3RRBA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with amp
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 177
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrbA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrbA02
3LOOA 5BYDA 2AWDA 4EN4A 1RKSA 3RSFA 2I6BA 3B1NA 3RSGA 3DZVA 2A9YA 3VAQA 3Q1YA 3HPDA 3NBVA 4UBEA 3ZS7A 1BX4A 1RFUA 4S1IA 2VARA 2FV7A 3NCAA 5EYNA 5TRWA 4E8YA 1YHJA 2HLZA 1TYYA 2AJPA 2AJRA 3KTNA 3RQ6A 3RPHA 1LHRA 3RT9A 3UMOA 4C5KA 3UQ9A 2DCNA 2PKFA 4O1GA 2YXTA 3W4SA 3Q92A 4K8CA 3KEUA 3RY7A 3DRWA 3HICA 3RQ8A 4B8SA 4E8WA 1V1SA 4E3AA 4X8FA 4EOHA 1EKKA 4LCAA 2QHPA 3I3YA 3NM3A 3IE7A 4C5NA 2ABSA 5C41A 3PL2A 1YGKA 4LBXA 2A9ZA 3BGKA 3NL5A 4K8PA 2JG1A 4GM6A 4K8KA 2DG2A 2R3BA 5CGEA 3UQEA 3NL3A 5TQIA 4E8ZA 4C5LA 3RPZA 2HQQA 1RKDA 3CQDA 2NWHA 1UA4A 2R3EA 3B1QA 4U7XA 3RQQA 3ROXA 3RQ5A 3RQHA 1V1BA 2F02A 3NM1A 1LIOA 3PZSA 3D3KA 3RTCA 4XF6A 1VM7A 5F0ZA 3RRJA 4YWRA 4EBUA 1RKAA 3NBWA 2ABQA 2PKKA 5BYEA 3NL6A 2C49A 3B1PA 3RU2A 4S1MA 4XDAA 3RNOA 3NL2A 3UQDA 4JKUA 3RM5A 2O8NA 2QCVA 3HYOA 4K9CA 4DC3A 3RT7A 4S1IB 1L2LA 2AA0A 1C3QA 3RQXA 2JG5A 2Q5RA 5C3ZA 3RSQA 3RTEA 2PKMA 2PKNA 2JGVA 3B1RA 3GO7A 5CGAA 4DU5A 3NC2A 3RSSA 1JXHA 3GO6A 2AFBA 3MBJA 3K9EA 3GBUA 4KALA 3ROEA 1ESQA 3JULA 5COJA 1EKQA 1KYHA 3MBHA 4PVVA 3UBOA 1GC5A 1RFVA 3K5WA 3OTXA 3IQ0A 4YL5A 2YXUA 5F11A 1LIKA 4LBGA 3IBQA 3RRBA 2XTBA 4K8TA 3RTDA 4K9IA 3QA2A 3ROGA 3RO7A 4C5JA 3RU3A 2C4EA 3LHXA 3ROZA 3RTAA 1LIJA 3EWMA 3NC9A 5BYFA 1TZ6A 5C40A 2F7KA 4N09A 4O1LA 4WJMA 3H49A 3RRFA 1GQTA 3QAIA 3RS9A 4K93A 3FHYA 4S1HA 4XCKA 4JJPA 1TD2A 3FHXA 4KANA 3RO4A 5C3YA 4JKSA 1RK2A 2AB8A 4B8RA 5B6AA 3UQ6A 3LJSA 2DDOA 3RREA 3KZHA 4XF7A 1TZ3A 3IH0A 4LC4A 3UMPA 1VK4A 5EY7A 3RTGA 4KBEA 1LHPA 1ESJA 1UB0A 3RS8A 2AX3A 3H74A 3KD6A 4C5MA 3VASA 1V1AA 3D3JA 3BF5A 1WYEA 3N1CA 5CM5A 2DDMA 2V78A 1DGMA 1V19A 4KAHA 3IN1A 4E84A 1LIIA 3LKIA 1VI9A 4N08A 2DDWA 4KADA 4EUMA 3B3LA 3B1OA 1JZTA 2I5BA 1RFTA 3RQ2A 2I6AA 5BYCA 3IKHA 3RTBA 2RBCA 4E69A 1U2XA 1JXIA 1YGJA 2HW1A
