3RRBA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with amp
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 177
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrbA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrbA02
1V1SA 1YGJA 3BF5A 3UQEA 3W4SA 1VI9A 3H74A 3RTEA 4S1IA 2NWHA 4C5JA 4DU5A 4GM6A 2V78A 4WJMA 3RSGA 3LHXA 4E3AA 3UQDA 3B1QA 4C5NA 5TQIA 2I6BA 3BGKA 3RQ8A 4K93A 3DZVA 1RFVA 4N08A 3RPZA 2ABSA 2XTBA 4EN4A 1V1AA 1TYYA 2ABQA 3B1OA 1BX4A 2I6AA 3FHXA 2JGVA 3H49A 3IE7A 3K9EA 1RKSA 3B3LA 3QAIA 2A9YA 3FHYA 4S1HA 1EKKA 1TZ3A 3CQDA 4U7XA 4K8TA 3GO6A 4DC3A 5CGAA 3NM1A 3RTGA 3B1PA 3HICA 3HYOA 3RQ2A 3K5WA 3RT9A 3KZHA 3NC2A 4B8SA 4EBUA 3IH0A 3RNOA 2QCVA 2JG1A 4C5MA 3D3KA 1RFUA 2F02A 5EYNA 2R3EA 4O1LA 3NBVA 2AJPA 1YHJA 3RRFA 3MBJA 4E69A 3NC9A 3IKHA 3RM5A 1JZTA 1ESQA 3ROEA 3NCAA 3RREA 1RFTA 2Q5RA 3NL3A 3RQQA 3OTXA 4X8FA 3RY7A 2C49A 1RK2A 4C5KA 4KANA 3RS9A 3RRJA 1LIOA 1LHPA 2DDWA 4S1IB 3NL6A 3RO4A 3QA2A 3UMOA 5C3ZA 3IQ0A 4E8WA 3NL5A 3RQXA 4LC4A 3ROZA 3RTCA 3LJSA 3EWMA 3DRWA 4S1MA 4KALA 5C3YA 3B1RA 1YGKA 2VARA 3N1CA 2R3BA 3B1NA 4KAHA 4O1GA 4K8PA 3NL2A 3RU2A 4XF7A 5F0ZA 4C5LA 2DDOA 4XCKA 3UQ9A 1RKAA 4EOHA 4KBEA 1LIKA 1JXHA 1WYEA 1UA4A 3RTAA 2O8NA 3ROGA 2AA0A 5F11A 3RTBA 2AFBA 1LHRA 1JXIA 1GC5A 3PL2A 5C41A 4UBEA 5BYEA 5BYDA 2PKNA 3RSFA 4JKUA 5EY7A 3GO7A 2DDMA 3D3JA 2RBCA 3ROXA 3HPDA 3RQ5A 3RPHA 2QHPA 1KYHA 1TD2A 2PKMA 4LBGA 3RO7A 3LOOA 2JG5A 2YXUA 2PKFA 3RU3A 1C3QA 2AJRA 3Q1YA 5BYFA 4E84A 3UMPA 5CGEA 3IBQA 2DCNA 4K8KA 2DG2A 2HLZA 4XDAA 2PKKA 3RQ6A 3RSQA 1V19A 3MBHA 1UB0A 2C4EA 4LCAA 4YWRA 1V1BA 4EUMA 1L2LA 3RTDA 3KD6A 3I3YA 5B6AA 3RRBA 1DGMA 4LBXA 5COJA 4JKSA 4E8ZA 2AX3A 2FV7A 3LKIA 3UQ6A 4K8CA 5C40A 2HQQA 1LIIA 1GQTA 2HW1A 4N09A 3KEUA 1RKDA 1U2XA 1EKQA 3RQHA 2I5BA 4PVVA 2AWDA 1VM7A 3JULA 3KTNA 1TZ6A 3NBWA 5CM5A 4YL5A 4KADA 3ZS7A 3RSSA 3IN1A 4E8YA 3GBUA 1ESJA 3PZSA 4K9IA 4B8RA 3RT7A 4XF6A 3RS8A 4JJPA 3VASA 3VAQA 4K9CA 2A9ZA 5TRWA 1VK4A 5BYCA 1LIJA 2YXTA 3NM3A 2F7KA 3UBOA 2AB8A 3Q92A
chains in the Genus database with same CATH superfamily
3OMWA 4RJIA 4MV7A 3JASB 5BVHB 1K4MA 3QBDA 1IZ7A 4NESA 2VDWA 4G1BA 4E3AA 1JN0A 4BC0A 3VNSA 4LGCA 4CG1A 4EPVA 3U3RA 2J5RA 1V11B 4IJMA 1QHFA 4GPEA 5KQPA 3RPZA 3DZFA 3KYDB 2WIBA 3BE5A 1V8DA 4JGIA 2RK4A 3HVRA 2RG7A 4HDRA 3DE3X 1ZISA 3FRIA 1VE9A 4HGYA 4N01A 4U7XA 1LPPA 1K08A 1N6LA 5KNDH 2XUJA 2EJBA 3LX5A 5IK2A 2LDXA 2AJTA 3EC1A 4HK4A 3E5MA 3Q1KA 3ZHSA 3MQFA 2GS9A 1BHSA 1I6MA 1ZSVA 5K05A 3C15C 1IPFA 1ZK1A 3UG6A 1YBVA 4NZOA 2UYYA 3PNPA 1N34B 3M6MD 3TLZA 3D6HA 3ADDA 3NEJA 5E9WA 2YVQA 3DMHA 3PDHA 4LDQA 4BJ5A 1IEVA 4YAOA 4TLCA 3UA4A 1X7GA 3N8DA 4WCVA 1KOGA 2IW1A 2ZJ6A 3DAHA 3G23A 1PUIA 2BGMA 4ZGGA 5JYEA 1SBTA 3NP9A 3RQXA 1E96A 3B13B 4K9QA 4W9NA 3TVDA 4XR9A 4Z4IA 3NX4A 5LP6A 2PHZA 2X7HA 3PHLA 3OPYA 4B8YA 4D25A 1LIIA 4INAA 4Y2SA 2XE4A 4KE6A 1J97A 1L2TA 1WQ4A 5FBHA 4C3VA 4G01B 1IJKA 1J21A 2HU2A 3AEZA 5KC9A 3DL0A 5DWDA 1JR3D 3HC7A 3V2GA 1E3IA 3ROTA 1T15A 4JP2A 2IUFA 3KEOA 4JY7A 3THOA 4EQ6A 1AX9A 3KP1A 2QDKA 1XCPA 5HF9A 5ER9A 4TKUA 1NMYA 4N6GA 4TQAA 4TZKA 3ZWQA 1VRVA 1A9TA 4FDTA 1N0HA 2Q1YA 3GH1A 5K9ZA 5JNRA 1TJPB 2P65A 2YVAA 3D3JA 4B2IA 1XD2B 2HLNA 3F7OA 1N6IA 3E35A 3IT2A 3KZVA 3L3BA 4NENA 4ZALA 3U7JA 1IDOA 3DYVA 5LM3A 1R0KA 2J3QA 1RJWA 3EIXA 1SM4A 2QX7A 5LD2B 3C7TA 3LUPA 3RYCB 4ZZIA 5DGTA 3TB4A 1Y7PA 4OUDB 1TECE 1X74A 3KT8A 1OXSC 2CV1A 1GQFA 3FPHA 1RM3A 3IGFA 3QPCA 1K6MA 2GOYA 5KI6A 2XD4A 1D5WA 1MIOB 1W5TA 2OQ2A 3W9SA 2VJMB 1XUOA 3OU6A 2HYIC 2ZVDA 3A6JA 2A33A 1MGPA 2VUHB 4GKAA 1NDQA 1Y82A 4OP3A 4R2MA 4F92B 5KTPA 4RY0A 3N39C 1MO5A 1NUTA 5JCXA 3F6EX 1IY2A 5FA6A 3ZE8A 2EL7A 2H6EA 1P18A 4R2LA 5JZSA 2HPZA 2AFRA 3ZGLA 3ZS7A 4EHDA 1PR0A 1VHTA 2R97A 1KEEB 2DH5A 2J5BA 1EXWA 3OSZA 4KIFA 4RD3A 3DA8A 3RRMA 3SBOA 4BMSA 5CDTA 1TMOA 5BN4A 1O6FA 2RGBA 4CL8A 1HOTA 4UBLA 5F51A 5KVVA 4DWWA 3JZAA 1QH8A 2CF6A 2CXQA 2HB6A 3KALA 3LQ2A 4UD6A 1PL7A 4W5JA 3WNQA 4BQIA 1MO6A 2QE7A 1CS0A 4W4TA 5BQ5A 1UM8A 3HDJA 4ZEOA 3E9CA 3RLIA 1XPRA 3K1AA 1PWXA 3DTVA 1IBSA 3SSMA 4GOLD 3MELA 5CU7A 3ECSA 4YR7A 5CBPB 3TM4A 1W4RA 1AKRA 1Y9DA 2WAYA 2YV3A 3JAKA 4YLGA 4H60A 4EYSA 1SCDA 4KX3A 5G0WA 3BUSA 4TT8A 4H0FA 1SKYB 1NE2A 2VP5A 3N9IA 4I9UA 3R7WB 4AMUA 2BFWA 1ZJWA 2NSHA 1HE5A 3WA6A 2HMWA 2QJWA 4LXGA 2GN0A 3QWFA 3CQDA 2VBFA 3KNZA 3ETCA 3H2JA 3K0BA 3HYRA 1K7SN 4GXQA 4KE7A 5NULA 4D9JA 2C0QA 3QRWA 1TW2A 3U4IA 3PFHA 2WV7A 3K94A 1G20B 2VOEA 3GJ7A 3A6KA 1AHIA 4H2DA 1I4WA 4FZRA 4S2EA 3VO2A 4DWVA 1B8OA 4Q66C 1IHYA 1TM7E 3H3XA 4XD7A 1U94A 3CX6A 2WHEA 3LL7A 4H1TA 3ZHOA 1GLNA 1YV9A 3DFMA 1L4LA 1W87A 3PFWO 4O4LB 4TKVB 3L1VA 5IBRA 3MBJA 1Z4JA 4BO3A 3MRXA 4EUMA 1O95C 1R4MA 3OEWA 2XWBF 4N5DA 1VPLA 5ESWA 4B3SB 4C5KA 1NJ2A 2DCUA 2H2GA 2NUPA 2Z9BA 4CFZA 8OHMA 3EWMA 4EQZA 3AKZA 4OJTA 1NONA 1KRWA 5EXPA 4PLHA 2O5CA 2CVOA 3B1VA 4OSEA 1WE2A 3PQ2A 4Z9XA 3GGDA 3L4JA 4H16A 3PEWA 4QF5A 1GNSA 3M70A 4D99A 1TVCA 5B3AA 4E5SA 4TT3A 5A0FA 3DL7A 1GPLA 1H69A 4II7A 3RRNA 2H2AA 2QTVB 4Q9DA 1HK7A 4TSFA 5JR3A 2NU8A 3ZV6A 4AXXA 2GLUA 4Z1MD 