQ8A 3HICA 1LIIA 3KD6A 4PVVA 3RRFA 3K5WA 4S1IA 3EWMA 4O1LA 5EYNA 4B8RA 3H49A 4C5LA 4E8ZA 4LBGA 4E69A 1YGJA 2DCNA 1YGKA 1V1AA 5COJA 3NBWA 2RBCA 4EUMA 3B1NA 2O8NA 1RKAA 1C3QA 5C41A 3ROGA 3RU3A 2PKKA 3NL5A 1LIJA 1JXHA 3Q92A 1V1BA 1DGMA 3RTGA
chains in the Genus database with same CATH superfamily
1W25A 5JO9A 1E9DA 1MV8A 4ACAA 4HPJB 4OQZA 2O8DA 1ZP6A 2NP6A 2QM0A 4GKKB 4FSDA 4FDLA 4YCCA 3GJQA 2GCEA 4M8KA 1I4OA 1T13A 2NU7B 1EM6A 5D6OA 3WKCA 4TXJA 1EUQA 1ND6A 1YJ5A 4RETA 2C03A 1U9IC 3DCIA 2CXOA 4ON9A 1VIMA 1ZD8A 3C8UA 4PQEA 5CNIA 1SXJD 3NGXA 3OOEA 4PLYA 5AVVA 1GIAA 1KDRA 4AKGA 3QEAZ 5H0IA 3ZDXB 1EJ2A 1ML4A 2F1RA 3H8WA 1DC4A 4C1BA 1QC5B 1EESA 2IBSA 2GF9A 5HIMA 3KTFA 5LQSA 5KSPA 5CDUA 3I04A 1XCLA 3NWEA 3W5CA 1YBHA 1L4NA 1Q3KA 2HRDA 2ONZA 4NABA 3W9YA 4F3YA 4RTNA 1M2KA 3KZMA 4LISA 4YAOA 5A5EA 4M7PA 4GPTA 4ZIRB 4JITA 2QMHA 2WR8A 5IARA 2IVZA 2E4AA 3JTMA 3OA0A 4L8WB 2CNOA 2N1BA 4FONA 4MVJP 4ZEMA 1NR7A 1NU6A 3QE0A 1OXVA 4L6AA 3R09A 3T3EA 3TRIA 1KZHA 2XGJA 4OOEA 1PVVA 4OKNA 1UQTA 2ZRBA 4BFTA 1E2EA 1U4SA 4LN1A 3U81A 4X54A 3EXIB 3G8AA 4RQUA 2FZKA 4S1PA 4EMTA 4KREA 3H83A 1DCKA 3PENA 4LDPA 4L07A 4L15A 4Q4DA 2Z95A 4NZZA 5EE9A 1UEIA 3BKXA 3JQBC 4GYKA 1UT6A 4JLMA 3EG9A 5AHRA 1HRDA 3BOSA 2BKLA 3CO5A 2RGCA 3NCTA 4IJ6A 1SHJA 3ZVMA 4L0QA 5AJVB 1F8YA 2WM8A 4ZVQA 3W2TA 2GN6A 2QLNA 1E62A 2HN9A 1ESCA 1LPPA 3AI3A 3K96A 3BRWA 5DBGA 3SQMA 4AUNA 4QNRA 3UPUA 3D64A 3V4OA 3KPJA 3UUFA 3TIGA 4EUSA 3LUAA 1CUHA 4X93A 3FOZA 4TKLA 3BK1A 2QMZA 3K9EA 1KVRA 8MHTA 4A8TA 2UUOA 5A5FA 1XCJA 2E3JA 4XX0B 5LQJA 3UMYA 3LI2A 4PG6A 2WVHA 3RAFC 4V02A 4N9WA 1ONPA 4QHTA 3IR7A 1Y6GA 4BVAA 2C4WA 4Q93A 4A16A 3PDJA 3SEFA 5DHPA 3H75A 3IQGX 3T7DA 4CRWB 2XRMA 4NY1A 5C7YA 1F2DA 5AVRA 4G67A 1XTRA 4Q01A 2A5GA 2IP2A 4I55B 3SYNA 3J80A 3B89A 1L5GB 5F7OA 2XDAA 2Q7OE 5FWXB 1PX2A 3ZW9A 4IGAA 3RIEA 1R8YA 1DG9A 1G20B 2H1RA 3B38A 1E3WB 2Y1EA 1AS2A 3WYNA 5KQGA 2GSDA 3KBOA 5HZKA 4PFSA 3NUZA 1T9DA 2WHQA 5H9WA 3CVUA 1W0KA 1PU2A 2QLTA 3OPXA 1X7WA 2W4QA 4ROTA 3WKEA 1Z39A 3WKAA 1E1QA 3QOFA 4D0RA 1A0OA 5C81A 3KM0A 4G9EA 2PUBA 2QL7A 1ZC3A 4YWJA 3AMVA 3V1LA 5ALZA 3D6NB 1DB3A 3QEOA 1Q74A 1SC9A 2E0IA 3I9V1 3O2QB 4UQOA 3UG6A 2IHUA 3WQHA 1QAQA 4MV0A 4WLEA 3TD2A 5I7VA 1HEUA 3OC6A 1LBEA 3BJRA 5ABPA 4IRUB 4KBFA 4JLDA 3NV7A 5DGCA 4M8IA 1CEYA 4GOKA 1UKEA 5A05A 3Q6IA 3V9PA 1GN8A 3WVNA 5F7JA 1UBHS 3INYA 2EW1A 3V80A 2P3QA 1RWOA 2VXBA 5EJ5A 5KJ1A 4NBWA 1U7DA 4DLWA 4JVMA 5DIFA 4B9EA 1U0EA 5EL0A 1PG5A 2GJAA 4AMGA 2IQIA 4XIFA 5FI1B 1SULA 4D98A 2HDOA 2FSUA 1DZIA 4DA4A 2QY6A 4MRSA 3GMIA 3ZS8A 4BDSA 4GVXA 1U2GA 4XEHA 4XWGA 3FMPB 2QSYA 1VG8A 1X8XA 1Y6FA 2HUNA 3T1OA 5JCXA 5H82A 1JBQA 1REQA 1TM3E 1U9CA 2BBWA 4MS3A 4WUVA 1PSZA 2J31A 3MTDA 4GNKA 4MI9A 2JIDA 4DLBA 2FF5A 4A03A 1OH7A 3K9QO 1EUCB 2HO5A 1QGUB 5MFZA 3FHYA 1M1YA 4BVBA 1DG3A 1RWBA 3NR2A 1G8SA 4QUAA 4WKPA 3DSRA 2PNJA 5F52A 2XXJA 3D3JA 4FFOA 4CQJA 5JXWA 4TS9A 1HNXB 5EJ9A 1NP6A 5H4HA 4RA6A 2QY9A 4OQMA 5JZMA 5J1SB 3LTNC 3K15A 1PDOA 2OOSA 3C3XA 4PHFA 2V6BA 2IT1A 4ZA2A 4K26A 4LVNA 1EINA 5HA5A 2NTYC 3U3RA 4GMGA 2IH5A 2X2EA 5C9ZA 1UEXC 1Y1RA 3PVSA 1E6CA 2QG4A 5LBIA 4ZDIA 3B1FA 1SKMA 3T6KA 1PSWA 2JJ2A 2AF3C 4OM8A 1XCMA 2C58A 3D8UA 4KN6A 4PFQA 3Q8XB 3OZVA 3EPKA 1QFXA 1O1YA 1BS2A 2IL1A 1Y8RB 1UDXA 3VAAA 4PCLA 1UANA 2BGUA 3B9RA 4RD3A 1RSZA 2VRWA 3IQDB 1GNLA 1VRCA 1W6RA 5J4VA 5K0NA 1U63A 4KPGA 2QMUA 2W98A 4WESB 4HI0E 3ZWYA 3F8TA 2PUFA 4YIKA 4LZLA 2J3JA 4XTCS 5CAEB 5JNTA 5G4LA 3BF5A 2AWOA 4WN9A 3OKFA 4E2WA 2JZOA 1A77A 1OPXA 1U8UA 3V1KA 2V3WA 1VIDA 2YICA 3CLRD 4IJKA 2NO6A 4MTCA 4YECA 1QVZA 2RGWA 4XARA 2ATIA 1J23A 2D4AA 2FJPA 3RNLA 2BAGA 5LP6B 4ZTZB 4GOOD 3WB1A 2PGXA 3EFHA 1ST2A 5EWMA 5J63A 4H17A 4DLTA 1JHRA 4EF4A 5B64A 2JIZA 3OJCA 3NGLA 2H07A 2Z9DA 3PQ8A 3R0VA 1JECA 1Z83A 5REQB 4WLOA 1VOTA 3NDBB 2M6RA 4CNQA 2B37A 3CF0A 3B2NA 2QXYA 4R8LA 3BGOS 5DM1A 1I9GA 1NN5A 4RLQA 2H5LA 3I9JA 1UJCA 2GK3A 4HQKA 3A9SA 3FLEA 3WIBA 4BJHB 1MFPA 3WGZA 3V34A 5CFMA 4LQLA 1YRBA 2FFAA 4KO1S 5KYXA 1ADJA 4GZLA 1BD3A 1CJMA 3RIXA 1XFDA 5BWBA 4OJYA 2I1VB 1UOQA 2R8EA 1VHJA 1E60A 5ALPA 3O8BA 5FJJA 4M3NA 3NIFB 1XZLA 1V7ZA 4GR9A 3U19A 3D6HA 3B1NA 3RUDA 2FPUA 3UAVA 3VR6H 3DOEA 1TE2A 3MMSA 4JYAB 4C5MA 3UG7A 1Y7HA 1K4KA 3KD3A 4PANA 4PGGA 3HYTA 4Q7KA 4X94A 1Z73A 4ARUA 4B6GA 2AJCA 3MXTA 1BEZA 4WV3A 3FPLA 2HXGA 4G89A 1ZD3A 1XMXA 3I9V6 3O84A 3ZD9A 2A0UA 3FCOA 4RKFA 1TT5A 4H31A 2VH5R 1O95D 5FEUA 2BE9A 2Q5QA 2WP0A 3EF1A 4BGUA 2PUVA 3K0SA 4JLVA 4G1BA 3WIOA 5H81A 4UE2A 2I8LA 4IBOA 3QSYA 2FSVC 2QMOA 1HE2A 3EXFA 4GXNA 1R1DA 5HIKA 2W5UA 3Q3HA 1FBNA 4MW7A 4NOMA 4QRHA 4FEGA 1IXRC 1Y9EA 2XNJA 3SXUA 3UBOA 4HB3A 4OJTA 3ZJ4A 5JJCA 3ZWCA 4AKSA 4HWSA 4AVYA 1NUTA 3GVHA 1DO0A 2VJMB 1A04A 1DIGA 3CNBA 1DOZA 3SBDA 2R84A 4ZAYA 5AP9A 1OWPA 2A14A 2WI8A 3V7YA 1NJ5A 3T9EA 3ABRB 5C4IA 1VA5A 2WT4A 2X3FA 3P0JA 3WSTA 