chains in the Genus database with same CATH superfamily
4RKFA 3K2IA 1O6CA 1O94D 2E2WA 2NZVG 3R4VA 2IZ6A 4I9GA 4Z86A 1GV1A 1TM2A 4KQMA 4MW5A 5HKKA 4TN1A 1GUYA 2DHCA 3TTUA 2Q28A 1R0XA 1A1SA 1XRQA 2XF2A 3FYUC 3SZOA 5BVHB 3NAQA 2K2WA 3ER9A 5BUZA 4QEDA 3SSMA 2FG7C 2R9VA 4CMEC 2WJ6A 3OIYA 2FWNA 4GMGA 2ODEA 4HCJA 4U2CA 5DBHX 3VNBA 1XNQB 4HPJB 2VT7A 4EITA 1R6VA 5KYTA 4XIJA 2EF1A 3G3EA 1KPGA 2JHCA 3LCJA 2EYQA 4ZT3A 4JI6B 4OJYA 3ZXSA 3RRXA 3H6KA 4PG5A 1Q1EA 3LKDA 4V39A 3ROKA 1TM3E 2WVHA 3NLLA 1B0UA 4H3HB 4WT7A 2H9IA 3EVNA 3HSYA 5LSAA 1Q57A 2FEAA 2QLTA 5EMLA 3DE6X 3DZKA 3HR8A 3NKFA 4ALMA 4BV9A 3R3XA 2PJUA 5JSHA 2JGNA 4KXLA 3J80A 1IY0A 4ISCA 4H18A 5COAA 4AKHA 2DFDA 2EL9A 1GRNA 2UXCB 3IO5A 4P35A 3NT4A 2HNAA 4HC4A 4YAOA 2V55B 5FBZA 4ZICA 3ZV7A 1Y4AE 4AZSA 3NVDA 4RTNA 2QHPA 1NYLA 1XDGA 2IWHA 4CKZA 4PHHA 4AP5A 3IUSA 4B3HA 4K2HA 2PPVA 2Q8PA 1JG2A 4ZVRA 1U6IA 1W6RA 4R1QA 3AF3A 3RYFA 3J7AC 2I1LA 3LHFA 2AJDA 3O4FA 2FDXA 5IDWA 1HYBA 4O63O 3IIIA 1GZVA 1X42A 4AULA 3V1LA 2C8VA 4O29A 4KIFA 5BSHA 2UUAB 5GM2A 3BXPA 2RAFA 2JGIA 3FMOB 3PC7A 3R5TA 4NLLA 1EA7A 3L7LA 1T0BA 1NI4B 2RGRA 1JR3E 1UBNA 1JFSA 1G5FA 1SKUA 2Q2OA 1G7SA 1L5FA 2YN2A 4M0KA 3CG4A 3WBFA 1FRVA 3D8RA 1G5RA 1PNTA 1TCBA 1XL0A 1PX2A 1YAJA 1NBAA 1NMSA 2C92A 3O75A 4DV0B 1IN6A 3DP7A 2JLSA 1JT9A 4K2AA 4DG5A 5A2QA 3PEUA 6REQA 3NHUA 2CMHA 1IZ8A 3NDJA 1LIKA 3W5DA 1WO8A 3DEKA 1TJ5A 3FZQA 3PC6A 5FO1A 3VNUA 1NM5C 1YZUA 3GDGA 4D8UA 4RJTA 3AU8A 2DC1A 1Y4UA 5FOXA 3E22A 3ROZA 4A27A 4C2UA 4W4TA 3IR7A 2WZQA 4CHGA 1CF4A 1ZJ4A 2G9RA 1T1SA 1JIXA 1MLDA 4L0CA 1X7ZB 1Y1RA 7REQB 1M6YA 1TZKA 1WMDA 