4HEJA 4RIGA 1XL0A 5ADWA 2PS1A 3MWLA 4LHWA 5ICMA 1H6DA 3K2QA 1FX1A 4MYUA 1F0NA 2WI8A 3EUFA 1TF7A 3JQQA 4PSDA 3VOBA 4RK5A 5JYBA 1L4BA 3BL8A 2F1OA 1DIGA 4KREA 1G4AE 4Y2HA 4MKIA 1GQOA 2VAXA 3U7EB 3RS2A 3BAZA 3VO1A 4P38A 5ECDA 3BE8A 2NSJA 5ALGA 3B7WA 3GNSA 4J03A 4MQ5A 4Z7QB 3KXIA 2B99A 2LUOA 2X0IA 1KDVA 4KO4S 4PAMA 1F2TA 2FWIA 1Z9BA 3A27A 3FGNA 3S8EA 2NO7A 3GRYA 1WD5A 4DV3B 2BMDA 3O8BA 4BTLA 2GCPA 3QPDA 5KO2A 1JEQA 1EQ2A 2PX4A 5BSWA 1X19A 1R3DA 2CL6X 1T8YA 1XALA 4IH1A 3AU9A 4OCZA 3RKSA 4TYMA 1L8QA 2C4HA 2OCYC 5DBOA 2Z5LA 4CV3A 3A0UA 1JIXA 3L01A 5A6SB 1L1QA 4PG7A 3M3HA 1GKUB 1XEAA 3VM6A 4ER7A 5JPDA 3PRKE 2HDNB 4PONA 3L41A 1G2QA 3RVNA 5HIIA 2NO1A 5CT4A 4KSCA 5EJAA 4NCIA 1P1BA 1DAIA 4MV4A 3CXUA 1H6BA 3IURA 3HBMA 2W2XA 2YVLA 3DHNA 3LUJA 5A02A 4D8XA 4HYYA 2GNAA 4Q9IA 3WZMA 3QSYA 2YMPA 1ZW6A 1SQ0A 3WYCA 4A0FA 2GD0A 2V74B 5ITZB 3E8XA 3FLMA 3OLXA 2ZT6A 1HG0A 1KH1A 3M6IA 4TL7A 4X90A 5ECYA 5KYVA 3TLCA 2QVXX 1CQIB 2VAMA 2BMEA 4WLVA 2FLVA 2ZB2A 4GRIA 5LA6A 3SXUB 4FLEA 2HPAA 2YIMA 4D1YA 4JP8A 1WP4A 3UAWA 4GI2A 3R0VA 4L8WB 2FPSA 5G1NA 3WKEA 1FX0B 2G5TA 2VJQA 4IMRA 2ZM5A 3ADKA 3OA0A 4ZCRA 1X92A 3GD7A 1PSDA 2I33A 4QUKA 4PYOA 1D0SA 1KFKB 2W2NA 3TQCA 3TMYA 1UF9A 2ZQZA 1NMQA 1L7PA 1SVIA 3ZOZA 4OQNA 3CX3A 2ZRPA 2NAPA 1ZKDA 2Q28A 1QB8A 2GSWA 3T7TA 2R6JA 4B84A 5LR6A 4RH0A 3WGQA 1JQLB 2AOTB 3CLTC 2QGFA 1Z0AA 3M1LA 4LYGA 1DXOA 4QSMA 2HK9A 2HRCA 1Z0DA 2XSZA 3GCDA 4K1XA 2X0RA 3L40A 1W46A 4LXXA 4MDHA 5TPZA 4JI3B 1LLQA 3A1DA 1Y1QA 2P4QA 4JI1B 2UZ4A 2QGNA 4HGOA 2EF0A 4EJSA 4JLVA 4ME6A 4NH4A 4KN5A 2R1TA 3PQ7A 4BV9A 2R3BA 4KAHA 2WKWA 3FCCA 5IJ0A 3ZBTA 4LI0A 1T6BY 1LTKA 4INJA 5WRFA 1N5MA 3OFJA 4LI3X 2GPTA 4LSGA 1P4HA 1DDGA 3B82A 3D8BA 3REQA 3A3KA 1ST2A 1N1MA 3H87A 1OIXA 3TF5A 1TTPB 2OO5C 1BHO1 1R64A 1LJUA 1EX7A 1JYEA 5TQ2A 3QKRA 1JBEA 1WUTA 4D3FA 4FNOA 5L9AA 1ZM2A 3K92A 2BFDB 1N3YA 5DK6A 1ORVA 1XXLA 1NR5A 2GEBA 1GNTA 4J1NA 4R9SA 1PYOA 1JWBB 3HYLA 2VLIA 3MJVA 2EFCB 2PAFA 4ARIA 4DIMA 5BYFA 3EF0A 3WHKA 1MB9A 3OOYA 2P62A 4KVZA 4Y1GA 3WAGA 1GA6A 1NE7A 2AXNA 4LV6A 5CG1A 3KB2A 1O87A 4ML3A 4PU0A 4DR4B 4FOTA 4AVYA 1CDDA 2PO5A 3T3MB 4R9NA 2HKIA 3MGGA 3ZQKA 2B4AA 2J3EA 3UQYS 4D96A 4P5EA 4PANA 4JLKA 2GZDA 3C87A 4RESA 1WB5A 4BLSA 2CXUA 1M1YB 1TE2A 2ZIWB 4KXNA 4E1AA 3I1YA 4CLRB 1GNQA 4W5WA 4HTFA 1FY2A 2XNDA 3PSAA 1P4AA 1M54A 5B3KA 3KPWA 1K0FA 4BYMA 2F4VB 2WTNA 5K3OA 4L6IA 2B30A 2AOUB 3QEBZ 3FPFA 4II2A 1UZAA 1CUSA 1SN7A 4FNGA 1ZK4A 1J1ZA 2Q6IA 5T4BA 4HAXA 1N78A 2XNKA 4JJ7A 4M76B 5E3HA 4JKIA 1RPZA 1OVMA 1WETA 3HZRA 4MINA 3L7BA 3B1FA 2ENWA 4OM7A 4JZYA 1G59A 2VNSA 4A26A 2P75A 2C4NA 4D3XA 3IJRA 1C7EA 3L7NA 2ZUUA 1YQXA 4BU1A 3NXSA 4KKXB 1JV2B 1E3SA 1S9HA 2AGVA 4JGBA 3RUPA 2BF7A 1DB3A 4BB5A 2IYXA 4CL3A 5CCEA 2A7QA 1XZ8A 3PS9A 2DT8A 4D82A 2PX0A 1E9FA 3BWMA 3WGOA 5IARA 1X7HA 4MARA 4PQEA 2XAUA 1NG9A 4KQHA 4WCDA 3T06B 1MPTA 3BIXA 3ZQUA 3GCZA 5CA0B 3N2KA 5JS2A 4YWHA 3O74A 4ZHSA 1BMFD 3K4PA 1MW9X 1YR6A 2GHIA 5HKKA 2FFQA 2V7XA 3O8NA 1GA1A 2F3PA 1EVYA 4Q7KA 5JSUA 3ILHA 5LU9A 4TVSA 2VDMB 5AM1A 2QG9A 4FYXA 1KMHA 4JT8A 5TY0A 4FINA 3MSCA 3NVDA 4TSKA 4UTRA 1PYDA 1TK3A 2XGJA 1JKJA 5FBZA 5C1DA 4BFYA 3QYPA 2BZSA 3WIBA 5A7GA 5E6UB 3TEFA 2ZTMA 4UE6A 3GARA 4EW6A 1WABA 2FSIA 4BEBA 3JQGB 4UTOA 3E9ZA 1JHQA 2EYQA 1IHPA 3H86A 3PR3A 3UQZA 4FZ3A 4UEQA 3WIEA 4NU8X 1KBOA 2P5YA 4QXAA 3VAAA 3WAKA 5JYCA 3GBVA 1HNXB 5LMUB 4B32A 3SYKA 1QFMA 5DBHX 2AYZA 3BYZA 4MWGA 5CCBA 3KUXA 4JASB 3V80A 3H6HA 5FNVA 5JFOA 1KQNA 4WVLA 1CY2A 1LPBB 2VLBA 3KOMA 1WKBA 2KB0A 1IY9A 2Q6VA 2PZEA 3A36A 3A6HA 3OZEA 3RKUA 5JT1A 1USIA 1EVKA 2ZVPX 4PO1A 4KE8A 4ED9A 1MTZA 2ZJFA 4RQTA 3T5AA 1BZYA 4TKLA 4L3WA 3KQYA 5F73A 2D5IA 5C7OO 3Q8MA 4Y9SA 4DCGA 1U0RA 1D7AA 1P2TA 4QXOA 3AHJA 4A4DA 2XUQA 5ALDA 1XJWA 2ZKLA 1DT3A 3F8TA 3IV7A 4FJ1A 1NVBA 3CF0A 1YU6A 4K3VA 1ZIPA 2IHYA 2RBGA 3AB3A 2QYTA 4EKNB 1QFSA 1HLGA 1UJBA 2GT1A 4EG5A 2O2SA 5ARDA 4DCCA 1IMJA 1TCAA 2HU5A 1EFPA 1W0CA 2QRMA 3RV4A 3LVBA 1FYWA 2WTMA 1JMKC 2ZIUB 3LP8A 2PYIA 3LX8A 4IX9A 3ZY6A 2PX3A 3UPUA 1JDZA 2VP2A 3BXZA 4LMAA 4UTNA 3OQNA 4BWGA 4RHYA 4ZC8A 2APJA 3SJ7A 3CVVA 5B6IA 2GZ1A 4WQMA 1XFDA 4PRZA 1Q83A 1PO7A 2QG4A 1WCXA 3B8HA 2EZ9A 3INYA 2GK3A 1EG2A 3IAHA 2Y9PB 1KP2A 2O05A 1S8FA 2XWJI 3CZQA 4HDAA 2ZRHA 1SEVA 2Y1DA 3FCEA 3GA5A 3L0BA 1M34B 4N0QA 4BFSA 3OE5A 2X8AA 2P40A 2ZSJA 2CXHA 4UAJA 2L17A 3L84A 1RI4A 1OC2A 4IUYA 1GRNA 1MEOA 1ZG3A 2IIPA 4XEUA 4YBZA 4DUPA 1N8TA 1ARZA 4O1IA 4Z5XA 4K9IA 1M2FA 5KUTA 1CTQA 3DFKA 4RBNA 3SHOA 4KR6A 2YXBA 2AD5A 1NVMB 4AJJA 5DK4A 1O97D 2OFWA 4UQOA 3WMFA 1JL3A 3AK4A 1Z13A 1EPUA 1S7GA 3JYQA 1XXHE 2PN1A 2GEFA 3DHYA 3PXEA 4L27A 5AKZA 4X61A 1WKVA 4RXTA 4RX1A 3RG8A 2VPQA 1BYIA 1T9AA 1AT1A 3ETDA 3L8CA 3O90A 3M6UA 1N1GA 2JIBA 3A1FA 3TO5A 5BQFA 5HDQA 4X1KB 3HUTA 1Q1GA 3OJXA 2ZPAA 3RC1A 5L40A 2VYVD 3JD2A 3TAHA 4A16A 1Q7TA 1U80A 2FPKA 4MUBA 1L4EA 2R84A 5UKDA 4IXDA 3S1LA 3KR1A 2QTLA 4KHZA 3TMAA 4A5OA 3NH9A 3ENNA 4D43A 3EXIB 4NYJQ 3SSAA 1SU6A 3W3AD 3HYOA 2WWIA 1DQNA 2ECKA 2OCKA 2YX1A 4EF6A 1NF9A 3STVA 2F4NA 1KZ9A 3EX7C 4GOOD 3N8NA 5H59A 3U7QB 