4GLJA 4X60A 1NYQA 2WFMA 3ZH9B 4C0QC 3GLKA 4U5XA 2LP4Y 3OIYA 2JL1A 5HKKA 2V4MA 4O5AA 3LU1A 4MIOA 4YT5A 3N2EA 3C97A 4M0FA 2RHTA 1BX0A 2NPIA 1CYDA 2WOOA 4WH0A 3I0NA 2F43B 2P75A 4UKDA 1PVOA 4OXIA 5CLFA 4C0JA 2PK3A 3CF4G 2HCRA 5CVJA 1GZ5A 2P9YA 2PO7A 1TF7A 2QP4A 2Z9CA 3NDIA 4L85A 3TXXA 4F7WA 4LJ9A 3Q40A 5E6RA 4ZK6A 5T4BA 3WYAA 1IVNA 3UANA 4HQFA 1WQ1R 4C3UA 3BK2A 3DHVA 2ZTUA 4RELA 4UMEA 2VWHA 4WXHA 4RENA 3TS1A 4CCSA 3NIBA 5TY0A 5A4MS 4GRIA 4ZU1X 3FPFA 1LLDA 1Z7WA 4BZQA 4IWYA 4WAUA 3UWPA 4FB5A 2AR9A 1YBFA 3HBAA 1O97D 4WCVA 3CBQA 1B1CA 1MEOA 2K6GA 4FZVA 4NWIA 4FE7A 4EM6A 5L9AA 3ESQA 1R0XA 2CMHA 2ZBUA 3A3NA 3TLBA 2UVPB 1H5QA 1GLGA 3EQ8A 3AIOA 3O1IC 4R3UC 1JHUA 4A5SA 4KRXA 5K0BA 2WPNA 1O9GA 1TD9A 1AXEA 1B0PA 4MEBA 4FD3A 5CB6A 2QSUA 3RADC 4ADSG 4RDIA 1P33A 3BMOA 4B0OA 3SZ3A 3ZZUA 4NARA 5L3ZA 2VRBA 3IEVA 4CN8A 2Q3MA 4ZREA 3DLCA 3TR0A 2OHJA 2ZRGA 1SBCA 4GQBA 3UPDA 5A4DA 1A50B 3RQ2A 4IXMA 2R8ZA 3H74A 3BILA 1L3BA 2FN7A 2J09A 4IXWA 5JH7A 3GO6A 1PQYA 1GZ7A 1RWMA 3N58A 2O6LA 5K1ZA 1BFDA 2Q3LA 2BKUA 5DTJA 5EA2A 3ZDZB 4B8RA 1XTBA 2ANBA 1O96A 5TV2A 2ZJ7A 4ZOLA 5BN3B 3DBVO 1M1ZA 4JWKA 3DL4A 3IXQA 5LCXA 1QFYA 2CJXA 2H2FA 3U56A 1ZLXA 1XKTA 4Q1CA 4JLKA 2ZRDA 2IGTA 2O8NA 2WWRA 4DZZA 1DRUA 1VRWA 3E5RA 4RZHA 2QN1A 4JLSA 5TGZA 5BRNA 3AR7A 1RAFA 4B44A 1BAPA 1EXWA 1NBMD 2BLNA 4GBJA 4GM4A 4MV4A 3BSFA 4A91A 2HW1A 1V2HE 5TS3A 4PC6A 1NJSA 2P5UA 2HNKA 5FUVA 5I8WA 2PYIA 1CR4A 5C46F 4REQA 4YJ2A 3UWKA 3ZCQA 4P2BA 1XEWX 4IUBS 5B58T 3IUQA 1GTMA 3ILHA 3OQ6A 1ODJA 1R6UA 2B8NA 2IK8A 1JMVA 1V1RB 4H4DA 4LYFA 4PGAA 1VKJA 4B8YA 3NIWA 5G41A 3RROA 2AEFA 3DMPA 3W4KA 5I45A 4WXYB 3V4VB 4FOOA 4AKIA 1SJ9A 1E98A 2UZIR 1BMFA 3LQ4A 3A4IA 1T25A 1MX5A 4CV3A 5A71A 3K35A 5I9MA 1M2OB 5E3JA 4IYJA 5F76A 1EM8B 2PPLA 1F17A 3BH6A 3QQPA 4PLFA 5FBWB 4ZT4A 5FOQA 3GGOA 2CYAA 3ZVKA 3MYYA 4X3OA 3LYUA 4JKUA 4ZCMA 1MAVA 1Z62A 3AFMA 5JPIA 1QX3A 1QOZA 4JJ4A 4MB0A 3LFUA 4MR9A 4WOJA 5IAJA 4A0GA 4BNMA 4EPXA 4F5WA 5JAZA 3THYA 3KNZA 1A2KC 1NDQA 1W87A 4L3VA 2AXEA 2PY6A 2VP6A 1DQNA 5AQ1A 2ZBVA 5FRDA 3DA8A 4P93A 2FPWA 5CIWA 4EDFA 1SUIA 1I6KA 1BX1A 1OW3B 3OX1A 4FM9A 1JKIA 2P9QA 2PBZA 3CNQS 5E3HA 4NX2A 5F78A 1SVIA 1IU9A 1VLVA 2JCYA 4D9NA 1IZ7A 4NZYA 1VG1A 2GEUA 1SA0A 4OIFA 1RTTA 3AT1A 4D3DA 2Y67A 1L1FA 2Z2IA 3PHLA 4RPJA 2ZUTA 4DRXA 2BISA 3WB9A 3NHJA 2IPMA 2A7QA 2H1VA 2WIFA 4JYCA 4Q7JB 1JA0A 1XEFA 3TJRA 1RKBA 2EBHX 3K0FA 4ODIA 5I4KA 3HYCA 2DR2A 4ZCRA 2BI7A 3DCJA 3DEFA 4DIMA 3ZV6A 1P4JA 3OOHA 5JROA 1TIPA 1CQXA 4YCSA 4OLJA 3ZTTA 3TGLA 3RT7A 1QF7A 4OI4A 2HRQA 3HO6A 3CPHA 4RMIA 4OB8A 5AJYA 3PICA 3OPYI 2FEWB 2L0XA 3K5IA 3N8DA 5FBKA 5A3SA 5C80A 1LH0A 1GADO 4EHDA 1FRZA 1HO3A 2LXNA 5ICGA 1Q50A 3TD9A 1RQNA 5KQPA 1X13A 3K0BA 5HJEA 2UYGA 3VV3A 3K20A 1DEXA 1KKUA 4HNVA 3EGXA 4WY8A 1HUQA 1I3CA 2QORA 4W1RA 2PZJA 4D9BA 4QJ5A 1T2CA 2I4NA 1YONA 1M0EA 2PH1A 1L3IA 5K6TA 2NU9B 1NF9A 5JXIA 4BO1A 1EGAA 2X0DA 2HNBA 2AFIE 2Y99A 1ZIOA 2NSHA 4B3IA 3DLTA 2JIPA 3FA2A 3GZNB 3PUVA 1H2ZA 2GD6A 2I4MA 3EWAA 1KO8A 2HV8A 4G09A 4CIWA 1PUIA 2OZEA 4LZJA 4BEWA 3VHXA 3IVRA 4JI3B 2DX7A 4WFKA 4LBGA 2OM6A 4EYGA 4HYQA 1N2IA 2ZJFA 1WW3A 3O8OB 6YASA 1PFYA 2YXPX 5MN4A 1NBIA 3ZXIA 2O54A 3ETCA 3LDFA 1T5SA 3SC3A 5LDDC 4XPZA 4F5ZA 3VU1A 2XZPA 4HVTA 3DZVA 2WD9A 5EQFA 2P8JA 5D85A 1QRSA 4LTDA 4PSVA 2C8VA 2Z1MA 2GC6A 2GBPA 1B8OA 1SCQA 1J5EB 2JLQA 1XKXA 2R00C 1GAWA 5H59A 3OJOA 2P6RA 2IA5A 2ZE5A 1PFQA 1D0IA 3G2QA 2HX1A 2HF2A 4H1VA 1ZK2A 2ZYGA 5T41A 4DC9A 2ORED 8ADHA 1RJEA 1XP8A 3FETA 3TJMA 2YDXA 4JQCA 3N2AA 1YA6A 1EXDA 1NOJA 2XI4A 4RFSA 2VXYA 5CHYA 1YC2A 2VOEA 3L6EA 4FGWA 1UJ5A 3TOZA 2O3QA 3PVZA 3WA7A 5FWYB 3U7HB 2Z2YA 3WQRA 5HK9A 4MS4B 1QIGA 3QLJA 1R74A 2O2EA 4MWTA 4MMZB 2QGZA 3IA2A 1XQXA 1L4BA 4L9SA 4DG5A 3FZYA 4QFDA 4D0NA 2K7ZA 3CEHA 3KSZO 3U3ZA 3DM5A 2P2SA 3IE1A 4OQXA 2DG2A 5DBFA 1P91A 2VDRB 5CB4A 2NU8A 2IZOA 3HPDA 4RWZA 2AHRA 3DAFA 1NE7A 3SZMA 3KIPA 3NIDB 3TKAA 2VQDA 3FPBA 1Y8AA 3LZ6A 2FWNA 3ITKA 1SOUA 3A32A 4HLDA 4LZAA 5TF0A 4DUGA 2C7GA 4U7HA 1PZHA 3FYSA 4EO4A 2AJ8A 3RQQA 1RJDA 3HPRA 4R8KA 3COZA 5DISB 1UKAA 2C04A 1XZ8A 3WWEA 4Y7DA 4TV9A 1TQ6A 1N4DA 1LFDB 1E2PA 2ZWIA 1F51E 2A1IA 3P32A 4LCBA 4AWAA 2OY0A 2IHYA 5JHGB 5FD8A 3OT1A 4IHJA 4QUJA 4OQYA 1Q1QA 5GZ1A 2CZCA 4J7CA 5CX1B 1E59A 2C0CA 4ACBA 2X5JO 3M1YA 3VZQA 1P2FA 2B6NA 4KQWA 5BO5A 3SSNA 4ND1A 4AT1A 3DL7A 4C4SA 1VRVA 1L8OA 2ZB3A 1GNSA 2P7HA 2FZWA 1A9RA 3K1AB 4OUDA 4E3WA 4DDTA 4HDRB 2GCNA 2PL1A 4YB8A 3BXGA 1TIKA 4QFBA 3BWMA 3FRHA 4BRZA 1RKQA 2PBFA 1G98A 1TKBA 1G38A 4BC1A 4BNKA 4BNLA 1GQRA 4PC1A 5FLYA 3GJ0A 1F7VA 4QOHA 3R6WA 4HTFA 4E2FA 4JI6B 1IPHA 2P0AA 1X94A 1W2GA 1LVGA 4LEIA 3ZY2A 5I7FA 1I7DA 1YZYA 2ZSIA 4LGVA 1J25A 5FOXA 2XODA 1IM5A 4U39A 2F17A 2GJ8A 3TLGA 2Q5LA 2ZULA 2I33A 1RTKA 4AY4A 2XA2A 4C5KA 2Q2VA 2ICAA 3RHSA 2HA5A 4QTXA 1LRLA 2ZVPX 3TIVA 5K0CA 4G0UA 3HY3A 