2JPDA 2VUTA 2ZUUA 3BMCA 2FFAA 1YULA 1HE3A 1KO7A 2AQIA 3CTPA 4N76A 2Q0HA 3N86A 2HPAA 1N2IA 1ADCA 2REBA 4LECA 5B12A 3PXCX 5HYVA 1OPRA 1GZ5A 1RM5A 1NLUA 3DKRA 1H66A 1SVLA 1T13A 2G17A 3NQ41 4R1OA 4CM7A 4E7OA 5FEUA 5KCZA 1ULZA 2EHJA 3DEIA 4OAPA 3LT0A 3BE8A 4PN3A 3BE5A 1O5TA 4FILA 4BPBA 3L7IA 3U4QB 1DFIA 2VYQA 1M2EA 1QBKC 4EGFA 5FUBA 4ZOLA 4B2YA 4F9GA 3N8KA 3QLTA 1Z5GA 4FYKA 1PUXA 2ID8A 3Q9UA 1QQ5A 1L7XA 4QHSA 3FCAA 2FJPA 1ARZA 1Z8NA 2A14A 2IP1A 1H1DA 2OCYC 3W6ZA 2W0MA 3L7NA 2R6HA 4D9FA 4IXTA 1TKBA 2FCAA 3ZR4B 1A7AA 3N6RA 2BGTA 2RIPA 3A04A 3HTXA 3RVMA 2VQDA 1JDTA 4PR0A 4HEA6 4BZPA 1GAWA 4KNWA 5E7QA 5LMCA 4B2PA 4YECA 4D82A 3IO3A 4IICA 5T3UA 4H16A 2CLOB 4JI7B 1JEJA 3T9CA 2ACVA 5KOIA 1R4ZA 4MR7B 2J0EA 4N48A 1OOEA 1USVA 4J1TA 4NDZA 5K5EA 1OILA 2FDRA 4UBOA 5I7FA 4ZVPA 4CI0B 2MYPA 1OE0A 5DOVA 3SDZA 5KU7A 1M34A 1L9XA 2L42A 1GV0A 3FYTA 4GKJB 4EI2A 3CVXA 2EKQA 1PBTA 1N2CB 1T8YA 3DL2A 3HCDA 4NK4A 1QG4A 4YDRA 4KR6A 1YRLA 2ZP1A 3E8XA 3JAKB 4TMVA 4INAA 4R8MA 2CLIB 1P7ZA 3HFJA 4XAQA 5EJ4A 1KRHA 4RTRA 1YQEA 4B5LA 2J3IA 2D1TA 2ZVPX 3HRHA 4HGQA 4LSZA 3BD9A 3T4PA 4PYIA 2VATA 4MITA 2GD1O 3BDIA 2MU1A 1JS1X 2J5RA 1DJLA 4XYBA 2B94A 2VZ0A 4KXFB 5GMOA 1N2HA 5T8KC 3UCFA 2FHPA 4R9RA 4ERXA 4EG1A 2Q5JA 1NFRA 2WOOA 2ZE6A 2XUGA 1K9VF 3AVQA 4TXNA 5F98A 4C6TA 3U17A 3QVSA 4JB8A 1SUBA 3B5JA 5DWVA 1EXWA 4IIFA 1QRAA 1KC3A 3DAPA 4YWJA 1CUZA 4DMFA 3WLHA 1QHEA 5HM8A 2XUKA 2H48A 5KDLA 3UKJA 1YQGA 1X70A 2GZMA 3KVNA 4MYDA 1CZLA 3LYHA 1KNQA 4ZHSA 3GFSA 4ZPXA 1J49A 3V7YA 1ACLA 1VPEA 4Q4AB 5L51A 1CRWG 1J0CA 1ZM7A 2HHLA 4RZHA 4HL6A 4B6GA 5DHUA 2ZSHA 5DGIA 5CB4F 1VA4A 4QTZA 3WGHA 3ORHA 3AETB 2C99A 3PRYA 5FR2A 5K8IA 1EHCA 3SBEA 2CXQA 3DLCA 3DKVA 4MV9A 2H0QA 1NMYA 2CNDA 1WMAA 1CJCA 3BH0A 2PNFA 4DQLA 4FIZA 1I94B 1TCCA 2XTBA 3F3KA 1GLVA 2HWXA 4PLZA 3OM8A 