1CUWA 2ZRGA 3H2YA 3PGXA 4FYWA 4G5RA 4DMGA 5EYNA 1MVOA 3K15A 3KT0A 5DLQC 1RHJA 1PR3A 5BXQC 4JK3A 3EVZA 3UWPA 2WKSA 3E8SA 1ZHOA 4W9NC 1UT6A 4ND5A 1AHNA 2Z04A 3BXOA 3RS9A 1GT6A 1OFVA 3V2IA 2ZIAA 4R9VA 4YUVA 1LEHA 2RHTA 4ZVOA 1H6CA 3QI7A 1NQUA 1YZGA 2DLDA 2GR9A 3AEKB 1YZUA 3A2LA 1QQ5A 2C7PA 2ZE6A 4F38A 4QYMA 3FOEC 5A7FA 4P58A 4D81A 3EXHC 2QR5A 4HLUC 1MC1A 5JS8A 3KEQA 1GFSA 4Z3OA 1GFZA 2WHPA 5AO9A 1CR0A 3ZE7A 5HP4A 1SU8A 2OV6A 3TDNA 1D9ZA 4GMXA 3KYIB 1NC3A 1LBHA 4MUEA 1VPEA 1X9GA 1NQWA 5BUCA 2CLIB 1VLZA 1A0OA 4L4YA 1MABB 1GRQA 4KXXA 2KWIA 3HPDA 2SNIE 2ZPTX 3UGKA 4A6PA 3NM4A 2XQFA 2IDZA 1IOVA 4IQ4A 4NBWA 3OCWA 3VMFA 4A2CA 3W5VA 1LZKA 3KB8A 1ZR4A 1Y5NA 5BV1A 2NZXA 3AUFA 1XAIA 3IE0A 1Y9ZA 4XDZA 4PC3A 2POCA 2X8LA 4NJOA 3NHLA 3EXAA 3S70A 5CJ2A 2B4RO 4QTYA 1M2KA 1SKAA 4OHCA 1HFWA 1XX6A 5LYYA 1L7QA 3IP7A 2Q6TA 2B8TA 2JJ2A 3GZ4A 4XSGA 4H15A 1LA2A 2HA4A 1MEEA 3UB4A 3VHRA 4EW1A 1P2BA 2H7VA 3TK1A 2X9LA 1RP1A 1J1IA 1FB5A 1SU4A 3NHPA 2JI4A 4FSDA 1E79D 1Z5WA 5ICEA 4B3BA 2ATEA 4IQ8A 4D5EA 3EPLA 1FRZA 1RPNA 2AQ8A 2C4VA 2R6CA 3GZNB 2AMLA 4O4LF 4GE0A 1EKQA 2JIDA 4LOJA 4CF6A 1TJ5A 4AKGA 1FCJA 1X7YA 4RJKA 1KK2A 2IEGA 4X45A 3STYA 4XQCA 1EJ6A 3GFFA 2E48A 4UNQA 5EJFA 4KKVA 3UMVA 2ZRFA 5KX5A 1NI3A 3IXLA 2PUAA 4HL6A 2XMBA 2QN7A 3W2FA 3OM1A 3H83A 4X1IB 2CLHB 2H9YA 1LBIA 5I7VA 4CNQA 2DUUA 2RGXA 3EASA 3FDFA 2A57A 1UJ5A 1I51A 2RSLA 1SVNA 2G6TA 5A7HA 4URVR 5KC8A 1WMDA 2R8OA 4XX0B 1P0MA 3CCFA 4ZQGA 1V7QA 1S3GA 3ORSA 1WDLA 2ZR8A 1FPMA 1RZUA 3EHEA 3FYUC 5DP1A 4QIHA 4Y2RA 3NTVA 4YDQA 4Q02A 2J4CA 1K5PA 2WM8A 4S1PA 3TAXA 5FPKA 3HH8A 1Z6PA 4L5YA 1H8EA 4BX0A 1R9JA 3UMYA 5AJHA 1HR0B 5C5EA 3N5KA 2OAEA 1U4OA 3DJFA 1T1RA 1P72A 3AR4A 1PT5A 1V37A 2A9QA 2ZUDA 1QK5A 3FUWA 4Z9BA 5DZSA 3T0IA 4D56A 2G71A 2O3SA 2DEUA 4JI0B 3TL2A 1KFJB 4RHFA 5DM4A 3AL0C 1QV6A 4PS0A 5ICGA 1IOWA 3MHPA 4ALJA 4RGBA 4LYHA 4NCKA 3WMXA 2F17A 1Q1BA 1KBQA 2HUNA 1JHRA 2WM2A 4Q48A 4QYSA 2YHUA 3DV0B 4GZMA 4O0MA 4BNZA 4QC2A 2R1VB 3NKFA 1DX9A 4IGAA 4CI0B 3EIFA 2HLDD 3DEYX 4XIGS 3THWB 1W7KA 4AS1A 4L4XA 2WFLA 2GHRA 3DVQX 4LRXA 4K2HA 1VSUA 1L1FA 2ODBA 2VTVA 3ANMA 1PFVA 2WWYA 3F5DA 3HL4A 2VARA 1JQEA 2Y68A 3AM5A 4LDJA 5KMGB 2FG7C 2PS9A 2X0KA 3IRVA 4EB6B 1B14A 4UQPA 5EN4A 3M4ZA 1ESDA 1X3LA 3MCTA 4Z53A 3FDJA 4DIKA 2J7PA 2IS4A 4DOMA 5EIXA 2R9VA 2V6GA 3G1UA 3TZCA 2H51A 4YACA 1GGMA 2BKVA 5K8IA 2GO7A 4W5OA 1GC5A 4HNSA 4DJDC 1H2WA 1Y4AE 2GZ2A 2HQBA 1DVRA 1ZL0A 3CSSA 4AUEA 3KRTA 1CY1A 1OAAA 4PHCA 3H1EA 4L5CA 4LJ9A 1X1AA 2IYNA 2OO3A 4K9MA 1CQJB 2DAPA 4P98A 4AMBA 5KU1A 1CY6A 1N9GB 4TXMA 1F3LA 3LTEA 4TTRA 1HYHA 3M6VA 1N36B 3WL5A 3KYCB 5CNIA 1R0ZA 5ICCA 5CA1B 3EAFA 2ZSHA 3C3PA 2A5JA 4YRIA 1N8KA 2QMUA 5EJEA 1Z3IX 1ZMOA 4LBYA 4DKXA 2OG1A 3EULA 1MRNA 3SNKA 5A2GA 2NUTB 4N48A 1UB0A 2QHXA 4XRRA 4ZK6A 2CLSA 4F3RA 3TD2A 2UXCB 1O4VA 4Z7JA 4HDRB 4LZNA 1L7XA 5HE8A 3RRXA 1TM2A 2IEBA 1Z5ZA 2ZDQA 3CZ4A 3RLFA 1TYZA 3HU3A 1X7DA 2F1RA 3JQEA 3KTAB 1Z08A 4XJSA 1Q1EA 3PYMA 2XBMA 2HW1A 1CVRA 3ZK7A 2XVYA 1LI4A 3AR6A 3SYNA 5FQNA 5DN6A 2WW8A 1Z07A 5CK5A 4NABA 4DUZB 2Q4OA 5EKSA 4XF6A 2VTBA 5IM5A 2C2BA 2QQ5A 1NWCA 4BVGA 4XSVA 4WECA 1AUPA 4R7TA 2I80A 3L0PA 1QYXA 2Z9CA 5AI9A 1CRPA 1AB5A 3TE7A 3S8YA 4HR7A 4F9EA 4OXKA 4XLTA 1RT9A 2QN1A 4I99A 1QO0D 2I1LA 3S1AA 5EZQA 2PNFA 3BWVA 5ILGA 3IQEA 2C7RA 1FRQA 4OB7A 2CXTA 2IV2X 2C1ZA 4N5MA 4NH0A 1SHUX 5I7FA 1M7GA 4Q39A 4WXMA 2ASEA 2BJWA 3LA6A 4LAFA 1JIUA 1LU9A 3PE3A 5DTIA 5JI2E 1YBAA 1XMJA 4MP3A 4QM6A 1LI5A 2FOLA 3PVZA 3Q0TA 1KQ3A 4X0EA 4MUJA 4UNPA 1IBKB 3NI2A 1KE1A 4EY5A 4DT1A 2C7OA 1A8PA 2DHCA 2FPIB 3E22B 1JECA 3A1NA 4W7HA 1MOQA 1PFWA 4K3UA 4ICIA 4YR9A 2IHZA 1FJXA 2OESA 3D4PA 1BX0A 1G8YA 4WXEA 3L6EA 3ZN2A 2Q4BA 4FHFA 3ER6A 3EXEA 5EZSA 4C2BA 4O25A 5EMKA 2QTRA 3MERA 4YUZA 1PL6A 1GTJ1 1SCJA 3JWHA 3RAGA 1K89A 5DB4A 1T3SA 4EZBA 5F1OA 1JU9A 2XTZA 1NQXA 1EFDN 4EJSC 1B73A 3RM5A 1K86A 5IHXA 5HF8A 1AO0A 5TSDA 4XWWA 5AK5A 3TTWA 5IEJA 3L5OA 3EQ7A 5EJ4A 1TC2A 3MBKA 3H1PA 3T15A 3VU1A 5JS6A 3KLBA 2HIMA 2WTZA 1YZKA 4YMLA 3A4VA 4UOEA 4XB6B 4QECA 4F84A 2WSSA 4ZGBA 3SLRA 1QYDA 2GBFA 1E62A 4LN1A 1O94D 3BZUA 2GPNA 2Q1XA 2JI7A 1ZY2A 4U2GA 2OMEA 2C1EA 1F6BA 1TCUA 1NKSA 3ND5A 2FSPA 3I61A 3H3FA 1Y7IA 2W42A 1U2EA 1U3VA 1UJMA 5AVWA 3OQOA 3C3YA 3DVAA 4YALA 1X7WB 1PWEA 3T7DA 1GLGA 2ZJ4A 3G8YA 3T9DA 3PYLA 4RVGA 3EE6A 4G23A 4UHCA 1DDIA 3L1KA 1WJGA 1KI7A 3FETA 1OD6A 3OIVA 4JB0A 4QFDA 5EKTA 4AJPA 3C6BA 1CS0B 4XVUA 1EK1A 3ZWMA 3TOXA 5C3MA 4BNGA 1I3MA 1F8GA 5CNMA 3DE7X 3DOFA 1YS6A 5FFMA 3EGEA 1R8SA 2PBZA 3AHCA 3R6GA 2J4DA 3DUFA 4PQFA 1CZLA 2IYOA 2O14A 1YCHA 2P67A 4BY9E 2QAJA 4QNMA 1UP4A 5HS6A 4MUKA 3QY0A 1C0LA 3JAKB 4E2XA 5CA0F 2DERA 5HCNA 1YVPA 1H0SA 2JJ8A 3DEAA 3H9EO 3O73A 1N75A 1C0PA 2IHUA 4BRUA 1U7PA 4I1UA 1NUSA 1A77A 4KFUA 4NC9A 4P3PA 1E3EA 1GL9B 2XMDA 3EFHA 3SIRA 3PWSA 3VI4B 3Q7TA 2IYFA 1AHPA 3EUAA 3KLNA 4PC6A 5FUXA 4F3CA 1J99A 2GILA 1OI7A 2JLQA 1KOJA 4OBEA 3BDIA 2WUWE 4DMHA 4FNAA 1DMSA 3Q1LA 2A0UA 4IXMA 2PLRA 5A4MS 1Y81A 1RKBA 4DV7B 3F71A 3TBFA 3GF4A 5KQSA 3FRJA 4C6SA 1VBMA 4JL6A 3DOUA 5ELMA 1PZHA 1M67A 