1XD2B 3PK0A 4MV3A 4WFJA 2HT6A 5F77A 4MINA 2X8BA 5CBKA 1ZD4A 1RP1A 5ALKA 2IUUA 4GGPA 1FP1D 1HI9A 3LJKA 5FTNA 5C4GB 2GZRA 3AVVA 1YE8A 3H5AA 3W6NA 1NZJA 1PEKE 4QWWA 1SC1A 1Y5RA 4WJKB 2HJRA 5CNJA 1Y3HA 1FFHA 3DWEX 3D6TB 3QNMA 4N5MA 1YQXA 1KHTA 3CV3A 1U8AA 2WB4A 4ZI5A 3U7JA 1CIVA 2QRPA 4KZKA 2ZRAA 4B5KA 4WBNA 1YI1A 5K8VA 2VCEA 3ZXUB 1RPJA 4LBVA 4Y1GA 2O8DB 3LBHA 4LTNA 3OUZA 1FGSA 3ABZA 3AB7A 4YMIA 5THKA 3JYPA 2AJRA 3CURA 3CISA 3DO6A 4QDUA 3GMTA 1QPZA 2Y6UA 3H2YA 1YQWA 4MW2A 1W49A 2GAFA 2OGWA 3KVNA 4WRRA 1L2LA 4DKJA 1Y4ZA 2P6NA 4GX1A 2DDWA 1EK0A 3CKMA 1VBFA 1FDWA 2EP7A 3OO1A 2PL5A 3RG8A 4ZYWA 4O3MA 4Y1EA 2X4GA 3HB5X 3ZVNA 2G7MC 4EG8A 4GC5A 5JH7F 3RS3A 1RJ9A 1Z5UA 1XTQA 1IB0A 4LCAA 5HZMA 2XNCA 3UB4A 1V5EA 3PZSA 3FCEA 3KR2A 4O0MA 4ZOLF 2VN8A 3TLYA 3VQTA 5F7XA 2NNWB 4ZVTA 4CV1A 4P3OA 3PX2A 4BQNA 5JCJD 2DT5A 1UM9A 4WZBB 2V5UA 5FFMA 3PLAE 1Y6QA 2D5AA 3O4GA 1XNJA 3ILYA 3PUYA 4I1VA 1S3GA 4CIXA 1LXCA 1J6UA 3FHCB 3EOAI 2Q5IA 1V41E 1I2CA 4HEA6 2AR0A 1IDN1 1JQEA 1OXMA 1CRZA 1F2TA 5BW8A 2F8SA 1D5WA 4I36A 4IQ0A 4YJ2F 1GJRA 5F1KA 2X5NA 5LXTA 2H59A 4J0HA 3WGMA 5L51A 3FLAA 1KDZA 4BJ1A 1KDPA 3WK7A 4BMZA 5C7OO 4BBPA 3VPFA 4CKBA 4UTOA 3JARB 3VYRB 2W11A 3H4VA 3H2JA 5GQSA 4TYNA 1OYWA 4F7DA 2Y66A 3EG9B 4PZZA 1GYQA 3G7UA 4KDEA 2QYTA 5CW1A 4H3SA 5EIBD 3KRTA 3G0OA 3PJDA 1I7QB 1Q0TA 2Q41A 1RACA 1YCHA 2PL9A 3O1JC 3UK0A 1BKDR 2FEKA 6AT1A 1Z5OA 2ZBDA 1BWRA 4OLBA 4EB6B 5CCDA 2ZYVX 4ICIA 1ECCA 1J1UA 1CETA 2J5QA 2Z0MA 3EY9A 4JBWA 4I4TF 4H7EA 4X20B 2XUAA 1SXHA 3HSYA 4IDDA 5LJIA 2X5OA 4B0PA 1GAQA 1H9AA 2WDZA 1VPDA 4HWTA 1YZNA 2OQ2A 4CLEA 1Z29A 2DBYA 1ZXXA 1PT5A 2JGAA 1HDYA 5LM3A 1JHPA 1AMNA 3O8DA 4Q7QA 4PX2A 1I3MA 2ISSD 1Z4MA 2HSGA 3EF0A 3N2YA 4JC5A 3T5PA 3HJCA 1UUFA 1PJCA 2EERA 2GVNA 4F8YA 4QKQA 1O54A 3ODPA 4RZXA 1FUIA 5BNWA 3E9DA 1J90A 2CUZA 2VDNB 4KVAA 2JGJA 2FOLA 2CDAA 2A4KA 3E35A 4ZEXA 3IXMA 4B5LA 3DF7A 1E1RD 3KTAA 4IOJA 4B2YA 4KR2A 4K8OA 2XUPA 3O93A 3WL3A 1JSLA 1R66A 2NV0A 5JS8A 4QU8A 1YCDA 4FSXA 1KXZA 2JI4A 3O90A 3CGGA 4PXYA 4DTIA 4EGFA 1H9BA 4DV1B 3K9FC 2HYIC 1QVVA 3DBHB 4IDGA 4MGIR 1F1BA 2IIVA 3E18A 1Z6YA 3FRJA 4DE5A 3AR2A 2BEKA 3NALA 1BOOA 2QPTA 3O92A 5B53A 2XD4A 2EATA 1SKYB 3Q1LA 1EDOA 4I4IA 1IOZA 2OT3B 3NW9A 4RDXA 1QGOA 3Q5EA 4LJSA 5KBYA 2AI1A 1Z0KA 2HJSA 3TW8A 4ENTA 4LSMA 2PLAA 2C9DA 3UUEA 3GFTA 3I45A 4AURA 4D3SA 5J4YA 1UMDA 3BN3A 4KFUA 1TECE 2WF8A 5FT9A 4JBYA 1HE3A 3LECA 1NV9A 3O91A 3RRMA 4NF2A 3RVKA 3SHVA 3UEOA 3ZCRA 1V5GA 4JFAA 1T1SA 1HG0A 3G6WA 1OXXK 4R83A 2JLAA 3DMTC 3ML1A 3OG9A 2GCAA 2ZT7A 3BFVA 3Q85A 4GOND 4POOA 3RO4A 2OBXA 3JQ6A 4B75A 4OK5A 1GUZA 2BFDA 1REQB 4MS3B 3PXGA 1RLIA 3HCCA 1QQ6A 1KL7A 3QVOA 3SEAA 3TKYA 3TAHA 5T5QA 3J81A 3BWYA 1ZNZA 3FG9A 1VCNA 1X1TA 2C96A 3CJRA 3E1SA 2DP4E 2XUIA 2Y68A 3I83A 2B25A 1M1YB 1GT6A 4ISCA 4M0MA 3SJUA 1ESQA 1NGSA 4NAVA 2GLTA 2MR5A 3VO8A 1ZJ5A 2O05A 3MLAA 3MINB 5EXSA 2G8LA 2QPLA 4KLNA 2PUEA 2AKEA 3SM3A 2Q21A 2CB0A 1N9ZA 2PH3A 2A2ZA 4KIFA 1JSRA 1T6ZA 1V3QE 2AOVA 3CN9A 4FJ2A 3WYFA 5IN4A 2XRFA 1ZI6A 3VU8A 3KJFA 4LYYA 4F2DA 2UKDA 4HMPA 3P2MA 1KGSA 5EMMA 1NJ8A 1VI2A 1BZYA 3LK7A 4W5JA 4LF7B 3R5TA 3R9XA 2CMFA 4D4GA 5AJWA 3H8JA 3FNGA 4MVJA 1JN0A 4ZVVA 4XVRA 1SK9A 3ZN2A 5IH7A 2TSYB 2XVMA 3GEMA 3B1XA 4XB6B 4QQ8A 4DLPA 2O1XA 4YLYA 5KNCH 1EVLA 3Q8MA 1HTTA 1DDGA 4Q3CA 1HFJA 3QFTA 2IPNA 2VBIA 1VHLA 3UAZA 5DO9A 4GH5A 4MIEA 3SMQA 4ZZ1A 4HN9A 4QJIA 3BIOA 3AEKA 4JDPA 4I8XA 3ZUPA 5K8UA 1A7AA 1VI5A 3ILSA 1P1CA 4WN9B 5FBQB 4JJ7A 5GGYA 1VE3A 5CB4F 4TL7A 4N48A 4Z4QA 3HCRA 1KVQA 3S5JA 3N2KA 1XTIA 4URWR 5CXSA 4AFNA 3E7DA 1NBOA 4F3TA 5LQNA 1AGNA 3MJDA 4NATA 2X9GA 4V2IA 4OP1A 4QGHA 4YH1A 4O59O 5EWMB 5TB5A 2HLDA 4MGKR 4RD0A 4BLVA 3P9SA 5HF8A 2AJBA 3P19A 4J7AA 4NZNA 4TV9F 4QPCA 2GPJA 1JPNA 2M6LA 5B2EA 4MI1A 1GY8A 3ED5A 5DKFA 5K7SA 4MUKA 3P9RA 1GSHA 4DR7B 1EX7A 3WY9A 1FYVA 4JJ6A 1E9FA 4A8PA 1P74A 4LOIA 4J7UA 1PDWA 3VR5H 5JY1A 1RAGA 2QZZA 3IS3A 5JISA 2FI1A 1XF9A 2QW1A 3GLGB 4D8WA 1K7XB 3ZHSA 1OF1A 2PV0A 3HJNA 2CNBA 1RXVA 2DETA 2H2GA 2KJQA 3RVRA 1C50A 3I4FA 4V0MA 2IYZA 1E4VA 4GDMA 2PKQO 4H08A 4E69A 1P0IA 1KF0A 3QU7A 4RXMA 3U62A 2YNMD 2QNIA 1SXGA 4Z0TA 3ZM5A 2GBFA 2L18A 3W6UA 1GCAA 1P1KA 4M9SA 4CGYA 1QG2A 2OD2A 3K8QA 3ZE7A 1RFGE 4Q82A 3E15A 1BTOA 3IR6A 4M1MA 2HMYB 3BWVA 3KL4A 4E30A 2VWQA 5BR7A 2CLOB 4LJ5A 5FQNA 4RK4A 1DBRA 5JAHA 1ZK1A 4KKXB 1NW7A 1TQ8A 3WFJA 4X90A 3UMPA 1I3NA 4C20A 1S2NA 4R81A 3MGBA 4ZD6A 4BQFA 4NL4H 3G0GA 4QXAA 3L02A 2JFOA 2ZW9A 3UHJA 3IDSA 4XYLA 1R6DA 4PO3X 2YJ6A 1FJ2A 1K63A 4NV3A 1GGFA 2JLBA 4ARZB 1MA0A 1U0HC 2OVFA 2Q4BA 5LMUB 1PGNA 3C8MA 3O74A 2PFKA 3KR0A 2V54A 1LBHA 2P9ZA 3EEBA 4FFSA 3H2KA 4HFMA 2Z09A 1TUGA 3IALA 3MQFA 3HUEA 4I99A 4TXMA 4KH0A 5EWLA 4E15A 5ADVA 3FCYA 3SDBA 3KXKA 3QFFA 5FORA 1NDHA 2PX6A 3AV3A 4WBNF 2Z56A 2YQZA 1F8FA 1WP4A 1PQUA 2CEAA 2OCDA 3OZSA 3QMVA 1YVEI 2IYYA 