2VRCA 4O5OA 3SC2A 2YY5A 4HYTA 1ZICA 4HX2A 3VKVA 3W5UA 1DRKA 1Q74A 1QUFA 2ZRNA 3LT5A 3LVFO 1ZNYA 3I2JA 3PLNA 4Y1RA 3ZIDA 1ID1A 1P3Y1 3NATA 2VOEA 5LQUA 1MD9A 4UVIA 4YO7A 2C5AA 1CC1S 3SXUA 4BMZA 4LCEA 3CO0S 4M21A 3UUEA 1JU9A 3E53A 4KSBA 1Q2UA 4LY3A 2ZI5A 3NORA 4WLEA 3WK4A 1M0EA 4ENPA 3BMQA 5A3VA 1ISHA 3IKJA 4WZ6A 1SEVA 1HMPA 3TQIA 1TD1A 3C5CA 3QE4A 4JP8A 4PBRA 4ZD6A 3KTAA 3I8SA 1VQ1A 2XD4A 3GAAA 2E82A 4HQ6A 1YZFA 3PU6A 4G4GA 2Q5CA 1F4PA 5LLTA 1GDHA 2GK6A 2V7EA 2XYPA 2WB2A 1XEFA 4MAAA 1K7FB 5ISMA 3HB0A 3R44A 1W35A 2QVGA 2R8XA 2WIJA 4PX2A 4D8XA 4W8OA 3IN1A 4J2HA 4CM5A 2PM8A 1VKRA 4HFRA 4ACAA 1IJEA 4E3WA 1RLMA 2BR4A 1TW3A 1MBZA 2VIIA 2XA9A 4CCSA 2ZSDA 4D3ZA 4OHCA 3RODA 3UUFA 5IAJA 3WB9A 4ER3A 4F11A 2BZ0A 2J5XA 2NVWA 3BXGA 3Q8KA 2BC9A 2WSBA 5I8PA 1DG9A 2W2TA 3LYLA 3WDKA 3N2AA 2ZJ2A 3G13A 1DWPA 2F6RA 3EFOB 3FNEA 1KE2A 1W1IA 1TTQB 3ZS7A 2OCLA 4HNVA 4UEJA 4ZWNA 3V7NA 4X61A 3CLVA 3PNPA 4ZREA 4DLXA 2FN3A 4NMLA 4D3SA 1PR5A 5HA5A 2BH9A 2P91A 4M46A 4U7TB 4D02A 2XCQA 1Y3IA 4EHIA 5JJKA 4N12A 5DTMA 4EO7A 1JDSA 3CNEA 1KJIA 3JD0A 3M5PA 3BVPA 5KTTA 4O4JF 3X1MA 3KJHA 4TLCA 3NEJA 3MGAA 4H1UA 3ZQKA 2VEOA 3QLEA 1D7AA 1ISRA 1VMDA 5KKAA 1FMFA 1IBRA 1H6AA 2BEVB 3KZ1E 3UQYS 4L7VA 4R1LA 1X74A 1PJQA 2GBFA 5G0UA 4ZVOA 5A5FA 4DC0A 1Z56C 3KT6A 4LJRA 3NHSA 3RS0A 1ULBA 2A57A 2X40A 1OGJA 1ZXLA 2P62A 2PCJA 4G56A 5PNTA 4DXHA 3UQZA 2JLXA 1TDJA 2VORA 2ZEJA 4Q5IA 1SUAA 1IZZA 1FVHA 1TCVA 2QKYA 2PUAA 5GOTA 5KIAA 2Y9MB 3C3KA 3R0XA 1MZVA 2IYWA 1ODKA 1GPNA 1NXPA 3KAPA 5ECDA 4EPXA 1AKQA 2O50A 5A3QA 4JLJA 2C49A 4CXMA 2X2OA 2Q5IA 1B73A 2A5YB 1JI3A 2Y1WA 3CT4A 3CR7A 1R0YA 4B8ZA 2GJ9A 1ODCA 1TVEA 2IUEA 1Y5NA 2HIGA 2PBLA 3K0AB 3ZDYB 2B3TA 3T99A 4TL8A 2BGGA 3OU6A 1X6VA 2NMVA 1Z5OA 3HWX1 4TWZA 2GA9A 2VWQA 1GL9B 4FBGA 2H1OA 3SZMA 4L9RA 1DXQA 3U16A 1IDN1 