5TB5A 3WHLA 1KXJA 2H4ZA 3OZ7A 4GC9A 4G0PA 2OVFA 2DF8A 3KG2A 4M9UA 2ZAOA 4J49A 3T7RA 1UPAA 2JK0A 2R751 3BFXA 3KLPX 4URZR 3WK8A 4CKWA 3BC1A 3U7HB 3CLKA 1VIMA 3F74A 4EI2A 4EG8A 3NM3A 3DKIA 2ZYDA 3K0AA 2AC4A 4WEOA 2VJPA 3Q92A 1DBRA 1O08A 1WDKA 4J94A 1YQUA 3HA3A 2JDID 2B25A 2I2WA 5KEIA 3ESBA 3NONA 4KQIA 3T99A 4X00A 5B7NA 5F76A 1G4UR 2JGLA 2P2SA 3OJOA 1NIPA 1DBVO 3DXFA 1JLKA 4TMXA 4IG4A 5EUCA 4KGZA 5C8XA 3ZEIA 1U0EA 1XCOA 4BRWA 1QU3A 1XVLA 3ZDQA 2HMTA 4A91A 2OK8A 3I2YX 1AE1A 1DRUA 5FUYA 4JBXA 5JADA 2NU8B 2DJIA 2XUDA 3A1WA 3EC2A 2Q0SA 1P31A 2SBTA 3EHDA 1YDEA 1P3Y1 1Z62A 3AZQA 3D2AA 4IO0A 2HWWA 3W5IA 3C4JA 5I9SA 3PQCA 1FK8A 3WLEA 2VS1A 3X2SA 4CM4B 1O6BA 5ADUS 3VTAA 5AW4A 1V9CA 3N75A 1XWIA 1M0SA 1P45A 2XCOA 3TL3A 1QTIA 1F2TB 3CKYA 3JQ9A 4U7GA 1KMMA 4M1YA 4XM2A 4GUAA 2E4ZA 1Q0PA 3CRVA 3EAQA 3BRQA 1ZIDA 1Z38A 4YQFA 1TYYA 4HX5A 1OLUB 4ZAXA 3TWOA 2Z2XA 3IKHA 1T13A 3DE2X 4NBNA 1JEQB 3DE5X 2N47A 2X0NA 4W1QA 4Y2QA 3VR3D 1N0VC 2H48A 3Q2OA 4KI0A 4F4IA 3IQXA 2O20A 5AVZA 2X9NA 4FOSA 4AZ3B 1YB4A 4NV3A 4AULA 4DPMA 1DV2A 4U02A 3THXB 4OL0A 4ZARA 3ND7A 5CVEA 2ZI4A 1JG6A 4H6VA 1E5DA 1CF9A 1CE8A 1YUMA 1S1MA 2AUNA 2P79A 3DBLB 3DCNA 1AZLA 4P4UA 3OTOB 2I5PO 2C9OA 2JLZA 3HVIA 2PEYA 2P5SA 1ZLYA 4U2KA 4BZPA 5KJ1A 1DWQA 4GICA 4NPHA 1FS4A 3BT7A 1YRYE 3MMZA 1Q19A 1U81A 5EIBC 1ML3A 1XRRA 2PKNA 3CW8X 3AKCA 2I4MA 3P0EA 2F1JA 3M7IA 3JZFA 4ESEA 4ZJYA 1A8HA 1ECBA 1JKMA 2XH8A 4F5ZA 1SZDA 5GONA 3FWZA 4BN4A 4BQEA 1DKRA 2FPWA 2R5WA 2VYFA 1EE1A 3EWAA 4HZUB 5AKXA 5LBUA 2AJBA 4P3YA 2PKFA 4B9EA 2KBEA 5DF1A 2OE2A 3U4QA 2IPLA 1ACJA 2JGIA 4RA6A 5LA6B 5KHAA 4BTEA 4UTPA 2COEA 5JH7A 5E7MA 1XMIA 4O8CA 1NULA 3QU4A 3A6FA 3CURA 1YR9A 2P41A 3P2EA 1HMYA 1YZFA 3IQWA 3QFFA 3F9CA 3KKQA 1Q1QA 4RZUA 1KRHA 2I6XA 4U3JA 4ZV9A 5IUKC 1H4SA 1V7CA 2JFNA 3BWEA 3P0FA 5BVGA 3LKIA 2DQ4A 2Z2KA 5KNCD 3W7VA 2ZRLA 1GP2A 2D3TA 4YRZA 4Z9FA 3X1ZA 1U1FA 3G1WA 1Z75A 3NDRA 3R41A 1VM7A 5TQ0A 4DLAA 5AM3A 4LGVA 1ULUA 3CRZA 4KZPA 2G07A 3DBRB 1XTSA 4WWHA 2HA2A 4G4JA 2PRKA 3L0OA 5DGDA 1AO3A 5LB4A 1OT3A 3WSTA 4HQRA 2PUVA 1OE0A 5AVUA 2A78A 1KMIY 2JIMA 2Z8YA 3IFSA 3K2IA 4JA0A 5EQDA 5KYYA 4N41A 2EHDA 1BDBA 3BMXA 3FSRA 5TS3A 4XDGA 1PNVA 3W8FA 3U0VA 4IR7A 4CU5A 1HT2E 2DWPA 3G7SA 3OM9A 3R3WA 1JA1A 4MKZA 1QUFA 3QUSA 1WZIA 3ZVMA 3RYHA 1X2BA 2JLSA 4ZYWA 1QYRA 1ZA2A 2OC9A 5E8JA 4PAQA 1LF0A 3LCVB 4XQEA 4BNKA 2X9VA 5DHFA 1JG4A 3QJ5A 2J9RA 1VYTA 3G82C 3A6ZA 3PQ6A 1HZZA 1R6DA 2H4HA 2ZRMA 3TZKA 1ZNXA 1YZYA 2PWAA 3PRHA 1LSJA 4PQRA 4QXMA 3PFKA 4YMSA 2O54A 2GN2A 3X1MA 2VRCA 2FG5A 3IT0A 3RTGA 3ONFA 3D54D 2V0CA 3M9WA 4OSOA 3F6RA 5EE5B 1BGXT 3DC7A 1RWKA 2GAAA 3WO0A 5ALVA 5AW7A 1UXGA 4RPCA 2O52A 4RSHA 5LMNB 3USCS 3IXQA 2OZPA 3JD1A 1CUUA 3EJWA 2DRIA 2YNMA 2BFFB 3MLAA 4RIFA 5G0VA 1SXJE 1L7EA 1VKOA 1ESQA 1RIIA 4AYXA 5FT9A 1E20A 1YFJA 1NTRA 5IM4F 4MW7A 1V26A 1ISRA 1GV1A 1IB0A 2MYPA 5H02A 1G7TA 3ZDZB 3CSDA 1NRWA 4GSKA 4QEDA 3EC7A 3ZDEA 5IBPA 4EF5A 2IXAA 3ENQA 3GMSA 3M9XA 4GVXA 4OMCA 3AIMA 1EM8B 1O2DA 1SC6A 4WIAA 3KFVA 1U7TA 4MVJI 1PNRA 1JA9A 1G8AA 3RTAA 1QH0A 2ANCA 4CMKA 1X3SA 1SG0A 3AUAA 3CRW1 1FP4A 2ZI9A 1K0UA 4CQMB 1J8YF 3E7FA 4B33A 5TGZA 3TOSA 4DMCA 3O91A 2C3YA 1J2EA 4XDYA 4YONB 3VTFA 1NR1A 1QV9A 2V7PA 3R0IA 5ICFA 3V1LA 2Y0PA 1C30B 1F48A 2D7CA 3LDUA 3QP9A 3DF7A 2P9BA 2WTEA 3R3SA 4H6PA 4W63A 5DW3A 5LDDC 1OFUX 3EEOA 2G4CA 2QRQA 3D7RA 3NAZA 5DBGA 1PQWA 1I7DA 2YIVX 2ZJ0A 3IDAA 4PG6A 2BBOA 2C00A 4YJGB 3KV3O 4I9FA 1ECLA 5I9MA 1MT0A 3VDQA 3UK0A 4I4TB 1QQAA 4A03A 4GM0A 3ZCUA 4DIUA 2AFIA 1XV5A 3QKIA 2ZJZA 3T5CA 1PJCA 4KYVA 3MMPA 4C4PA 4ENSA 3N2KB 1W6UA 1DAOA 2UZ1A 4DSTA 5K5EA 1EEHA 5GAJA 3G9QA 5LYJF 1ONBA 5HF6A 3ORFA 3SS8A 1Y1KE 2ILVA 4EB8A 4NZNA 4DA7A 5ALOA 4M1MA 2JI6A 1IHOA 4OTZA 3ROKA 2RCNA 2LCQA 5AJUA 4HEA6 3D1JA 5AH0A 1A9SA 5KB3A 4KGVA 4WT7A 4BMOB 4QARA 3CNEA 1E1MA 2HNKA 4IH9A 2EWMA 1I10A 1RRPA 3HJAA 5G40A 1Y5LA 3MMNA 1X1QA 1EX1A 4V3BA 3PUWA 4WD3A 2YR0A 4JD5A 2NU7A 3ESDA 1BHQ1 1W49A 2HHAA 2IP1A 3EW7A 2M1XA 1ZRMA 1XTPA 4P6VF 2I3DA 5DU2A 5FNVB 3U62A 4Q4CA 4YXWD 2QB5A 2DU8A 3GP5A 2BEUA 3BQMB 1C0EA 3U81A 4CDRA 2NTEA 2CYAA 4ZJUA 2LPMA 2QSZA 4JOBA 3O8CA 3LQQA 2ID9A 3G9XA 1ELOA 4FZJA 1Y34E 1N2CA 3H7IA 5GZ6A 5TPWB 1M6VB 2Y05A 3T1QA 3KXDA 1X87A 1ZCFA 3I2JA 1GXSA 2QROA 3M89A 3NV9A 4FR2A 2XMGA 1QO7A 4TQUS 5CR9A 4B3XA 4AXBA 4E12A 4EW2A 1P5JA 2DSNA 2QEQA 1AKYA 1IBRA 1PX0A 4NU5A 4C9BA 1I2AA 3NIFB 5CT9A 4FYIA 4Q4HB 3DQQA 1RQGA 4LY6A 4POAA 2D0OB 1CY0A 2J08A 2IWRA 1VG0B 5EWMB 2FJ0A 3M5PA 1VE7A 2FA9A 5CDYA 4JQYA 4EVSA 2AF4C 2XA2A 2ZATA 3VJKA 1IY0A 1UBHS 3QVSA 3DLIA 4ZU3A 1YVDA 2FPLA 2RBKA 3LK6A 2H16A 3CBQA 2UVPA 3IH5A 3PNQA 2VBCA 4OHWA 5H70A 3VSEA 4FGSA 4QDOA 1UPTA 3NGXA 1ZN7A 3IPAA 4JVMA 4CZ2A 4OQEA 4REMA 3TOZA 1CR6A 4QD3A 5CVTA 5C3ZA 1UIMA 2DPGA 1CR4A 4I5EA 4X95A 1ESCA 5K0SA 1M2WA 4WLFA 1QDLB 2QPOA 3LA8A 1ZICA 3CLTD 4MP8A 1ZI8A 1M2HA 2FDRA 1MJGM 2HN9A 4RAQA 4YRFA 1NMZA 2DE0X 3N05A 1Q0HA 1VHQA 3E3LA 3KTOA 3P9SA 1WNTA 3K6SA 4MQ6A 3IAM6 1ENPA 1FUUA 1MENA 5FP0A 2GZMA 1XZKA 3R4VA 1AQLA 2IP4A 4LXIA 1MUUA 1C1XA 4MR8A 5B6PA 