1O6ZA 2WU8A 1HGXA 2JD1A 3CW8X 4DXAA 1ODFA 4UUQA 1FUEA 5ADUS 3T4EA 1T6BY 3RFXA 3G8CA 1CY2A 2GBLA 1BSVA 1E2UA 1SWVA 1Q95A 3HB4X 3MSCA 4KPYA 4S1NA 3MWJA 1U3GA 3HB1A 4ANFA 1QS0A 4AJ2A 4UZFA 2QTMA 4UBLA 1E32A 2WWTA 3IVMA 2X0EA 3R44A 3WHPA 1U2TA 1T36A 5DOVA 2ZU0C 3HA3A 3IJRA 3TE6A 1CUGA 4EUKA 5KSOA 4CVMA 2ZIGA 3DW3X 4J6FA 1W0JD 4R4JA 2FUKA 3FNIA 1PHPA 5E6RB 3E22A 4AXXA 2AZDA 3I3YA 4AJJA 4N5DA 3GY0A 2HW8A 4XCKA 5C8YB 1N2CE 3OKCA 3YASA 1G8KA 2QRJA 2B83A 2OHGA 1GQSA 1Q16A 1GUBA 3E81A 3PYXA 4NDNE 4XEUA 5ELMA 4B6OA 1LQUA 4KUEA 1G60A 3X1KA 1QB7A 3DXFA 1RQLA 1QE5A 2Y4OA 2IYRA 4DIUA 5KYKA 2D74A 1VZ2A 4J0EA 4YR9A 1U0SY 2DPXA 3KDSE 2BFAA 4JNKA 1U80A 2V7XA 3LZDA 3RI3A 2RGBA 4M38A 4WL0A 2B1JA 2XF2A 4Y2PA 4DC3A 3HXLA 3T1NA 2AN4A 2R1TA 2GS9A 2G1PA 2PKFA 1WY7A 1CU1A 4MH0R 2OZLA 4LHYA 4CN9A 4DCCA 5LXTF 1ZW1A 1HWYA 2X14A 2XNHA 3OZEA 2A0WA 5K3AA 2WIGA 3GJTA 4GZ3A 3UKDA 3ZWDA 2P9GA 3JWHA 5BN5A 1V8FA 5KOHB 2OXCA 4UD2A 1U0NA 1YD7A 4XDHA 3BMOB 2G08A 2Q2NA 4UM7A 4ZYZA 4IDOA 4F3NA 3G0HA 2E4VA 4H6PA 1BXGA 5TIIA 1XNRB 2ODAA 3W0LB 5T67A 3TR5A 2DKNA 4MWOA 3OQBA 1R7RA 1O77A 2RJOA 5JH7B 4FR2A 4EEKA 2FE4A 1TCAA 1N2GA 5LUBA 3BGVA 3SWWA 4L8LA 4A2CA 3MUOA 3R3XA 4IH9A 2SCUB 3G2LA 4HPXB 3VM6A 3EUFA 3PFGA 4HH1A 1H4SA 3F7TA 5F64A 3U9LA 3RM3A 1YNOA 5I6DA 3UOGA 5ALHA 3IO5A 4DV0B 1G5FA 1X19A 4A8JC 3BE8A 1FW6A 2HMVA 3BC1A 3D3NA 5LQMA 1NONA 2D5LA 2IXTA 3IP8A 4YMLA 1JV2B 4B81A 2RKWA 3M82A 5HJ5A 1NA5A 4V39A 4YJ2B 1P4SA 3LNTA 4RTLA 2DFNA 4NZ9A 4RY8A 4Q9HA 3L6DA 3PXDA 1W35A 3X43A 5LLSA 2F3QA 5KVVA 4Q7MB 2XWBF 6LDHA 4XI9A 3BEOA 1ECGA 4DCTA 3HK2A 3CEMA 2I7XA 3NIGB 2O8FA 1FVHA 3P2OA 2DY0A 4L75A 1BVYF 1X0VA 2WILA 2B1IA 2NXWA 1DAIA 1CVRA 1EH5A 2ACKA 3BHIA 2GEFA 4H7DA 4J29A 4N65A 3SQNA 1FSPA 1TYDE 1LLQA 3PKIA 3RFCA 4P1ZA 3V2GA 2WYIA 3FUVA 3U26A 1DBVO 3PXAA 1ECFA 1QKJA 3MQ4A 1RWWA 1MO6A 3ZCTA 4Z3OA 3GC6A 1KAQA 1JILA 2EDAA 1P6XA 2G88A 2XW6A 1QV6A 1U2GC 2YYSA 3PHIA 4I4TB 4Q12A 1PZNA 3AEZA 2PQ0A 1NG9A 4PIVA 5B3LA 1PR3A 2MWMA 3G02A 2QN8A 1Z8FA 3OZRA 3PQ5A 4H16A 3THYB 4NMWA 1W85A 1L4EA 2CFCA 3BWBA 2VZ8A 4R0MA 3LDAA 1COZA 1LFAA 4ZHQA 7ABPA 4WD3A 1COWD 2XXBA 1O5OA 3L8CA 4X6YA 4P53A 2YRWA 5TRTA 2XVAA 1Y3BE 1QR6A 1R4AA 3HCDA 5TPZA 4BWFB 3U7IA 5DM2A 3U9TA 3EVCA 1E6EA 2C5EA 3KQHA 2EGUA 3S0JA 1O9BA 2A86A 2C4KA 3AY0A 3Q7RA 4TOIA 4BKRA 4EPWA 4UPEA 4N76A 4DT1B 1MJGM 1R37A 1NIPA 2HF9A 2JRCA 2IYTA 2VK8A 5FUXA 3UMRA 1RKXA 2A57A 3QVSA 5KKCA 3KAKA 1BCSB 3OP1A 1Y98A 4NBTA 3SEQA 2EKPA 3B7GA 3C8HA 3LT0A 4AN0A 5K8LA 4MUFA 2PEZA 3PB3A 4JP2A 2W37A 3I23A 4BBJA 3ZGZA 1DBQA 1DO2A 1KYTA 1V7CA 4CL2A 1MJ5A 4WOPA 2HJWA 4RJIA 2A33A 3OZAA 5J5VA 1AV6A 2C95A 3ZPXA 4BNTA 3W06A 3GVCA 3GN1A 4S1IB 4HBGA 2VHJA 5E6UA 3RD5A 4DM7A 5BUQA 3KSMA 2RHBA 3A10A 4C21A 1VBKA 2IHJA 1JXMA 1W78A 1CP2A 1DAKA 3D4NA 4WN3A 2VDKB 2AH5A 1KDYA 4GI5A 4OA5A 3A2KA 3EGXB 1ULHA 3RYCA 3SS8A 3RS7A 1GFZA 1K8RA 5K2OA 2YIJA 4EYEA 2C5SA 4MVJF 2OV3A 4ZYLA 1TUBA 4V0KA 2ZATA 3CJQA 2WFLA 3CLKA 4CEJB 5DU2A 1U4NA 5FBRB 2GFHA 2ZJZA 1TCCA 1XZKA 2OZVA 4Y2VA 2JFHA 1NY6A 4WGGA 3R24A 3ZGOA 1OTYA 1QP4A 1MF7A 3VR4H 2GTHA 1KP9A 3C7DB 2HK9A 2C3MA 4JEHA 4LWZA 3OPYB 1JR3A 4YJGB 4BNYA 3U39A 3A9RA 1Y1QA 4ND8A 2YIMA 3PT9A 5BYEA 3RRFA 1EGVB 2H8KA 2XUOA 3B20A 1C4KA 4X92A 1HZZA 4G9BA 1UXOA 3CXRA 3CUTA 1VTKA 2H5JA 2PKRA 4UQLA 1WM1A 1JUDA 2IZZA 1I30A 5SZJA 1BJRE 2FRDC 1FXUA 2JPDA 1FLNA 4QGBA 2XSZD 4Q1DA 2ODQA 4ARIA 3W2EA 5LZ2A 3CUSA 4BFLA 1ZAYA 4AO6A 4BNDA 2O3RA 1SUAA 3P4UA 3V6MA 3AZOA 4U2EA 5FDFA 5IK2A 4EOHA 3FJOA 3WLPA 1CJSA 2RKBA 1YB4A 1CJTC 2JKVA 4XYBA 4ALIA 1PR0A 1HLPA 2VAMA 1VPVA 3GV0A 4XIJA 2OO7A 4ZQBA 4ZZ3A 5JFTA 3THXB 2ZLBA 4Y98A 2FA9A 1QIFA 4LHXA 3UT0A 5B3KA 2Z04A 2XCUA 3MCZA 5J59A 3W5IA 1XFAA 4YCAA 3ACDA 4NPHA 1CW2B 4L4ZA 5KNDA 3AQIA 1C0EA 1BHJA 1G9XA 1MTZA 3D4IA 1LBSA 3OICA 5DLYA 2NU8B 1LRKA 3I04M 5CB4B 1BGXT 4AK9A 1ZG3A 3MPOA 1T8TA 5CVTA 4QUIA 2C2MA 2NZ8A 3LW8A 4OJNA 5D3MB 1NMXA 5E2BA 4YAWA 5DMXA 4GE3A 3FOEC 3OKAA 4NAHA 1AGRA 3VISA 1C9YA 5H83A 2UUCB 3DAGA 5G0SA 3AKZA 3WO1A 3T7TA 1WMBA 2FOIA 3MWDB 2A9VA 1U9JA 3HCNA 3M5DA 1KO1A 4LNHA 1J8FA 4UMDA 5G0VA 1TYAE 2MCFA 2O2DA 4H18A 1YB6A 1C2TA 4O2RA 4TV9B 3ZJYA 4EA6A 2R4QA 5I7OA 2OXEA 1QIKA 1ZKMA 1CY0A 1AO3A 4WHMA 2J7KA 2QTVA 1FUKA 1ZH8A 2ZYRA 3KUKA 3PCXA 4INZA 4BB6A 4EBUA 4ITVA 1MB3A 4G1CA 2J3KA 4IX9A 4BDTA 3CRVA 1FS4A 3GRFA 3B1RA 5DFAA 1N2HA 1EHIA 2QUIA 1H0HA 4MKRA 3I73A 3AB3A 1IDOA 1EK6A 2ETVA 4IFBA 1LJ8A 4A23A 2VUUA 2J3HA 3C3DA 1V96A 1LV7A 4PNHA 4LXHA 4Q37A 3OEED 2G9NA 1GR0A 4OUDB 3V4RA 3AXSA 1TLFA 2FWIA 1ORRA 2JVJA 1DVRA 3A11A 4N5NA 3R7WA 2EWWA 5B4TA 1YE5A 1P18A 2P2YA 5AOBA 1LDBA 1DJQA 1KI6A 4KJZA 3VMMA 4ZK2A 3ECCA 4XWKA 2AD1A 2I6GA 4XVHA 5JADA 1SZDA 3DE6X 4HTFB 4LX8A 3HDHA 4XDGA 4C3OB 1U8ZA 2R6AA 2C9MA 4EJ6A 3PX7A 3JQFA 2BEUA 1YIOA 3UMVA 3H2SA 1A9OA 4JX8A 2GJSA 3TLGB 1Q0ZA 