4F6CA 3A2KA 1LD3A 1QG2A 1R88A 1M75A 1Y8QA 4MAMA 3N87A 1ONOA 2CE2X 5C8XA 1T2UA 2G9ZA 3TTSA 2H51A 2OCBA 2W11A 4A1OA 5IHPA 1QZZA 3G7NA 4E5VA 2VTVA 3KKMA 3RVKA 1CUEA 1TOAA 1UC4B 5SZKB 3IHTA 4BNUA 3QF7A 4Z53A 2AN9A 4GW3A 2AG8A 1QVRA 4W5OA 1GZ6A 3VAZA 4QUKA 4CMAA 1TZ6A 4O5AA 2UVPA 2F4NA 4URXR 3D5EA 3ZDFA 4DA9A 2H00A 3HY3A 1JEQA 3IFSA 1VE6A 3IA2A 1BFKA 3OEHA 4M0CA 4MLZA 4FCVA 2Q2WA 4O6VA 3ROPA 1R6BX 1NFFA 1US8A 4NZPA 2FGKA 4PNPA 4TMYA 1SXHA 3DFFA 3OEYA 4ZOAA 1XCMA 1U7HA 1RRCA 2PKCA 3IV9A 4O2AF 1O89A 2A88A 1V96A 1RQGA 4AD8A 4N0PA 1XN1A 2PQ6A 4BKUA 5FOSA 2V7VA 4PLPA 4JXZA 4HQKA 2EP5A 2J5KA 3VI3B 3LBFA 2V6IA 1TUIA 3DTVD 3NRSA 3P20A 5AW4A 1NPYA 1Q22A 4ZYYA 2ZAOA 1AKUA 3C6BA 4X91A 4ALKA 2LWIA 4H1VA 2O54A 3VV3A 1K8ZB 2RBCA 1OR8A 5HF8A 3AUAA 4AUEA 2BJHA 4MW1A 1BHJA 4KDFA 1EJ2A 2X5JO 4E1VA 4MUXA 2V7QD 1RVDA 4HI0E 2ATIA 3RUFA 1Z6GA 2RGNA 3NBVA 2X77A 4BUCA 5JCJA 5C4IA 2D0IA 5D5QA 1SZPA 4LYAA 5DX1A 4JT8A 2B1RA 2VDNB 2YVQA 1CNMA 3ZBUA 3E8MA 5E95A 5TSDA 1GPKA 1ISIA 1EFHA 3LO5A 4FOSA 5FIUA 1EE9A 4MULA 2MSWA 3C5HA 2PNJA 1MENA 3ONWA 2V4ZA 4PLWA 1VJGA 1PR0A 1Z2EA 1E1MA 3VPHA 1WTCA 2X3YA 3AVYA 2BDEA 2QN6A 2PKXA 4IIVA 1UBLS 5BOSA 4F4DA 1DIBA 1QCZA 4JEHA 4BQSA 1W5BA 3E4CA 3QJ5A 4AZ3B 4F3NA 4G1VA 5FYQA 1JSLA 1MB4A 1XK7A 2BMWA 2EJUA 2PWYA 4V0OA 4E14A 4EZEA 3V48A 1C0PA 2G82A 5JD4A 4I4TB 1NY5A 1TMKA 1G3MA 1BVRA 1AF4A 1E7MA 2EG9A 1LQ2A 4L4UA 2FFHA 3CSSA 1QYCA 1XEXA 3IHLA 4NX2A 4AL4A 3HP1A 1U0LA 1PFWA 5AOVA 1L0BA 5IUJC 2ZTSA 3IJRA 1VJ0A 3VUEA 4AW9A 2QZZA 4MNTA 3DV0A 1PR1A 1UMKA 3PHCA 1K75A 1SCUB 3HUUA 4QNMA 3W7VA 3UBMA 2A7QA 3FBWA 4FIDA 5EJIA 2WABA 3ES9A 5FO0A 2ZI4A 3UYLA 4CLRA 5K3OA 1TJYA 2QMYA 3SJCA 5JD5A 5F2KA 1JHMA 4IIHA 2GCAA 1UAYA 3SNKA 1YBVA 4MUNA 3SZRA 5C8YF 1MRSA 3RNLA 1G4UR 5J1TB 4BIIA 1XPRA 4CR6A 1RCFA 4RXTA 5GQSA 4B87A 