2XCSB 3RQIA 1NATA 3PHBE 2W6JD 3BICA 3PITA 5KYUB 4ANFA 1ZYUA 3GNQA 2XZOA 5EMMA 1UBUS 1E4EA 1XDGA 5KKCA 2OC4A 2ZUWA 1SPXA 2PU7A 2WFAA 3QFHA 1JHYA 1PJ4A 4RLSA 3G6WA 4TMKA 2WQ6A 3KQKA 3ICQB 4L8LA 1TXGA 1R7RA 4IKPA 1Z73A 2W4IA 1ZUHA 2FPMA 3FNHA 2Q8PA 4Q9KA 3L0IB 2ZDGA 4ITRC 2IHJA 4B5KA 1KERA 2G5GX 1UZLA 4JENA 1DSSG 3NTXA 2DBRA 4L8GA 3BH6A 1MXHA 4AY5A 5AHWA 1KA9H 2QP3A 2HIHA 4AIIA 4F5YA 1E2PA 4C0WA 3UUWA 3GLFA 1KI6A 2C2KA 4QATA 2OQVA 5I4KA 2RHDA 2HCRA 4OX9Y 4TLEA 3OTIA 4WZBB 4QAQA 2BGLA 2AKEA 1YJQA 1OBOA 3L49A 2ZVJA 3CVWA 4DREA 4KI7A 4RVNA 5E9AA 2BE7A 4KLNA 5DM0A 3THYB 3ZIAD 3F90A 3OC6A 4OHBA 3EOZA 3QHAA 3NBWA 2AEEA 2YXPX 1L5FA 4TXHA 1WX1A 4BMVA 3D64A 1I3CA 4GMHA 1X1DA 3MK31 3QPUA 3VV2A 2XUGA 1XO1A 4MIKA 1RHKA 2IDJA 5CYGA 4JJ6A 1YRWA 2CVHA 2JJ1A 2V3WA 4X8HA 2ZUCA 9GPBA 2E5WA 2YY5A 4OQDA 2GESA 2Z6VA 4IWNA 1Q15A 3N0XA 4OFBA 4NZPA 4IIJA 1I2BA 1N7IA 3FHLA 4AB1A 1RC0A 4LJ4A 3KAKA 4ZDKA 4AKSA 3N0WA 2AJLI 3TDKA 1EP2B 3QPVA 5HUJA 1SHLA 1QHYA 1J5XA 2G63A 3FLBA 1ATZA 2DHDA 4HOYA 3WSVA 3UPDA 4F9GA 1FSGA 1PFQA 1PBTA 2C57A 3CUWA 3D8SA 3LYUA 2CEKA 1G21E 2E3JA 4FCCA 2CDCA 1JHPA 3VYRB 4JZKA 4A73A 4AF6A 5DNUA 5J47A 4BV3A 4YRKA 2D5AA 2IOQA 1C0IA 1SQGA 3R3VA 2PNJA 3M6LA 4QG7A 4NCXA 2VYNA 5ESXA 4AKHA 3T9AA 2H5IA 2Q5EA 3OLWA 3PC8A 4LXQA 5F9MA 5L6MB 4YJ3B 4IJWA 5LN1A 1KVSA 3I23A 3UCXA 1VE6A 4G5YA 7REQB 1DCTA 1J4AA 4OOEA 5B4TA 1UAAA 2GZ3A 1P6UA 1RMQA 3JQ6A 5HKAA 4DS3A 1TZBA 1G55A 1R9NA 2WLSA 2REQB 4F45A 5HQTA 3VYVA 3IIIA 1UKAA 2CJFA 1OV6A 3UJPA 1U8YA 3H0EA 5JRZA 2PK3A 3LU1A 2BZ0A 3IOEA 4G25A 3IO3A 3RJMA 4C7BA 3UUEA 1QM5A 3SYLA 1L5OA 3Q98A 5GQSA 1TA0A 3H2KA 3A1EA 4G41A 5AVVA 3PEUA 2HFJA 5AW6A 4AICA 2BLLA 3AQIA 3K8OE 3PC6A 4GZ5A 5AKHA 5IDYA 3FUTA 3S4YA 3RC8A 2XHEA 4S1MA 5CUQA 2R00A 2X8BA 4BZWA 4EO4A 3WLFA 1PLJA 3GN1A 1Z7BA 3QU9A 2EHJA 3HCPA 1IJEA 3H6GA 1X8LA 1XRLA 1Y1PA 2KW5A 3CPSA 3PI6A 4HH0A 4Q1DA 4ADSG 721PA 4DC3A 1RKAA 4G0NA 4ND8A 3AIKA 1G2PA 4FFOA 5HRUA 1LZLA 1NQ5A 2HK7A 3A4IA 4LJ8A 1TEXA 2F48A 1Q0ZA 2XDQB 4C4ZA 1UMCA 3JARA 2AI2A 4NOLA 3WWDA 1QX4A 2PFSA 5DV9A 1UFRA 2JAXA 1S3SA 2FLKA 5D3KA 4J1TA 3WBFA 3ZC3A 5FD8A 3TTSA 2B78A 2QJFA 4NOKA 3AKEA 5JRDS 3AM3A 3R3HA 2WVJA 2QRKA 2VJLA 3SEAA 4YQYA 1XDZA 4D80A 2WIDA 1RHRA 3U9TA 3SKVA 3MS4A 1XTTA 2FZWA 4E31A 4N76A 4QKQA 1QGDA 4F9TA 5L3VA 1AKWA 1Y42X 3NNSA 1XZLA 1FU4A 1YDWA 3O9ZA 3PDWA 3OZSA 2CJWB 1WXIA 2QN6A 4HP8A 2NV2B 3LL4A 4R6WA 3F8SA 5EMLA 4QTTB 1KTIA 3RVPA 2GDZA 1JR3E 1Q7RA 4J43A 1Z6GA 4UPDA 3RRBA 2XT0A 2YUIA 4B46A 5CLJA 4XM0A 4O2AF 1XCJA 4HBZA 4YAJA 3E9EA 2X23A 1NW9B 4KDEA 4QWWA 5F33A 2WKRA 1LV7A 2W83A 2A5LA 3CPEA 1ETHA 1XRNA 3LWDA 4N47A 4EJ0A 2VBGA 4A0RA 3D1VA 4LJ6A 2BEWA 3I83A 4ZVUA 4GI7A 2ESRA 2H65A 1A2BA 4JLDA 5K4HA 5FOTA 4YWJA 4QGSA 3DBOB 2HZBA 1JXOA 1J39A 2EC5A 1PN3A 1T5BA 1U65A 3L2OB 3R23A 4PYQA 3R7DA 4E22A 2EJWA 2FK7A 2OM6A 3GGSA 3DDSA 3FCXA 4WNCA 2P2GA 4DCMA 1OYVA 3K5HA 4CMJA 1S8OA 2FPRA 1I0ZA 2IQIA 2P4EA 3D0QA 2CHVA 2O2YA 3EN0A 3FFBA 3OIFA 3TM5A 3QVXA 5FEUA 2NP7A 3WMRA 3ZJTA 3RUCA 3CJQA 4CDMA 2J9GA 3UFXB 4M55A 2WZCA 3HZHA 3K6KA 4A2PA 1LNSA 1H8HD 2C2ZA 1U1EA 4QFBA 2IOFK 4DDKA 2LNDA 1E7WA 4V0MA 2H7XA 4BMNA 4EG1A 3RFCA 1NSTA 4EY8A 5DNWA 3A0RB 4I46A 4RJJA 3S81A 3FJ1A 1J0CA 4FWBA 1TUBA 3MTJA 5TR9A 3QX8A 1UMBB 2WT4A 5K3CA 1Z06A 2D4AA 1VG8A 3DZKA 3JQ9C 4KQXA 4PN7A 1M6WA 2JANA 1PQYA 1ITZA 4Z0PA 4MKFA 3WNDA 3WTBA 2W6CX 3BB3A 2UV8A 5T64A 4X1OA 1RJ9B 3QKTA 3ZVKA 2PUWA 4XYMA 4DABA 3AL3A 2AWOA 3GEDA 2HLHA 1FFCA 4D92A 2PMDA 2GUGA 4X71A 2EBUA 3SD7A 1RXVA 2Y1KA 4YK7A 3TR0A 2RI6A 4P81A 5FOVA 3OUTA 2QMYA 2Q5HA 4OA8A 3ZU5A 5JSHA 3AVOA 2XA9A 1K06A 2WEKA 3B1NA 1Z25A 4K8PA 2IY9A 2X1VA 4GOND 4LJLA 2G17A 1CRLA 1I1NA 1B00A 3E82A 3PXAA 4LRWA 1BGWA 3N07A 3ZWCA 4UCWA 4Q1EA 5BNWA 3CR8A 2FPPB 3DOHA 4AWXA 4DL9A 5KQRA 1V9SA 3H2HA 4K6GA 3UB3A 3VKFA 3W1VA 4QDIA 2G76A 1P0QA 4EF4A 3FWNA 1JB1A 3RVQA 1PQPA 1NVVQ 1OBVA 2HRZA 2LKCA 2VSOA 3PXUA 4C4TA 1ID8A 2JJYA 1UOOA 3DCIA 4JYPA 3AERB 1EUDB 2WNIA 2VBIA 2C2GA 4BGVA 1O5TA 3BFVA 4GYKA 4I3HA 2VTDA 3Q15C 3OTGA 2I0FA 1DO2A 1LNQA 1Z39A 3LFHA 3OP4A 1JBQA 4ZAWA 1IQPA 5FB3A 5FWYA 5JQGA 3KJIA 1D2HA 1U1CA 3AY3A 3OLVA 4DCUA 3H9JA 4AJNA 1HEYA 1RJEA 1FFYA 4X7MA 1PGPA 5CX1B 3UGJA 1IXKA 1KQOA 3RTDA 2WA2A 4FYJA 4I4NA 4J1QA 1J22A 1TYEB 4C1NA 4DT1B 4J0FA 1WXHA 1OI4A 1YDHA 4ZVNA 4R0NA 4DNOA 5IZ4A 4H17A 1MX5A 2PLWA 1MHPA 1HYGA 2P27A 4G9GA 4GR4A 5H83A 2UZAA 3RK4A 2R7KA 1I3OA 1MB3A 2PZLA 1FFWA 4QUAA 4S24A 4AMZA 5JXJA 4BKRA 5INTA 1EJ0A 1JJVA 1NOIA 4NL4H 1FSFA 4BAZA 1TVKA 1ZHFA 1BHJA 2G7MC 2WK1A 2HNBA 4TXJA 1EFKA 3W6UA 1KIAA 4D9CA 2A7XA 1IUOA 4X6UA 5F2OA 5FPTA 2XQGA 1OZAA 1OXVA 4K0RA 1S89A 4E8YA 3QH4A 2C88A 4HNQA 4J16A 2Q07A 1HT1E 2GF2A 1VP9A 1XCLA 4UBOA 5JNWA 3NASA 1SHKA 3AM4A 2YASA 1QH1B 2YZ2A 2F43A 5GGYA 3TQTA 3G59A 5EP1A 3MLBA 4ZYUA 2BFBA 2PKXA 1FP1D 4B2YA 2X86A 1O96A 1FVXA 5T7BA 1XZCA 4LISA 2BBSA 4XKJA 1NN1A 3RTEA 1YOVA 4IF4A 1OXMA 2P2NA 3DTVD 4IIHA 3OOJA 1GA4A 3B9QA 3T0GA 4R71A 6ABPA 3DL2A 5B1DA 1SRQA 2ZTSA 1YHYA 5AI4A 3O92A 3TN7A 3UUFA 5CYOA 1SKUA 3VHQA 1V8OA 4EPXA 