2V7GA 4YJFA 1U5AA 1H0RA 2QRVA 3GPBA 5CEFA 3AHIA 3NM6B 1EB9A 2JW5A 4BMYA 3MTGA 3WMGA 4EJ2A 4I5FA 1Y1LA 4YCMA 1LJLA 4RAQA 4BEBA 4PCAA 4CETA 4QECA 4RNCA 3QVGA 1EFRA 4EN4A 4RMJA 1ZVQA 4LZZA 1T5HX 3SC2A 5HPYB 5T57A 3LCUA 4FFNA 4GOXA 3ZDQA 3C87A 4YP0A 3LH5A 3P0HA 1KRHA 4PZCA 1AG9A 2JGDA 3NEPX 3NRSA 4MVCA 4L3WA 1K4YA 2WHYA 2ZETA 2KLHA 1WX1A 3OPVA 1W2HA 5IPFA 2VHTA 4DR1B 1E5QA 2JFZA 3SZRA 1E6MA 1SEPA 1N3IA 4LV8B 5CW2A 5D2CA 1M74A 3LPMA 4HP8A 3ICVA 4YCJA 3HI6A 4E5YA 4DWVA 4ECAA 4QVKA 1J07A 2JGIA 4HXYA 2ZWAA 2OP1A 5AM3A 1B3BA 1KP3A 3VVMA 5KTOA 4O4HA 1KI9A 5BV0A 3WSWA 4A82A 1YR7A 2YS6A 4CI0B 4YGYA 4GI1A 3IBTA 4MA5A 1KA9H 1E77A 1QXSA 2V7TA 4PZLA 2G82A 1ENOA 3IB6A 5DZSA 4C4PA 1DMRA 2Z2ZA 3F6CA 4NCHA 4Y1FA 5LJLA 2A9RA 1E2NA 1RJ9B 1SAYA 2LNDA 4LNUB 1WDMA 3U0VA 1JFTA 1N32B 2BRUA 2H52A 5D6NA 1VBNA 2FPLA 3L40A 4TTVA 2BF4A 3AF0A 4EVRA 1OX4B 2O5CA 1JJVA 4X63A 1Q5PA 3LQFA 1II0A 2QE6A 3IBCA 1AMOA 2W42A 4PINA 2XB6A 2FPIA 1UM9B 3KC2A 3AX6A 2CFIA 5GP1A 3CQDA 1N25A 1A9QA 4IIHA 4K6HA 4Z2AA 1AN9A 3VDRA 3H5WA 1WNFA 2XMQA 3TVYA 1PR4A 4AZ3B 1H5NA 5LXTB 3P45A 3H99A 4MYRA 4WINA 5JI2E 3NJRA 9ABPA 4NC9A 1ZO8A 3QUCA 3E8SA 3UVEA 4CKBB 4NH0A 3DE7X 3COVA 5B7PA 3B7WA 3B1PA 1DBSA 1GPYA 4R1LA 1K6IA 2C84A 1B0UA 1Z12A 2RK3A 4FEEA 1E4OA 2HU8A 2WAAA 1C8LA 5BN4A 2D2XA 3AF2A 4IFIA 2BHTA 3UXHA 1YOVA 4X7BA 4G07A 4H2DA 4MARA 2B7LA 3PITA 3ZW7A 2RB4A 3OEHA 4GOLD 4UNIA 4NYIR 2Y0EA 5EJEA 3GZ4A 4Q4JA 2D2FA 5LZ5A 2JBAA 3NEYA 3PQ2A 4HN2A 3WKBA 3GEDA 1QHHA 2QVYX 4Q1EA 4E4YA 1OOEA 4LDNA 3MT0A 1NQ5A 5AKIA 3SLKA 1O0CA 4JT2A 2AI3A 4TSFA 3DDNA 2NPOA 2ZIXB 4PYNA 3KE9A 1FP7A 4MJ3A 4WK6A 2F8LA 4ZHQF 5DTRA 1S2LA 3QBEA 5G3ZA 5B3AA 3ER6A 5B4UA 3BXPA 3EA5A 5CA1A 4PYOA 4DV3B 4AJ4A 1G4UR 3MS4A 2WZBA 4U2GA 3OP4A 1G21A 4C30A 3WLQA 4FBMA 3RF6A 3L06A 1TX4B 1LPAB 2DWUA 3H5RA 4OLFA 4QEDA 4RFLA 3LA6A 3IUJA 4JWTA 4POAA 5K9ZA 2Q6IA 4GI3A 1J9GA 2LKCA 4TS3A 3MN1A 5EPUA 1WETA 5EY7A 2M6SA 4MYCA 3U4AA 4B9AA 2WTXA 5I9SA 4DWOA 4UAGA 1SCAA 4Q3OA 3HGMA 3ZUGA 3ABSB 3NHBA 1JAXA 3NKFA 3MILA 4FYYA 4YUYA 3CNNA 3BRSA 2HSDA 2Q1SA 4Q1FA 7GPBA 2GYWA 1UKBA 1VI9A 4NI5A 1L5QA 2GN0A 3GBVA 4I0WB 2BFBA 3PRHA 5K3FB 1V37A 1Z6QA 3VI3B 3WGTA 1B6TA 1MOSA 5FPHA 5EYNA 3ETHA 1J1ZA 2JJYA 4MRNA 4KMOA 2XDWA 4PWZA 3GEPA 5EIAA 4NU5A 4JVOA 2I6XA 3NFYA 4HF7A 1FMTA 3GDWA 2IYAA 2H0RA 1Y1SA 3ZJTA 3U7RA 1ZYUA 4WEQA 3V1NA 3TW8B 4B87A 2CV1A 3MVEA 3TX6A 3NHWA 4WPGA 2CLHB 3AR6A 1VG0B 1TOAA 3GELA 2QI9F 4INJA 3V1YA 5JXGA 1I7SB 4CM7A 4BX2A 2O8EA 1XDWA 3DKPA 5C37A 3N28A 3D1JA 3IEKA 2YS7A 5A6SA 4OIMA 1VL1A 3CMCO 1GQFA 1N6KA 3LC2O 4DG9A 2WVGA 2DWCA 3ORHA 1P5JA 1UC4B 2UYYA 3QX7A 3OSUA 2W22A 4LPKA 4MQLA 3GCWA 3CO0S 2PUDA 2R8YA 3TQIA 2BFDB 2A35A 3O4IA 2Y1GA 4G41A 3WB2A 1PX0A 1ZBDA 1XAHA 4UVDA 1U4OA 2QKYA 3RHFA 3VU3A 1CJBA 1KQ3A 9GPBA 4GZ5A 1XYGA 3R9IA 5KNCD 2QSZA 5FTKA 2V7WA 2JB9A 4HNRA 2C8KA 2XMRA 3ENKA 3WOVA 3LF1A 2D13A 1EX1A 3B6JA 3PPXA 4BP1A 5D3ZA 5JFOA 5SZHB 1F0KA 1PL0A 4HLNA 3EX7C 2I7TA 2VJDA 2SKDA 3HP1A 4B17A 4E13A 4PX3A 4QOIA 1AF4A 1E64A 1KSHA 1UJNA 2MDTA 3L18A 3N3AC 3H1AA 3AEUA 3PGJA 1L5NA 3V46A 4UTRA 3HSSA 4TMTA 2XZLA 2HMAA 4C4YA 4D4MA 3QMPA 1GAXA 1E6LA 2WFZA 3Q8LA 4DLLA 2VHCA 1XCPA 3LLMA 1GHTA 2ACEA 5EFOA 2C2OA 3R6LA 2EU8A 3BB3A 1QU3A 4DYVA 3DC7A 1I4LD 4KXWA 2PX2A 1FMJA 3AP1A 1TI7A 3R8XA 1P0QA 2C5FA 3NYQA 3PPWA 4IZIA 1M7HA 4MA4A 2J32A 1UBSB 4TSRA 2C1XA 4IV0A 4U9HS 1OWNA 3WTBA 3ZY5A 2BBSA 3CJTA 1Y81A 2O23A 4PONA 4Y2QA 3O8RA 3D3EA 4DMCA 5GV8A 1XLWA 3IV9A 1FSSA 4FUTA 3A6LA 1IL0A 4M7OA 1JMYA 3ESRA 1OB2A 1XAIA 1CUCA 1E18A 3JR3A 3N2KB 4WZBE 3X2SA 2B98A 1KO4A 5EE0A 2ODBA 2UZ4A 4PLTA 4BQQA 1LX7A 2JLCA 1YMQA 3KKNA 3OQJA 1N5MA 2HWWA 5JSUA 4KO3S 1VB3A 3S1AA 1CP3A 3MQ2A 4C5BA 4YGXB 4BFUA 4J0FA 2Q2QA 3QEBZ 1OC4A 1Z28A 3MJSA 1IATA 2IU6A 4UHFA 4DUYB 5WRFA 4BFXA 2X7XA 1ZS9A 2G09A 2GEJA 1NOKA 4J75A 5MGBA 2BSXA 4JB3A 5JNLA 3FTPA 4DANA 3LVRE 1JWBB 3IB3A 1T4MA 4L02A 4NG5A 4XWAA 1VHTA 3UKOA 2EFDB 3RK4A 3D6MA 1JVBA 4E2ZA 1XMOB 1F1JA 3HY6A 5U4XA 1E66A 3LIPA 1SOVA 4YC7A 2O8CA 4WKBA 1LNQA 3JRXA 2X2PA 3PC4A 3L1UA 3HP4A 3OWOA 1J09A 4KE9A 3SBEA 3TEJA 5ALGA 3PT5A 2HJHA 3A26A 3R5KA 5KYYA 3M6VA 1ZK4A 2JDIA 3GWZA 4RIEA 2OV6A 4C89A 3B1VA 1SQGA 1CPYA 3LA8A 4KI0A 1K6JA 1S89A 4DLUA 4BWYA 1KU6A 2XTAA 1LK5A 1C3QA 3RWOA 1OFUX 2JJ1D 1TM2A 4LHEA 2JAUA 1VLHA 2V9PA 5HUQA 3QIAA 4MEJA 5HE9A 3HUTA 3L0IB 5HXAA 4KBEA 3E1KA 2OXFA 3EMDA 1QV7A 4M36A 1GU0A 1DC3A 2GZHA 3CVVA 1E79A 5KNBH 4CKCA 5K8IA 2VZEA 1IBSA 5DNVA 3O83A 1YB5A 1UIRA 3I1FA 3VH1A 3BULA 2B8EA 2NVUA 4KHPB 1WHSA 2IUEA 2Z8XA 1WTAA 2FYTA 1T4GA 5TEVA 2AG1A 3JD1A 3V7FA 5AUQA 4DB2A 1VFNA 1NVMB 1QDUA 5ED4A 5CEJA 5DNCA 5ALSA 5JD3A 1Z4KA 4LCEA 5HUJA 5KMGA 1RZRA 3ZCSA 4ZT6A 4BZXA 5JSFA 5EWLB 1AA6A 2GLUA 2RIRA 2CLEB 2BE7A 2OLEA 2VO1A 3OLZA 1OZGA 4NJOA 4DMUB 2Q1YA 3AL0C 5EC8A 2GN2A 2PGLA 2J0SA 1O7JA 3O8QA 