1QVZA 2AOVA 2WYHA 4TLLB 5EHQA 5ITVA 3FZYA 3KUKA 3LRXA 4PCAA 4U7DA 4CUJA 3D7KA 3KQNA 3NUGA 2WNHA 4M53A 2YY7A 5G0UA 1L5YA 1KKLA 2GNOA 2ISSD 3ISVA 1ZRSA 2OZVA 4O2AA 3WXBA 4HQOA 4I4TF 5BP7A 5BN3B 1TQ2A 2WIJA 3BFPA 3KVNA 2YNMC 4ZTZB 1FBNA 1BN6A 2FP4A 3OIDA 1H2RS 2XAAA 1NRXA 4ZYTA 4ZT2A 3PRYA 4UBIA 4CM7A 1MQSA 2YCLA 2NO0A 2GAJA 5G2OA 1Y1LA 2WFZA 4Q03A 5CAEA 3ZD7A 1ORDA 4HJXA 4HNUA 4ROTA 2VNAA 4DGQA 1KDTA 2RFLA 3AWIA 3JR7A 4UEKA 3MWDA 3AUUA 1LIOA 1BCRA 3W8RA 5FWDA 3Q10A 3P27A 3C85A 2IC5A 1E0KA 3MJCA 5ETJA 1V3QE 4EGFA 1B2LA 2Q4DA 1B76A 3IBYA 2J3HA 3R3ZA 2UZIR 2AG6A 2C98A 3QTLA 1NAHA 1Z0ZA 3P94A 3H13A 3J81k 4TOIA 3WYGA 3ZJ4A 1L7BA 4FT2A 1BS2A 2VTBB 1U6JA 2QTZA 2I7VA 3PFGA 1WB4A 1U2RA 3DXXA 2PT6A 1VP3A 1ZA1A 3KXPA 4OD0A 2DTEA 5F4BA 1N8NA 4TT3D 3IPRA 2FSGA 3HBNA 3D4NA 4MGHA 5ERGB 3TRKA 4TSFD 1LBEA 1TLLA 2JAPA 1UQTA 3A04A 3EH1A 1RFLA 3K8QA 3OG9A 5DSTA 1KJWA 3QJGA 2BCJQ 4QM7A 2ZRKA 4P33A 2PZ8A 3IJPA 4PG5A 4DEXA 2IYUA 1G5RA 3NTQA 3FVWA 4ITUA 4NOMA 1IN4A 4G5HA 4JLNA 4AF8A 4C7XA 4XASA 1QC5B 3KETA 5EKUA 3NAGA 2OBMA 3VJMA 1KSGA 5AVYA 2XZTA 2JLXA 3AI1A 1XOIA 8LDHA 3OIUA 5K8UA 1E1CB 3VTKA 4EJMA 2PLFA 4HTAA 2OWDA 3O0TA 5D84A 1KSJA 1VECA 3P19A 1T8RA 3T6KA 3OCYA 4B4KA 4ZD6A 2VJBA 3MF4A 1ZUNA 3N2EA 3OETA 5JZVA 1Z56C 2VHXA 3L6UA 4V3CA 2GPSA 3BRCA 2GZHA 1VL1A 2AZ4A 5DYGA 5I4IA 3P7MA 3JQAA 3HA2A 1BWRA 2QYSA 2DY1A 5C40A 4DR5B 5T8KA 2GI4A 4JLPA 3FSJX 1FDOA 2TMGA 2J6IA 4TQ9A 4OF4A 4R8LA 4KTVE 4BB6A 1L4MA 1Y9AA 1LW6E 1DJMA 1VHDA 4HNAB 5MF6A 1MVNA 1V8BA 1G66A 2CYBA 1Q7GA 1JHZA 2X2EA 4FN5A 2PYZA 4G0QA 4UU8A 5KVQA 1ZUD1 2DKOA 2ZM6B 2DC1A 4EPTA 2W2PA 3LWNA 2E0IA 3ZIUA 1HLPA 4UVIA 2PMCA 2O1EA 3RYFB 1UBSB 1SCQA 3UK6A 3T5BA 5IXSA 1QZ3A 4L50A 4W9MC 1GEEA 1VJDA 1IB6A 3NYQA 1ECGA 4G36A 4I8DA 3QBTA 4CLEA 4KO1S 4RPIA 3ZLJA 1LX6A 1RE0A 2HIAA 2CY0A 5A4JA 3DTYA 5IJ9A 4XFJA 3A2MA 1XLVA 4URHA 5E6SB 1KU6A 4BBZA 2QZ9A 4ZCLA 2JGDA 4ZOBA 4KQ2A 3NNDA 4AY4A 3IUNA 4F11A 1NMSA 2JAUA 1NA5A 2RAUA 4GPZA 5EP4A 4DZTA 4JH0A 5IKOA 5F1PA 4F5WA 4ILEA 5TQIA 2FFJA 1XF1A 2E82A 4ZVTA 1ULHA 3Q7EA 3DZVA 1B41A 1NU6A 1EVZA 2AQIA 4WXHA 2FY8A 3EZLA 3VVMA 1E1LA 4P92A 4ZI5A 4HB4A 4EHLA 1P7ZA 4XAQA 1LLUA 4U6SA 5CP8A 4L5AA 3GQBA 3TLGB 5GONB 3I8OA 3OVMA 1T2UA 2ERCA 2F2TA 2J85A 3HKDA 3JQPA 5CAEB 3T9BA 2FUG1 4A8TA 2VWHA 3AQ4A 5B1YA 5K6TA 3B38A 1KF0A 3H2ZA 4GMGA 4CR7A 1UBEA 4C6TA 3C43A 4FW9A 2ARKA 5JAUA 5JH7B 1ZBQA 3CT4A 3RBXA 5L95A 1S8AA 4N5LA 4LFCB 3SXJA 2C5AA 1EBFA 1K8QA 3G9TA 4OHMA 4MX8A 3Q40A 3RRFA 4Z7NB 3SKYA 1MC8A 3ROEA 1BMDA 3HMQA 2PBLA 2UVDA 4JGGA 2XSZD 4DB2A 4C0LA 1F4VA 3WOHA 1CWUA 5JJ5A 1P9OA 2FH5B 1M6NA 4RV4A 4Z1OA 4IH4A 3UATA 4X85A 3JYHA 5JOQA 1CX9B 4DR7B 2XOKA 3KPJA 1NXQA 3NCTA 2ZYTX 5BWOA 2PSSA 4C87A 5BMVB 4M87A 3PL1A 3T3NA 2QMQA 2FW9A 1OUMA 3CO5A 3LVFO 2HSDA 2M1ZA 1ILWA 2BUBA 1QGYA 1YULA 2VEOA 1ZD3A 3TLAA 1YZTA 4UPEA 5KYTA 3OEHD 4LF7B 1COWA 5ALFA 1XFAA 1N2EA 3NUZA 4GXRA 3T34A 5KYYB 2VJOA 3R0XA 4HX9A 4C0HA 1JILA 3OLYA 3M5DA 2XD9A 4RKYA 1IK6A 2AFHE 3E15A 3BMOA 4AZVA 3L0YA 4MRRA 2PKMA 2FUEA 1EUCB 4OIFA 3MS7A 1DELA 3GFOA 3RYHB 1GL6A 3FPKA 4CT4B 5C5IA 5KYNA 2YXUA 5ABPA 1G8PA 1KPIA 4HJRA 5K3AA 1AS0A 1JJIA 1RWOA 4LF6B 4CIDA 3P0IA 2F55A 4YRNA 4C20A 2C96A 4HDCA 4ONEA 3WGYA 1IZ8A 2QZJA 4FCWA 2AG1A 4HVCA 4R0MA 3T12A 2FCRA 5G0SA 1D6NA 1EFRA 1K75A 3HU5A 4CTMA 1KDPA 2A88A 4M37A 5B4UA 5JATA 3VOSA 3WGMA 3EGXA 3G8DA 5BV8A 3HJUA 2BGNA 1NNI1 4KYIB 5KQLA 5DTEA 1L8LA 5HTKA 4R83A 4FB5A 1B6RA 1HOXA 3LW7A 3D02A 1X39A 4R16A 4ZEXA 1ZLXA 1NF3A 2ZQYA 3DO5A 5AOAA 5EXSA 5FBWB 1CT9A 3FKQA 2CLDX 3PDIA 3OZCA 3B2EA 4RTNA 4UMFA 1BJTA 1IZYA 1UODA 2AIRA 2ZBRA 3SS7X 2B1QA 1ISMA 3P20A 4PNZA 3SGLA 5FA5A 4RWEA 1CK4A 2GZAA 4EHBA 1DKQA 1J2JA 2M9MA 1VA4A 1XT6A 1YA8A 3WJ2A 1QIGA 1Q7EA 3S44A 2WHQA 2EFEB 1G6OA 5D86A 5HQJA 3DFFA 4UC0A 1G19A 1V48A 2AN3A 2GJ9A 5DT2A 5FOQA 5FUBA 3BZWA 3AG6A 3RVLA 3PQFA 4ITVA 3UANA 7GPBA 4KBGA 1CB7A 2SKEA 4WY5A 5AR1A 4ZQFA 4F4HA 3RABA 3CNBA 5E7QA 4BGEA 1FNSA 4DVJA 3FUXA 5B64A 1XQWA 3KJHA 3NM5A 3O4FA 2IH5A 3SPXA 3LHXA 1TYBE 2QK4A 4X1YA 5D5QA 2CE7A 3WYFA 1BE0A 2OBBA 3OLCX 4IZIA 2I4LA 2I6FA 3QI2A 4WA8A 2EFGA 3PC8C 4NYIQ 1UAGA 3BD7A 4FMDF 1UDRA 2BGJA 2J59A 1SD1A 4NU0A 4PO9A 4EW3A 3V3TA 2HQ1A 2RHBA 2ZRQA 2EW2A 1JDPA 4O4HA 5ILOA 1KC1A 4PCUA 2FRVA 5DWQA 4GSYA 1JX6A 1NQVA 1TJ3A 2X6QA 4M1TA 5HMLA 3ULKA 1I7QB 4E07A 3K0SA 4FFLA 1K97A 2VSYA 5JXHA 1NUQA 4ALKA 1IEQA 1QFYA 1W2HA 2VWQA 4ZAZA 2PM8A 2O1WA 2AFIB 1G3UA 2NO4A 3IL2A 1IONA 1R8YA 1VOTA 3TSYA 5FI0B 3WB2A 1E3TA 5IC4A 1VLMA 1OREA 1PFKA 3CTMA 2BZGA 1Q0QA 4K86A 4A82A 1J24A 4P3XA 1NV8A 3HRKA 1EQUA 4MRPA 2DDWA 2GAFA 1NLMA 4ZT6A 3MMXA 4LZAA 1D04A 1AC5A 2C8JA 3GJ4A 1YI1A 2QAGA 4ZRMA 5TMEA 1JSZA 4BLUA 3SVZA 4ZICA 4QUEA 1S01A 1X1TA 4JXKA 4R40A 3R5KA 4PLTA 1EA7A 3PTZA 4W7SA 5GINE 1GQSA 3CGGA 5F0ZA 1KYQA 2IZ7A 4OI0A 2GBCA 3ZKWB 1ZZGA 2B0CA 3AJ8A 4MQMA 4J4BA 1JBWA 3LOQA 4DN6A 1VE1A 2OECA 1W7AA 2AA0A 1V3VA 3KR0A 4J1TC 2QRUA 3L79A 2PX8A 3MW8A 2AR7A 1S3FA 3ANLA 1YZLA 3BXFA 4G0ZA 4EYQA 2QN8A 1P80A 1R4AA 2VYCA 1E58A 2WABA 3L06A 5P8WA 2XWQA 2NU7B 4E5VA 2B1RA 4MNTA 3OFSA 2QTGA 2QLJA 4J2TA 4PZUA 5JWHA 1CU1A 2FCAA 4WN9A 5EIBD 4OQ4A 3VISA 4C07A 1FYDA 2A9RA 3IAXA 4IIEA 1R1DA 3AEQA 4N3CA 5EG5A 3RB8A 3RV3A 4N5HX 4AZWA 2XYQA 4MYRA 1YGPA 1O5OA 3RWOA 3ETHA 3I3SR 2XE6A 3LKVA 3OH8A 2DG2A 3EIQA 2X15A 3IEVA 3EA5A 2TS1A 3WV5A 2PZJA 4OEHA 2GJSA 2OORA 3LAWA 2WIFA 4FI3F 1CUEA 4KH1A 1R6UA 3TNLA 3FZQA 4GRDA 2BHSA 1SA0A 3I9KA 5EYPA 2NTNA 3B8EA 4S0XA 5B1EA 3LQFA 5DYNA 1YVRA 3HVKA 4JX9A 3ZZTA 2JLUA 1KVUA 2HQSA 2YDYA 3DBHA 3K31A 4ACAA 821PA 4BE7B 1QVAA 1TKAA 3LJKA 3P9CA 1NBMD 3WLPA 4NBTA 4OU4A 1UEIA 2O59A 1LSUA 3NU1A 4ZO7A 3CEHA 3T95A 3BJRA 2C5BA 2O0HA 1AXEA 1BROA 3QA3E 3WR5A 1B23P 4TXNA 4RVDA 1SVWA 2IUEA 1JDBB 3WQQA 5CFRA 3E23A 3JS5A 4NXMB 3TGLA 4EHHA 3BTSA 3ODPA 3GEEA 1K2VN 3PX3A 5E0OA 3B6MA 3I05A 2ZULA 2H9IA 1ZFNA 3OFKA 4BO1A 3AW9A 2DDOA 3HV0A 3PXCX 3A58B 1YTLA 5K3FB 1XXHB 1FYEA 2JGAA 3S2ZA 3K6SB 4REQA 3KVOA 1MMFB 3W7AA 3H6KA 3W5SA 5EY5B 4UBMA 5EJ5A 4WFJA 2XBLA 3B1QA 3N2GB 2GSDA 1C41A 2RH5A 3ZOKA 5TT0A 4B3RB 1P9RA 4V1CI 2XV1A 4HFRA 4KQ9A 4P4GA 3NBYC 3RC3A 3AONB 3DYBA 4G8DA 1NKVA 1YS2X 3OZDA 3B1XA 3SE0A 1E4EB 4I55A 1Z2NX 1A5TA 1H3FA 3GAFA 1TEHA 5C8ZA 2IK8A 3ED1A 3PZBA 4CM9D 4LJ7A 4LF8B 2X6RA 3DNPA 1WXGA 3U5TA 1UIRA 3DZDA 4B8SA 1DXQA 3BKWA 4Y6QA 5EPUA 4YGYA 4AJKA 4KVFA 4XJTA 1FRFS 4QTUB 3GRFA 4D8YA 5U4QA 4YRCA 4FJ2A 4X93A 4NRDA 2FYTA 4P4SA 1UK8A 1PYGA 3V4PB 5JEDA 2OYSA 5DYWA 4HB3A 3GLHE 4BLOA 5TT1A 2H0RA 4C5CA 2Z30A 2PSHA 4Y6OA 3U4GA 3QYJA 2FE4A 2PCJA 2PANA 3P4YA 3EZ7A 5H68A 5D3MB 5B58T 3TQIA 4RZIA 3RRJA 1QAQA 3EWIA 2CUTA 2QYHA 4DA9A 2OBFA 2WJ3A 4BP1A 2JIQA 3I30X 3WDMA 4EEXA 1N5KA 2DBZA 4YMUA 2HDHA 3HSSA 3IEIA 4EJ6A 5CG2A 2HRDA 2RGNC 1N5JA 1YNSA 4N54A 4AO8A 4L16A 4MYHA 3G2MA 121PA 3V6LA 4Y2YA 5T5QA 2XKAA 4KPYA 5LB2A 1NNUA 2B4QA 1QMPA 3BEOA 3ORHA 5FPYA 3WE7A 4EG3A 2QY6A 1QG4A 1SCUA 3CEAA 4TRRA 4HC4A 2EQAA 2IUTA 4JUIA 4GWGA 4XEHA 5HUQA 1WO8A 2WVGA 5IX8A 1VDZA 5E1BA 3KAJA 1BFKA 2QTFA 4TVKA 3UTDA 1L5NA 3RT1A 2DSTA 3FHCB 1KK3A 5SICE 4IIJB 5IKMA 1KFEB 5AW5A 3FMPB 3BRSA 4LCEA 4EGSA 1ENZA 2HHCA 3F4BA 1GJRA 4H1WA 5KOHA 2WFMA 3P9QA 3ZEAA 1HDGO 4ETMA 1XTZA 4L7VA 1BH2A 3B1JA 1XSEA 2W6QA 4ZVMA 1YQQA 4Y6GB 4MQLA 5AFSA 3P2KA 3VYWA 3FUCA 2ERXA 2GX6A 3PEFA 2IU3A 5TXGA 3SHFA 3HB4X 3RM3A 4FQ5A 3ICCA 1ZK0A 3TUIC 3CLUD 4UEOA 5DP2A 2XMZA 3CH6A 1D2MA 1TMYA 1NFRA 2JJ2D 1RRGA 2QI9F 3IDQA 4TTPA 5K6AC 5KWSA 3SVTA 5FOSA 4Z0HO 3AR5A 1A71A 4OHYA 2OFFA 5COJA 1V3UA 3HM2A 3JWPA 4YT4A 1R4ZA 3FB4A 1DQPA 2MSNA 2X4LA 3PXBA 3BD6A 4TWRA 4NF2A 3BX1A 1Z4NA 1HV8A 1D1TA 2JFHA 5DRTA 3WFJA 1QP4A 4MJ7A 4I50F 1ZHHA 1VCOA 1EJ2A 3T7JA 2CMHA 1JEDA 3OOWA 5F12A 4CUKA 4F21A 1EFVA 1Z5UA 4WK4B 3U3OA 1ZO8A 2E87A 2ONYA 5T67A 1UP7A 1N6RA 4C4RA 1R6VA 2BEVB 1RACA 1M1NA 1QRDA 1EI9A 1VPDA 3D6FA 2VPTA 3QEJA 3ZKAA 4XYEA 3NANA 1FSZA 3RE1A 1D09A 1T4GA 2V5VA 2H2WA 1D0VA 1T0UA 3A6DA 3WGNA 4F56A 4XLLA 1AN9A 5J5AA 3QXCA 4LOLA 3ADOA 1NVXQ 2QM8A 5HWSA 4B8ZA 2PRZA 3DLPX 2HMSA 4D3ZA 5A9SA 2H52A 1KQPA 4J7CA 4B3FX 4YRAA 3PCRB 1B74A 5BSEA 1G5IA 5EUMA 4BE9A 5JD5A 3QV1A 3NGMA 3DQPA 3HL0A 3JARB 3JQRA 2QLMA 4BP9A 1E9CA 1KJYA 1H8ED 4KZKA 4I1PA 1UC9A 3FNQA 3IOBA 2VF5X 5IUJC 4KQ1A 1YS9A 4JBGA 5EERA 2PGNA 2GH1A 4NY1A 1E2EA 2WD8A 2XY4A 3GD5A 4QU0A 2IS2A 3SAJA 5LQRA 1MCZA 4JP3A 4DQ0A 1A2KC 3HR7A 4NZYA 1Z8NA 3SEQA 3U3ZA 1MTOA 4R84A 1TQ6A 4UCFA 1UWKA 5BNFA 2BCEA 3UHAA 1A96A 3FN4A 3T4PA 4TWJA 1NMXA 2IYSA 3ZHYA 2ZJ5A 5CMLA 1HDEA 5EQFA 3EXFA 3AY7A 4OQPA 5EZYF 3ZWAA 1PZEA 4O2BF 1SELA 5KSZA 3OURA 4W5NA 4WDRA 4KGDA 3ABRB 4QYXA 4Z2YA 1QP0A 2NP6A 2LZ0A 1R50A 1A88A 2OCXA 2WHYA 5MGBA 3G89A 1L6RA 3W6PA 2D4HA 4KE9A 1OYWA 4E8WA 1OIWA 1JHAA 2GYVA 1CP3A 4KN9S 3CZ5A 5EQTA 3VVBA 1SZJG 4K6CA 4BFLA 1PBNA 2YJTD 4HG2A 4PZ0A 2PT7A 3BCRA 5EQJB 1N2XA 1DQRA 3VPBA 4NE9A 1QH9A 3M2PA 2Y99A 3IA7A 4FSHA 4HSGA 4MVJF 4OBBA 1BQ3A 1KYVA 4R4JA 1E2FA 2QJOA 3LC2O 3V55A 2WTXA 1JLLA 4D9FA 1YCGA 4R8KA 1PFYA 2W2VA 3NORA 1Z82A 2XCTB 3PL2A 1XRQA 4DEVA 5IWCA 2EZTA 4JT4A 4NIMA 1I1OA 1CNFA 4AMGA 2O5RA 1U11A 1YBMA 3DO8A 2Y1EA 3PHCA 5KSPA 3JTEA 1ZMTA 1GUFA 4R2HA 2PWYA 3CYFA 1M66A 1M1ZA 2CK3A 2NV0A 2SHKA 3OZFA 2Q7DA 1H3NA 5H5JA 1XPOA 1YASA 4PNPA 1J5PA 3CKKA 3X1KA 4E84A 1Z8FA 2ZCVA 1JKXA 1E94E 3G0DA 5KHLB 2AVNA 1MBZA 4ZOAA 5JJIA 1S8NA 1DCMA 3PRJA 3LZDA 4GBMA 1V1MA 5LKAA 3WGTA 3Q7QA 3D6UA 3T4XA 2QXYA 5EJ7A 4MI9A 4Q9HA 3ZWDA 5C7IO 1E8CA 1OZFA 1GDTA 3OBBA 4Y1EA 3I58A 3RUIA 1COZA 4LDPA 4RZ3A 4B4OA 4E5PA 1QF6A 1YFKA 3SHWA 2P1ZA 3ESXA 5EMHA 2QYOA 3DL4A 1YKSA 4FD3A 1XYGA 2IIQA 2G09A 4B3IA 3DMNA 1YJAA 4AUMA 4BZQA 3H5VA 1FFHA 1DEXA 2V8BA 4N0PA 4RPKA 5DN6D 2ZJAA 1FL9A 1MF7A 1MRZA 4OHRA 5HJ5A 5C53B 3IN1A 2GK6A 3NT5A 5IYZA 1O8BA 1YUBA 3BGDA 3OOHA 1G20E 2W9XA 4M8IA 8MHTA 4S04A 2PQ2A 4TV9A 2Y0EA 2PT9A 2ALJA 2VAWA 4X8LA 3KWLA 4RC9A 2Z1NA 3I01A 5BMVF 4OI1A 4DARA 1A3CA 1SC1A 2YXLA 4DLBA 2PIAA 3HM9A 4A92A 3C1TA 4MROA 2VL7A 2AI1A 4MPJA 3S2EA 4D3SA 3W9YA 1X14A 2EIHA 3ICWA 4OOFA 4UHDA 3ZCRA 1OLOA 3WICA 3JALA 2VPYA 4HNTA 1EHCA 4HFMA 2WY2D 1CV2A 2W71A 3H5LA 1EUYA 4NULA 2X5KO 4ZT7A 4JYZA 1NUPA 1K68A 1V9LA 