3I4LA 4UUAA 4ZVLA 4EFLA 3ETNA 3A4MA 3EHEA 3L6BA 5ALYA 3RAEC 1G2OA 1SRRA 5EJ4A 2Q9CA 1IUNA 2VF7A 1MABA 2EZ8A 2WAYA 4CFSA 2AT1A 1BX4A 1E2BA 4RK1A 5G0TA 4E6PA 1L4FA 1NJ1A 2WUGA 4KLZA 2NQ8A 1IN4A 1YS7A 1V11A 4O4HF 4GP7A 1PJSA 1Y6JA 3CX4A 1NPYA 1W5FA 1W8IA 4X1OA 1UC5B 4XM0A 5ALRA 1QS0B 4MQMA 3LSTA 1NOIA 1CY6A 3MCAA 4ROSA 4YROA 5F35A 3Q0EA 5FUBA 2ZR9A 5BW6B 4HWOA 1T36B 3UJ6A 2QYHA 5AOAA 5JXJA 3G3EA 1C7QA 3C3JA 1C81A 4ZYTA 3USZA 3E22B 4R41A 4UREA 3DE0X 3PEWA 3BM5A 1TTPB 1LVUA 3CRMA 1FYXA 3ELDA 2WK1A 3ACBA 4FW9A 4JY7A 4ND3A 4XDAA 3DP7A 2IRWA 4IIXA 5BSWA 1UWKA 4Q6WA 3SOPA 1RAHA 2WZCA 3WGQA 3ZXYA 4F9TA 3P4YA 4UPVA 4JENA 3L4SO 3I6YA 2JVKA 4GSYA 4I7EA 2AG8A 3I42A 4M55A 4XQ9A 3RFUA 3HTXA 1KRXA 1E3MA 1GTSA 1T0BA 3UMFA 5HQTA 2FR1A 4D3YA 3U3KA 3RLIA 2R1TB 3QY0A 1ID8A 2E6UX 3ZQ4A 3ZXSA 1D5CA 5JCOA 5EXPA 4EJFA 5KINB 1DUIA 1MJNA 4N03A 3D3WB 5FJIA 5LDGA 5T6MA 1J20A 4KQEA 5KWIA 4N18A 3DBRB 4ILEA 5BN5B 1SBIA 3PIRA 1ZIPA 1U04A 3B6KA 4MJ7A 2PSEA 1HQCA 2PMEA 2C4HA 4M8NE 4TN5A 3RRZA 3EQZA 3GGGA 1YGYA 2M2IA 1Q7TA 2IYWA 1Y89A 2RGXA 2R8BA 3FYUA 1BMDA 4Q3AA 4GKVA 3DTVA 2R6CA 4F1WA 3AM4A 2P3OA 2EBFX 4KI7A 2XYRA 1XNHA 2ABQA 5F33A 2PXXA 5H3HA 5JSQA 3C98A 2V4UA 4U9IS 1O0SA 4ARVA 4E22A 1PJRA 1T8YA 1TEZA 4CVLA 3TDNA 2PKYX 1ILWA 4P4LA 3JW8A 1B2RA 2W6QA 4GMKA 4WLNA 1NVVR 4OHUA 4PAGA 4H27A 5EP2A 4NBUA 1OH5A 1JZQA 4C0AC 1Z06A 2BTOA 3S3TA 2CE2X 4Q19A 2ZI9A 4Z51A 2QP9X 3GN2A 3EPHA 4Q3NA 3WGIA 3DGEC 1E6UA 4Q3LA 3MJ4A 3DO8A 3GL9A 2QR5A 4R1SA 2O5EA 3VC7A 5CYGA 3VBEA 2J0UA 2Z43A 2E4XA 2WWIA 3CVJA 3FNQA 3IOBA 5EXDA 1OV4A 4DR2B 4LY9A 2QYOA 4JBIA 2ZM6B 2IEYA 2B8TA 4QYTA 3HJRA 3VOAA 5JNVA 5IBQA 3WBJA 1VSTA 2KMLA 3VNQA 4BJ6A 3GLGE 4KIWA 1Q3HA 1NVEA 4Z4FA 1Q6YA 4OFWA 5FXMA 3CCBA 5AM0A 1T5BA 2NSDA 1CERA 2W6IA 3BGSA 3WZLA 5EIOA 2BKEA 2E6KA 3UCXA 1ZZEA 4QYXA 3SZOA 4CV0A 2BCEA 3QUBA 1GYRA 1GARA 2X7JA 2YN2A 2VDLB 4K9RA 4X1IA 4A9AA 4D8VA 2FFHA 4BO3A 1FZQA 3M0EA 1V8PA 3HQ4O 2R48A 4E2XA 4ZHQB 5TE9A 3DRWA 1DC7A 3VTZA 4QHSA 4U1RA 3U7EB 2PX4A 1YJBA 3WL4A 2H1WA 4G0PA 2Z9BA 2GK7A 2D00A 1F14A 1DWPA 2IJGX 1V3VA 3HHPA 4ZAFA 5FIUA 5JWHA 4D8YA 4ZRNA 4B3DA 3B3GA 2BPOA 3RVMA 1EAMA 2ZVJA 2PTGA 4KDFA 4UHKA 4JLBA 1FFAA 5AW6A 5BP7A 1OUMA 1K97A 4ZKEA 1KYYA 4PZAA 3AP2A 4L5AA 4N09A 4QU5A 5AHXA 3RRYA 2F3RA 3AHEA 1TLTA 3IQFA 1DEKA 1W76A 4XJSA 5L4NA 1TDJA 2DBQA 4U3JB 1T3SA 4Y2HA 4BNIA 3C2QA 3ET5A 2NOAA 5LWHA 2GBIA 1ZZGA 2FJ0A 3CONA 1UBGA 1Y8CA 5IG2A 2EJCA 2PWPA 4U2BA 5J4LA 2XECA 3QG5A 2Q6VA 2VZLA 2WA1A 3L0SA 3VYTB 5AKEA 1RQ2A 1E0AA 3F5FA 2O2XA 4MCIA 1NG1A 2IGBA 3MWYW 2RHRA 5EZ6B 1R18A 1TKRA 2NACA 3DW1X 1KFBB 1J24A 2EZTA 1I9CA 2ATCA 4LXGA 3T5DA 3UKJA 4BVGA 2IYSA 2YQ4A 3CZCA 5JSHA 3E9EA 3TRKA 5HWSA 3PWKA 2O5RA 4YIHA 4NMXB 5EFZA 2EX1A 3TSYA 4DQ0A 3RYCB 3TZLA 1OXBB 2YV1A 5B6IA 1VMIA 2HLHA 1MOPA 2ZI6A 3OZ7A 5ITWA 1A4XA 1S01A 1THMA 4ZGWA 3D4LA 1KPHA 1WW2A 2QW0X 4C3ZA 2PXAA 4KUGA 4OXKA 4C01A 1MO5A 4F5DA 5K20A 4RTKA 3FKSA 1P2TA 3RJ9A 1G6KA 5HP4A 4UAUA 3KT6A 3OZUA 1Q1GA 1JNXX 2GAAA 3L6OO 4PVCA 2MSLA 2GAIA 1UP7A 2CVQA 1CB7A 3QX8A 1I32A 5FEMA 4JODA 4EKDA 2VNAA 3KCNA 4ND8B 5B3JA 4CMEC 2AFHA 3VKUA 5HM8A 5LQCA 3IEXA 2GNAA 1QQ7A 2HPAA 3KU1A 3OM0A 4MGZR 4EPRA 3HCBA 2Y77A 1J2UA 1LF0A 1QOQB 1RBYA 1Z2CA 4WACA 1GTZA 1QFZA 4PCUA 3TSZA 4BO9A 1H42A 2DPGA 2H2HA 3P9ZA 4PYMA 5CM8B 3X1YA 5B1YA 2DLCX 2BTQA 2PA3A 4H15A 2VT7A 4NBRA 3RW9A 1T9AA 3TDMA 4C2BA 2EFYA 1PFVA 1U8CB 1LIJA 1CSEE 2B4AA 3QPAA 3AUYA 1SUEA 1TM5E 1JEEA 1U1GA 1VDZA 3RREA 5D1HA 4KE6A 3X44A 5JBNA 1ZJ4A 2R3SA 2C9BA 2BGNA 3PZBA 1XC7A 1C3LA 4H0FA 3TRFA 3UV7A 4DY6A 1BHQ1 1P1FA 1RNLA 3W5DA 3RNOA 5ALVA 2ZSHA 1NM5A 3KEGA 3KSBC 1A8UA 1CY7A 3OJWA 3P9YA 4JX9A 1L8AA 1JF8A 2J8ZA 1IHUA 4JQOA 4A6PA 3HKDA 4OTZA 3RC2A 3PUHA 4ZI3A 4C0XA 2GYUA 5H70A 4HTAA 2GAJA 5DIZA 1GG4A 1ZK0A 3OTHA 3MZ0A 4R2IA 3BS4A 1L5MA 1PN3A 3W7BA 1Z5ZA 5EHZA 4ALKA 1YZQA 1P7VA 1DQZA 1EJBA 4O1MA 2WSSA 1G291 1LY1A 4JQZA 3LPDA 1QNFA 3KOYA 3KYDB 3MTEA 4TV8B 1RXSA 1OFUA 2PMCA 3H0KA 1CUDA 2DTDA 2KSQA 3NHYA 4UASA 4PSKA 3GJXC 1P0CA 1M1NA 2IP1A 2P2DA 4RGQA 4LF8B 1C3OB 5AT1A 1GNPA 3P27A 2BEWA 1NDUA 1NAIA 1JEAA 3EXEB 3HH8A 221PA 2VK2A 4NAUA 4XIGS 3UPTA 4WZAE 5BSMA 2K87A 1FX0A 5ICFA 1XD9A 1WPRA 1Z7GA 3TDKA 4JA0A 3ZY6A 3D6AA 5DXAA 2AXQA 1KMCA 1CJUC 2E55A 1LDNA 4LRWA 5E4YA 4NXMB 3RK1A 1XWFA 2ZBRA 1J7JA 1JXIA 4FILA 3KKQA 3OBIA 1XXHA 3R7WB 2PRZA 5K3CA 4DAOA 3DCNA 2LIVA 1KI6B 4CUZA 4E1AA 5IN5A 1N8TA 2HSWA 2J9YB 2ZPUA 2IDJA 1PL7A 3K6JA 1UOPA 2H51A 1NXPA 1EX9A 4ZOBA 4BZWA 4JJKA 2XOEA 1DTWA 4I3FA 3NBFA 2BEUB 3C43A 3DMGA 4OHRA 2Q4RA 3JV7A 3X1MA 5A4AA 3CCCA 1RE0A 7REQA 1T8WA 2QRVB 3FOFC 4MNTA 3GEIA 1R4NB 4C87A 4N08A 1RT9A 2XYQA 2WTBA 4BO2A 4U6QA 2AB8A 1PG2A 3NB0A 3NZEA 4I6EA 4K6CA 5FPPA 2W8BA 4S3MA 3V4FA 4D99A 3E9YA 4L57A 3WL7A 3K6KA 3O47A 2QZ4A 5ALMA 5TVGA 1UXJA 4FCVA 3QVGB 2YDYA 4CCAA 5KKAA 2XWJI 5K4GA 4MW0A 5JS1A 3JWJA 3SC2B 3T54A 4RQAA 3W1VA 1CF9A 3ADCA 4CLOA 2R5FA 3L82B 2EG9A 4OMCA 3CMMA 1KJ9A 1T1EA 4CL8A 1PUXA 1WSAA 1XVTA 2JGDB 2OCAA 3GXOA 4ZVRA 1E9BA 3T4UA 2A58A 3RRJA 4EL5A 1X74A 5MGNA 1FVFA 4OO3A 1A9PA 3UN1A 3WR5A 3M4YA 2F1KA 1IY2A 2K4MA 4XJTA 1QIIA 3U6BA 5CVDA 4RH3A 1PDVA 2W2OA 4C6TB 1YS6A 4CQLA 1RC0A 4IIJB 2I55A 4BLTA 4DBLE 2VSXA 2AKYA 1UC8A 2D2VA 4DABA 4BGDA 5M2QA 2BGRA 5GJWC 4F56A 4O4HB 4TVBA 2YZNA 4OX9B 4TTPA 3JYOA 2HR1A 4L9RA 3V2IA 4KR3A 2GEKA 2UV8A 3HRIA 1YZHA 1N8KA 3I05A 2VTKA 3NC4A 5JT1A 5EIFA 1L5RA 3M4NA 3ABOB 1SVMA 1A3CA 3R5HA 2J41A 1UT8A 2GHRA 2WJGA 4R2XA 2FVXA 1JQAA 3K9GA 4GECA 4IMRA 4TQ9A 1TK3A 3HVJA 5KC8A 2C2BA 1I2BA 3PYLA 5F12A 4MYSA 4YP7A 4OI0A 1H4TA 2I0FA 3AJ9A 3Q2IA 4LE0A 4RE5A 1G5QA 1CQZA 1HDGO 2NZJA 2VK1A 1Z4PX 4KXFB 4W9RA 1MX3A 4FOLA 2YWCA 2VTVA 4WLVA 4XE5A 5JMPA 1ZL2A 1OZHA 3VKWA 5HZHA 5JZBA 3UQEA 1UK8A 3EW9A 3HFJA 2YJNA 4ES6A 5FAKA 3V8RA 4AKTA 4RHCA 3TL3A 4QBIA 3ROFA 4U7WA 5TPWA 4XF7A 1QVRA 3BZUA 3ES9A 3AOGA 3B1OA 1L1RA 4PSDA 1WZUA 1SU8A 1ZICA 3ETDA 4HDNB 4HRXA 4E07A 1YK0A 4LDJA 4US0R 5AI9A 4TMVA 5ALUA 4BMCA 4EDHA 3EOBI 2FWMX 1QF9A 3P9KA 1C7JA 5BN4B 5LC1A 4X5OA 1NLYA 1V9CA 2OSBA 2FW9A 4MVJM 5HIIA 5FOWA 2GN9A 1EGHA 3MTJA 2C8JA 2Z98A 3KOXA 1WMDA 4IVPA 1JHOA 1JU3A 2R4UA 4Q4JB 3BWXA 2JBAB 3MT7A 4DC1A 1QHHB 3W2HA 2VYNA 4GLFA 4U00A 4JOCA 3CLSC 5JQGA 4LNAA 1H85A 2G5PA 4LGMA 4FDUA 2VJAA 1ENZA 1NFRA 2AG5A 5A62A 3HV2A 3GR6A 3MAJA 3A3OA 3PQ4A 3R3SA 3UMGA 2QN7A 1P2UA 1X9IA 1KY3A 3K94A 2CN1A 3LHIA 5SYAA 5CFQA 2XZOA 1TNDA 1QWOA 1RW4A 2WWVD 5DGHA 1JQBA 4TWRA 3WWDA 5ALIA 1PT8A 3MHPA 2QAGA 1G21B 3TAXA 5CCXA 1KFJB 2NGRA 2P9TA 3C85A 5FI5A 3M1IA 3STUA 1BW9A 1M76A 1NHWA 1RWXA 2JF0A 3JULA 4OSEA 2IIBA 5HQJA 2BBTA 2OQRA 3F49S 1K6EA 3QSGA 3DEZA 2XQVA 5JVDA 1ZA1A 2PYZA 4BWVA 5A3QA 1R5NA 4HBZA 1W5AA 3HMKA 4LJAA 3TMAA 1S9HA 1X7YA 1RRVA 2OHFA 1S8NA 1W5TA 2WLTA 3DTYA 3GH3A 3OIUA 3BB4A 2QB5A 4BU1A 2HA0A 2QI9C 3RYTC 1IBKB 4TYWA 5I7HA 4EKEA 4C4ZA 4LMBA 3R3HA 1BXKA 5GOZA 4V03A 1GKKA 2QLFA 3CZ9A 3TQFA 4FCWA 3Q2OA 4RK7A 1SG9A 3U4QA 3D8TA 3RQ8A 2DFDA 4QTTB 4QOSA 1CUVA 4YJKA 3KWJA 3NJ4A 4BQEA 3JAMA 1XJCA 4LOAA 2YASA 5EQJB 3E7PA 3ZQJA 4NONA 5KYNA 3BL6A 1JG1A 1HZZC 2DQKA 2WE7A 9MHTA 1SC6A 1BXRA 2XWPA 5GONA 2J9RA 1A72A 1VC2A 1V8BA 2SECE 4RS3A 4TROA 2C4UA 1OYOA 1FFXA 3JQ7A 4FYPA 4PO1A 3CZRA 4UCFA 4BZPA 3USES 5I47A 5AVTA 4O2BA 1GOTA 1Z4IA 1O6FA 3PA6A 4L72A 5A6SB 4YAGA 3KV1A 5D5HA 1OA0A 3T3DA 1OZFA 1HM5A 1VM6A 3QVLA 4KKVA 1D2AA 2P4HX 4G0OA 5DI3B 4WA8A 4ZXPA 4C7OB 1KQFA 2OO5A 1XEWY 1SCIA 1NPTO 2QP3A 2BUCA 3QK7A 4C05A 5JD4A 2O7VA 2QJWA 1TU3A 2ZTSA 3KEMA 1I0LA 4JSYA 4OYHA 3SGLA 4BKQA 3PIIA 3P9NA 1WZEA 3H2IA 3ZD8A 1T1JA 1LLCA 1HT2E 3LCCA 4XD7A 3IKVA 3JQQA 2O57A 3IC5A 3LKDA 2B20A 4KNVA 2LCQA 2VF4X 4COKA 1LSJA 2VJPA 5JZSA 1J9ZA 1NXXA 3KXDA 4JMLA 3L0DA 1FYEA 3CHYA 3RSQA 3AEUB 1U7ZA 2GTPA 3R0IA 1UBRS 4YMVA 1OU0A 3R7NA 1FLDA 1QE3A 2HOQA 2XE8A 3IQZA 3RIGA 4C0LA 3LF2A 2KHZA 1FPQA 3HDTA 4FINA 1EP9A 4G8JA 1NUUA 4NHOA 1F0YA 5FR2A 4DMFA 3ZXXA 4CIAA 1T2DA 5ENVA 2BEVA 5L8VA 1ISGA 3B7PA 5F11A 2CBZA 3E82A 1DFIA 1DKRA 1GEGA 1QHEA 3EZ2A 4M89A 5TQ2A 2POQX 1TA4A 4HDKA 1C7ZA 2HGZA 3O38A 4JXKA 5EP3A 1XDGA 4JKYA 3B3AA 2GGSA 1JX6A 4IS2A 4TTQA 5J2UA 4G0VA 3OOJA 2Y1OA 4MR8A 2X19A 3MMPA 4LHZA 4FJ0A 4O8CA 3WXMA 1IRIA 3L4EA 4AJIA 2GH1A 2JFVA 2W2MA 5TEWA 4DA6A 3RIMA 3EQ7A 4E4RA 3HL4A 2BR5A 3N5CA 3O3NB 3RC3A 3WWPA 1ISPA 1WJGA 1C9EA 1L7DA 1L7RA 1T91A 1ZCFA 3NC0C 5AKYA 2DDMA 3L07A 3DVLA 1HX7A 4D8TA 2WYUA 1SCDA 5JECA 4MRMB 5FUQA 2HBQA 1DMSA 1STOA 2ZFUA 3CPJB 1J5XA 4NJMA 1XZBA 1XTPA 1T3LA 3HEMA 2VNJA 2FMHA 4Q9NA 2IY7A 3W9BA 3M7IA 5J23A 2WTZA 2FPGA 1O58A 1SIOA 3NXSA 1NNI1 2HA7A 4AROA 2A78A 4A15A 3OZTA 3A3PA 3QPUA 2XCQA 1N6NA 3HU2A 1NF2A 1JIJA 1G8HA 1KZ1A 3JQFC 4KO4S 1DIBA 1UXKA 1HZJA 3CS3A 4HB4A 4DY4A 5GOTA 1SOMA 5B58C 3H2GA 4WBSA 1XDSA 3HM9A 2YWRA 2X42A 2O8CB 3FCAA 3L6RA 2JAXA 1NNEA 5KNBD 3QX3A 1YBVA 4G0MA 1QH1A 1RXIA 3SVTA 1N1EA 4K6GA 4MWDA 3U9SA 4B3XA 3PG5A 4RMHA 3NCAA 4RDHA 1UPAA 2D1RA 2XBMA 3LUGA 2FEAA 3HB9A 3DZDA 2B4RO 4Z6KA 4A2QA 3ZQKA 5JCPA 3GQBB 1PEYA 1TVMA 3GYBA 2O2SA 2ZRNA 4H77A 3E7FA 3TTSA 1Y7PA 5C51B 5GVSA 3GEBA 1ZNQO 4YAJA 1L4HA 2XITA 4ENVA 2E21A 2QTAA 4PQYA 2G28A 3VPGA 5BPHA 5K0JA 5EZSA 4J0IA 4Q34A 3TQHA 3MCWA 3NOQA 5DLQC 2DQYA 3W05A 4EIWA 3HNOA 4IJUA 5C3YA 3OLYA 3G82C 4Y2SA 1WULS 1CT9A 1FNCA 1GD1O 2XUJA 3MHTA 5LZ7A 2A0XA 1DIOB 2NVUB 1R50A 1WHSB 3QYJA 1V8OA 3CKKA 3O9MA 1L4LA 1P7ZA 2GKOA 2QK4A 2V78A 1ZUHA 3EC7A 3K6RA 2A59A 1PD0A 2IC5A 1LIKA 2PGNA 3S5UA 3GP8A 1EFLA 2QNBA 2O2HA 1EUDB 4DJTA 3HVIA 1FJXA 2YJ5A 2QW8A 5TMDA 3S4YA 3VSEA 4BZZA 5JRJA 5FV4A 3ASZA 3EB9A 3GF4A 1EFHA 3STYA 4BV9A 1F20A 3O8QB 3A27A 1E94E 2BRUC 1JKJA 1LHPA 1CCWA 2PKXA 2WTAA 4PG4A 3P0IA 4XCXA 5EXXA 3CY6A 4TYPA 3UB3A 4CT0A 4R6XA 4E11A 