4CM3A 3REOA 1E5QA 4BGIA 1V0JA 4HRAA 5DX0A 3WS7A 1GUYA 1X8XA 3F3MA 2HA7A 3KDSE 4JODA 4YAEA 3D7NA 1G18A 2EKQA 1J06A 1JQAA 1TCCA 2P9EA 3BB4A 2NVBA 3RJZA 4F7DA 2ZBQA 1OJ7A 3PNLA 4R8MA 3ZWNA 1JZSA 4MWEA 4HRXA 2CD7A 1RABA 2VHYA 4IZHA 4PZCA 4WZAA 5HIJA 1HH4A 4RFLA 5E4FA 5FWYB 4I50A 3WIVA 1UBMS 4Z1MA 5JQGB 2ZIGA 3Q7IA 3EVCA 4M86A 4O08A 2F02A 1DBPA 2NVUB 1SURA 4QREA 4Q82A 3EGOA 2EV9A 4GYWA 3N2IA 4MW1A 4ZOLF 1R10A 1ZXLA 4U7FA 1DU4A 1WPQA 5IN5A 3LFTA 1JYSA 4KGXA 5GM1A 3QU2A 5C35A 2WYUA 1Z2PX 4N3AA 3PUZA 2ATXA 3N0RA 2GB4A 1X77A 2ZEJA 1E1DA 4HAYA 1T24A 1TA9A 1U98A 3G2IA 2MDTA 1O7JA 4KNWA 4G0VA 4JUDX 1DX4A 1DQYA 4DIBA 3WKAA 2Y3IA 4YJ2F 1CC1S 5E4TA 1AKVA 1M5UA 1Z4MA 1OWPA 1TVKB 1UFQA 4NZZA 4TTJA 2FZGA 4BV2A 4FZ5A 5BOSB 2FMHA 2CCKA 4EYOA 1REQA 2FW6A 2JCVA 2FSHA 2OV2A 4RANA 2V6MA 5HIMA 1KWGA 2XNHA 1ZPDA 1IM2A 2FZVA 3T94A 2N9UA 2QW0X 3HNOA 4K7JA 4PIPA 3G0HA 1TMKA 3K9NA 1TM5E 3R44A 4BEJA 3KELA 2HRBA 2O4CA 3OICA 3EGVA 3KSRA 4EY7A 5JROA 1NBHA 4QRDA 2VXBA 2F43B 4PYJA 2BFBB 3AR7A 4L8FA 1FQWA 2O2XA 2D8MA 2B7BA 3IVAA 4AG3A 1IN7A 3LF2A 4EHIA 1R6XA 4F97A 2KX7A 1VL6A 5DOZA 2ZSAA 1ACLA 1Z0FA 2B8WA 1FDIA 3TS1A 2W4MA 3FLEA 1RBZA 3BMQA 4WJZA 1L1RA 5EZYA 4MQFB 3V7NA 2FN3A 4G0WA 3OQ6A 4O2BA 1IM8A 3LWZA 1NURA 3H19A 5JNLA 2QBYA 4D26A 2IGBA 3IAS6 3GMTA 3F6PA 1HURA 3LYAA 3UW3A 1SNYA 1ZOOA 3NTUA 3A4YA 2HFKA 3VSDA 4H59A 1NOKA 5J4VA 4P0QB 1DAGA 4AM8A 5FFNA 1J1UA 3BDAA 3M9LA 2PX5A 3HJHA 1C50A 4K9DA 4CR6A 1T3ZA 1SXQA 3GUVA 2CJYA 1RKDA 2R7MA 2ES4A 1PX2A 1J9GA 1RM5A 1Y48E 3ZM5A 1BFDA 4ZHQA 1GFIA 2WT9A 2GXQA 5AVXA 4MVJA 4IHJB 3T3GA 2QN2A 2X0EA 2RK3A 2ZI3A 4GYYA 5D7NA 2JCYA 2FU5C 1M2OA 1M8FA 3FKSD 1Q1ZA 1MH1A 1QR6A 2ABWA 4O59O 5HGJA 1YGYA 2YXTA 2NU6B 4MA0A 1EGHA 1T2CA 1XF9A 2RB4A 3VC3A 4LRTB 4F46A 4QDUA 4RKRA 4HPXB 2LIVA 4QODA 1GG9A 1D5CA 4B6SA 1P1KA 3UJNA 2QD5A 3LUGA 4WVFA 3G8CA 3OSUA 3P2YA 3DXZA 4U7JA 3AVVA 1P74A 4Z0TA 2GJKA 1WOYA 1Z2DA 3FHXA 2PXXA 4YRTA 2VR1A 5DHUA 3O1IC 3V48A 4ENQA 2K7ZA 2I6UA 3GLSA 4XB1A 2PUCA 4P53A 4YREA 3U4CA 1EWTA 5I9IA 4LMBA 1RYMA 4XUCA 3JQFA 3ZDYB 3SCZA 3MD0A 3ZDRA 2HHLA 2ISCA 1R0XA 3VNUA 2PRIA 1I1HA 3QF4B 2IHNA 3NC2A 2FFBA 2FXIA 2RGYA 1N6PA 3QA9A 2A30A 2XADA 3PC2A 4R1PA 3RNOA 1AHHA 1C8BA 3H4MA 4BGDA 3AXTA 2NAFA 3KT6A 2XR1A 4OYYA 5EEHA 4ZYYA 3TL6A 3AY0A 1QHEA 3H0CA 3EGDA 3SJUA 4BKQA 4Y9TA 4EX6A 4G8BA 2GC6A 2O5VA 3I2IA 4L5JA 1P19A 1DAPA 2QAGC 2WD7B 3CZRA 3OIYA 4IKOA 4EOGA 3ZGVA 3H42B 1Z17A 1C0KA 1KAGA 3DPUA 3T41A 4LXYA 4IG9A 2M6KA 4KAJA 3F7NA 4ZI3A 1VDMA 4O3MA 5FORA 2VT6A 3T3EA 5EHGA 3BAFA 5LZ7A 2JA2A 3UGQA 4PAGA 2OA0A 4XW2A 3FJYA 4MCAA 3BL5A 1VGQA 4AQDA 1DKNA 1W9MA 2NYAA 4YMIA 2FWPA 3D59A 3ZDDA 1R5OA 1JVSA 4PNEA 3C4VA 5IAAA 3HFJA 3M4YA 3DBIA 2XRYA 1RRCA 2ACKA 1S1CA 4L9AA 3EW9A 1QZXA 4M0EA 2LR0A 1JHDA 1FEZA 2Q3BA 4HMOA 4Y8VA 1GN8A 3PFFA 1Q0RA 3GIDA 4C22A 4D0NA 1A1VA 1IIBA 4EITA 2H1WA 3HV2A 4XGKA 3WYNA 1VPWA 3QPWA 5D00A 5TLSA 3BBLA 3CISA 4OPMA 5BR4A 4LOAA 1C3EA 3EVTA 4CWAA 2FZCA 2OORC 2P6UA 5EZ5A 3KE9A 3K9FC 3QG5A 1W48A 3MAJA 5B36A 1S2NA 3FJOA 1NLUA 1C3QA 1THTA 2C7VA 2QNIA 4IIGA 2PGAA 1SUFA 3D0RA 4HHEA 4DUYB 4PGHA 3OKAA 4ZOLA 1ZMXA 4NG5A 3EOBI 3QVJA 1Z6AA 5TNXA 1F5NA 3Q5EA 3RIGA 5J58A 2IZ5A 4BRSA 4EVRA 4AX8A 4WESA 1FZQA 2NXNA 3K9LA 1CZKA 3HY6A 4MUNA 1TF5A 2H06A 2E55A 4Q7LA 1ORTA 1KGDA 3DWEX 4W6QA 3GQBB 3FPEA 1DAHA 1U8TA 3NHUA 1VIVA 3AL2A 4K6MA 3HKDB 3HP1A 3D2BA 3L7CA 4ZOEA 3VV3A 3VU8A 3MJDA 4Y0NA 3A6PC 4JA2A 5BV2P 2FMTA 3DDNA 1NJ6A 5EWLA 4M0DA 4K1LA 1M2EA 1FZTA 4YJ2A 2YOHA 4OHKA 5MN6A 5A3RA 1JFLA 3HEBA 2PE5A 3CMCO 1EK5A 4XWGA 1PJ8A 1E2HA 1DRVA 5IC5A 1BMFA 1KEVA 3FH0A 4HWSA 4Y2VA 1V71A 2Q5IA 4I9NA 5D6OA 4TV8A 4DIDA 1N9KA 2KJQA 1C3VA 3IPCA 1XCMA 3K16A 1G7RA 1QPBA 1NI4B 3LPMA 1AG9A 4B3GA 3PL5A 2YCBA 3AUYA 5D1HA 3CNOA 4H35A 1M0EA 1XHFA 3PKIA 2I87A 1ZIXA 3T9EA 2OHHA 2ZROA 1OR8A 2GN8A 1SBHA 3L0ZA 5JJCA 1QANA 3ICEA 1EWQA 4KXUA 3NJ8A 3ZQJA 4UDYX 5JSQA 4GAEA 2G40A 2WLTA 2BUAA 4ASUD 4UM9D 1NXTA 2IHKA 3RSOA 3HNRA 1QGOA 2FR0A 5DASA 1T2AA 1S2IA 1Z0KA 3NH6A 2EXXA 1ABEA 2YHSA 1XZHA 4GLOA 5T6BA 4EHJA 5BXYA 2H4FA 3VZQA 3AM1A 5K0TA 4MRMA 1Q14A 1Y3FE 2IH4A 5FDFA 2GNPA 4MVWA 2QLBA 4X54A 3VR4D 3JYOA 1UJ2A 1RJGA 2VP4A 2A1UA 2VRCD 3LD9A 1PZXA 3R6WA 1UXIA 1F6DA 3RT9A 2RIRA 4LXTA 5FOUA 4C5AA 4I36A 4KLZA 3S8MA 1BDHA 3FF1A 4JI7B 3ERCA 3SKXA 4X66B 4MWBA 3GVIA 3HDYA 2EJCA 3MEQA 4E70A 3SXPA 3H97A 4LY9A 1QSGA 1WUYA 1IBLB 3AI3A 2JKZA 2O2CA 3K0FA 4BYGA 1XL1A 2YNMD 3E61A 3H5NA 1Z68A 4OK3A 3ZNPA 4POOA 4XQ9A 1JJAA 1ZM3A 2P3OA 4GGPA 4WY8A 2B94A 5K99A 2J8ZA 2RJ3A 3RUDA 1M2NA 1Z12A 3UWDA 3DOJA 1NVUQ 4ODIA 3ZWVA 3N6VA 3TLKA 2PKQO 1C8LA 1CD5A 1B8NA 1KZ7B 1M0TA 4EMBA 4CTJA 1RXUA 3PDIB 1A04A 1JZQA 2OHGA 3IMFA 4GGMX 2P9ZA 4QQFA 2NXWA 4FMCB 3WRXA 4D4JA 4F3NA 4D9NA 3EPRA 5CB8A 5IT5A 1ZMBA 1ISFA 1U9ZA 3DGEC 2ECFA 2H31A 1OBFO 2AFBA 2KQUA 3E8MA 3U56A 3SFZA 1IXYA 1LDGA 1TQ4A 5KAPA 3T61A 3DPIA 1V16A 4FQ7A 2ACEA 4LVCA 4S1WA 4CM8B 4HGPA 4HH3C 4BE4A 2RHOA 2YRFA 1F4LA 1CPYA 1YVEI 1GAJA 2ZI6A 4IOLA 4KX5A 4NMWA 4BLVA 3PHJA 1RYZA 4J3JA 1V1RB 1XZIA 4AW9A 4ETNA 4YDSA