5K0EA 4BY9E 1KBZA 2PRIA 3LZCA 3W7VA 4JC8A 3DHYA 1G7RA 1X1RA 5CUQA 2WJ6A 3IAHA 4GI2A 1V11B 2MSWA 3FLBA 4A0RA 4DF3A 3JVIA 4CYMA 4EF6A 2OSVA 2Z6VA 3HLYA 4RNDB 2X23A 3GDFA 4KSYA 3RSGA 3O8NA 3D7NA 3EY4A 4RADA 3OU6A 4RU1A 3RKRA 5ALXA 3UF0A 3PE6A 1NW5A 4UXIA 4KAJA 3S2EA 3UJDA 1UXIA 2YOGA 4UM9B 2EQBA 4OH1A 2D1QA 3C5VA 2IHBA 1JFSA 2FSSA 1WZNA 1P0FA 3I9OA 3OE5A 3FTNA 3UFBA 1XMIA 2RHMA 3BZBA 3HKEA 3IELA 2ZTVA 3KAPA 2CZGA 4ZXFA 4ALLA 4S0ZA 4R6WA 3OZIA 1XJ5A 2YWXA 4ZFNA 3GLFB 3WQQA 2OXRA 3R77A 2B5VA 2NAFA 4E4TA 3OF3A 1CYEA 4MUAA 4EZBA 4P54A 2ZVDA 4DYDA 1DL5A 4ND2A 1J8DA 2PSJA 4DOMA 1OXUA 3AM3A 1UA4A 1WYEA 1EE2A 3KUDA 3GLQA 1HQKA 4LXUA 2WBLC 1T5TA 4M2LA 4D43A 2RBGA 1E4EA 1VIVA 3SQLA 2VQEB 2AMJA 3T1YB 2BONA 2NYAA 1KC1A 1YL5A 3NNNA 2J6BA 4QICA 4DPLA 1TEHA 3JQGA 3KU4A 1NVTA 1VKZA 1HYEA 1MJFA 3EFOA 4DDMA 4E5MA 3BRCA 1Z37A 2AOWA 1YL6A 3FYUB 3BK7A 3SFZA 5CDGA 3QXXA 1ODIA 2XLBA 1GA1A 3CSDA 4YJHA 1MX1A 2YC4C 4LOJA 2FR0A 2DHEA 1U2EA 3L8EA 1DAPA 1WF3A 2XUDA 3NHAA 3PZRA 4IXTA 4BVEA 2I6UA 2J08A 2W2QA 1FDSA 1JDBC 2OMEA 3B8HA 2D0DA 4U7TB 5JQGF 2IFTA 4MV9A 4S35A 2VXCA 3RJ5A 2UZ1B 3RC7A 2WVJA 1CR2A 3OQVA 2P1ZA 4ZCPA 4LDZA 3ZWOA 2AVDA 2P9CA 3AF5A 1PR9A 3WWCA 5DCUA 3MYRA 4HAWA 1V48A 4LZPA 1BKSB 3IPRA 1YGJA 1FRNA 2O07A 5B7QA 1YASA 4KK3A 4N6OA 1S8AA 1UH5A 2J0UB 2Z08A 5H8WA 3QA3E 4DSZA 1S2MA 2BDTA 3H1FA 4IJQA 4X61A 3VBCA 4Q66C 4A1FA 1PT7A 2HL6A 3E9ZA 1OZAA 3QHAA 1UBNA 4DM4A 5JVDF 3NAZA 3GJ3A 3I8SA 5LMCA 3HXMA 5T7BA 3F2VA 2EVWX 3TOXA 1JDUA 4AJPA 1A8SA 4JJIA 5DV9A 3BIXA 5DWDA 3CRZA 3KB8A 4YRMA 1Y9JA 3DV0A 5EZYA 5JI3E 2QVCA 3GYGA 2ECOA 2WSYB 1QDEA 1KZ4A 4GYJA 4CTMA 2I5PO 1OBFO 3NTXA 3LV8A 4K8PA 1CLUA 1E1LA 3G23A 3NVDA 4B4VA 1L0BA 2WHEA 1ND5A 2RH8A 3H19A 4JLWA 3S1AB 4IJ5A 4X1IB 1TW2A 2GZSA 4EW1A 2E37A 2Y1LA 4XLTA 3W9UA 3VKGA 2VHVA 4BN5A 1SZCA 3OM9A 1WP9A 4GR4A 1KEKA 1G3UA 4EHJA 3TTUA 1H0KA 1H0SA 3R5JA 2AYYA 3WGNA 1XVAA 1P9RA 3LBNA 1Z22A 3SK0A 1CUEA 1AC5A 4WW0A 4Y9TA 4TTRA 4FLEA 3ZNPA 4L5YA 1PO7A 2ZSJA 1TK2A 4MQFA 5GONF 3TFWA 3WIVA 5IJ0A 4X1KA 2C7OA 4DGSA 1H2HA 1T6NA 4LJ7A 4N3NA 1PGJA 1YIDA 3AESA 4MRAA 1IIRA 1I6LA 2GR9A 3ENZA 1MG5A 3DMRA 1ZMXA 3KZVA 4I1RA 4LZOA 3WAKA 4AY6A 4AS3A 4XQ0A 3T35A 3QAIA 2X9VA 1CUJA 2JNWA 3AO0B 5BV1A 3QVJA 1W36B 2AF4C 1QCCA 1YVDA 4IGKA 2CDNA 2ZZMA 3KTDA 1VL0A 3JALA 1HPLA 4UC0A 5JANA 2AW5A 4IKOA 5D3QA 3S7ZA 2C0PA 5AIAA 1O57A 3QKIA 2HIAA 4DV4B 4P7GA 1KARA 2I22A 5TT0A 1QLHA 2FKAA 2LPMA 1TZ3A 4KWTA 1GXSA 4YO7A 2V0NA 1NQXA 2H63A 2PJZA 4F5EA 3WZMA 3V7NA 1RXEA 3NHKA 1DELA 1PJ4A 3KJEA 4PCVA 1PV2A 3JRWA 3KL2A 2OB2A 1BDMA 5D87A 1PE0A 3G59A 3L8FA 1GCGA 2VDWB 3FMFA 5DHFA 1M33A 2H00A 2VTEA 3RTDA 2W70A 1J22A 1LVHA 1N1GA 3AJRA 3BZWA 4EB0A 1SPXA 3TFQA 4CCYB 1XMPA 2KBFA 4ZJZA 3ZWWA 1NC1A 1RHRA 2SNIE 4G9GA 3KYCA 1ZM2A 1X14A 2PCLA 3UNXA 5IABA 2Q6LA 4B8SA 3E3OA 4G26A 1M6VB 2GCGA 2P5SA 4ENSA 4HVCA 1KY5A 2J7PA 2R87A 4R8SA 5J2UF 1E5XA 2YY6A 1MGPA 2YHUA 3UC5A 5JNUA 1QRDA 2FEOA 3MWLA 3BD8A 4LJRA 2RDMA 1S5PA 2YW2A 1XRQA 4B80A 4TTJA 3ZWQA 3N7AA 2QT0A 4Q9DA 5IT0A 4ARCA 2AFHB 2XMGA 1NFFA 3PSHA 1B15A 1JQDA 2LR0A 4Y2UA 5EKXA 3ESDA 3T8YA 4M4SA 1RCUA 4D57A 1NXVA 2CFSA 3PC8A 4HWPA 2DUJA 4PLVA 2PKEA 5K01A 1XQWA 3CNHA 2HMWA 2HU5A 2I54A 5FFNA 4D46A 3H13A 4MCHA 4N47A 4ER7A 1IN5A 2BTQB 2YZMA 3AVOA 3IOCA 4IZ6A 3PHJA 3VOSA 3BF8A 3BPSA 4ESHA 2NQTA 2B4TO 2DCNA 1QO0D 3UQZA 4BLOA 4LOLA 3QLUA 5JBIA 4I6JA 2B9EA 1S2GA 2W6JA 3E9NA 3VTFA 1ZN8A 3ROGA 3ZCUA 4EPTA 5CXUA 4UARA 3RG2A 1ONNA 2FSFA 5D1NA 2GUGA 2JGEA 4H1HA 4IW3B 1OGIA 1YRHA 2FZGA 2E48A 3AC0A 3QF4A 2C5GA 4FMDF 1I3OA 1XTZA 2G80A 3CA8A 3T7IA 3HRHA 3W78A 3CNEA 4OXQA 3PC7A 5BV2P 3THWB 2MT9A 1FQKA 1IMOA 2YVLA 4QOFA 1KOGA 1TKCA 1QQBA 3EXHA 3GLHE 1J2RA 3HKDB 3JQEA 4HWGA 1DV2A 3C4JA 4BASA 3A05A 3FGZA 5IANA 2JGMA 4AY3A 4LWPA 4FGJA 4MJLA 3OESA 3REQB 3IE2A 2FVYA 2W2VA 1ACMA 1ZH6A 1Z4LA 4MR7A 3T7CA 1JXAA 4LBZA 1MT0A 4EB8A 4MV6A 4OV6B 4YEDA 3UQYS 1RCTE 3GBPA 4L27A 1XEAA 2Q5RA 4I9GA 3DS8A 2DULA 3A6ZA 3R41A 2Q0QA 4PE5B 2IY8A 4I50B 4NBLA 2ZB2A 2ZJYA 3D1VA 4TTAA 4U0KA 2ZXFA 4ZPJA 5HUHA 4HQNA 5C53B 1RM5A 3FNRA 2PMKA 1RKVA 3Q7IA 3OTWA 3B13B 4FI3F 4OMUA 1M1NB 1U0TA 3WWYA 1OAOA 3T7JA 5FR1A 3U60B 1V43A 3SIWA 2G77B 1FYDA 1AZSC 2BEWB 2Q07A 1SXJA 4ZRMA 4OY3A 5AESA 2X1LA 4N0EA 4LRYA 1XZGA 5JTTA 4IDEA 2IYQA 2RG1A 5EGNA 1A96A 1RYMA 2LIPA 4GOJA 4LZWA 4OXXA 4TQUS 4X71A 2IIQA 5KYGA 3PFFA 3GRZA 1OBCA 3DVRX 3M5PA 4BTEA 1V16A 5L3SA 1NBWB 4ZEOA 4BVFA 2W2KA 3SX0A 2H1CA 2VH1A 3H18A 1T3HA 1KNQA 3G85A 2VQFB 1XXHB 2A30A 1VCHA 4PLHA 1IJEA 2R6HA 5KOJA 1B3RA 4K9NA 1YU9A 4D80A 5JASA 1OH8A 1V4NA 2JHPA 4F4IA 1K2WA 4FDTA 4MLZA 3WWOA 3P0EA 3ILVA 3SYLA 1GUAA 1XTVA 3OQIB 5KSWB 3I6QA 5JMWA 5NLLA 5BWLA 2XD9A 4G86A 4I3GA 4BEVA 1NXWA 2WQZA 1FTWA 1KZ9A 1NMQA 1ZY2A 2WJAA 3LHKA 4HG2A 4IYRA 3CUVA 3T1HB 4OAPA 4C7JA 1N57A 1YK1A 1AB6A 3C3AA 2XLCA