4L6AA 1IAQA 1J7KA 1U3VA 4IL5A 3H6HA 1SM4A 3VR3D 3RVNA 1IQPA 1SA0A 3W6NA 3ZN2A 4EHLA 2QVBA 3W5VA 1Z6QA 2B69A 2VDWA 3CRQA 2OA0A 4B3XA 5F1PA 2GHRA 2Q3EA 1SCBA 5EMNA 1U0GA 3KTDA 4BO8A 4EJSC 1WDWB 3OAAD 3BCSA 4GI3A 4R16A 2ZAIA 5TPZD 5A1TA 3PEWA 3QE2A 1G9TA 3D1JA 4FN4A 2YZ7A 1D03A 1CQJA 2Y4OA 4EJFA 4TS4A 1O97D 2QR3A 3TX2A 1F2UB 1GNVA 1JEDA 1KOLA 2HU5A 4H4CA 4DB4A 4JI0B 1CIJA 3H4IA 3R0VA 2UVDA 4X6UA 3B85A 2XUQA 3HEBA 3ZBQA 1GP2A 2X0EA 4NHEA 3LUBA 2CNOA 5ESWA 2P3OA 3DZIA 4E13A 1PYDA 3CLUC 5TGZA 1WVIA 4M6WB 3V7FA 3U3KA 1QR6A 4O25A 2HPHA 1W44A 3KS9A 3DTTA 2B2NA 2RI6A 3CPEA 1PT8A 2EFCB 3LM8A 3RF6A 5LZ2A 4MUJA 1F5NA 4S1WA 2XDQA 4GRIA 4RM3A 4ZCQA 1PKXA 2BGMA 2QVYX 3OE1A 1IH8A 1IHDA 3MG9A 1WLYA 4BVKA 2B7LA 4L6IA 2PRIA 3AUYA 4WADA 3UWKA 1BSVA 4E11A 1X9IA 4BMSA 4EFLA 3MCZA 3MA0A 4KQ1A 1JQKA 2M98A 1Y1KE 3GLHA 4HTAA 5AT1A 3OCXA 4GU5A 4ARZB 2IYAA 4DSOA 4BJ6A 5EN4A 3ZDQA 5BVGA 5JBQA 3DEFA 4ZK6A 1LPOA 1QGOA 3C3DA 2QDXA 4BBJA 4XDHA 1CE8A 2B2CA 4YY3B 3QKIA 4BKMA 2EG5A 5CDFA 4F4UA 1T6NA 4R5MA 3U4HA 5KQSA 4RXMA 2BE7A 4BNKA 2AMLA 2CEKA 4FR5A 4RA9A 3DPSA 4BBAA 2JJ2A 2O8FA 2JGRA 3M70A 2C04A 2ZB7A 3OZDA 3VHRA 1A98A 1DWQA 2QLLA 1Q0SA 1UIRA 4JNKA 1MO6A 2XVZA 3M89A 4M3NA 4NYIQ 3NMUF 1EP2B 2LE0A 4FT4A 1N0UA 3SKVA 5HPYB 1TIPA 3HK2A 2OB2A 1KYIA 2P4HX 3WOVA 2XXBA 1H2EA 2FUG1 3RRMA 5AK3A 1ZD5A 5HKBA 1E1CA 3T9FA 1T5DX 2GH1A 4C12A 1GGMA 3H1BA 3CVUA 4K9OA 3OMXA 3JASA 4MJLA 3TTYA 3EOBI 3H9EO 3ED5A 1R37A 3JQ6A 1JHPA 3LNCA 3EDRA 5JPDA 2DQZA 1TK2A 5JDCC 1KQOA 4BQRA 1BMDA 1A9TA 4TTRA 3NM6B 1QOPB 4YALA 1ZJYA 3R40A 4DIBA 2BEUB 2DECA 4CF7A 4UZEA 3S44A 3NM1A 1X77A 4RVGA 2QRMA 3X1JA 2DEUA 3K4PA 3EEFA 3FPCA 3NXKA 4NCIA 3L1UA 4L4XA 3E1KA 4Q9DA 2QAJA 3C3BA 3TZBA 4MV1A 2FW9A 4XDZA 4W5HA 4CQMD 2BM8A 4UQOA 2XYQA 4M1SA 2ZZMA 2H06A 3I73A 3K3PA 2GS9A 3Q41A 2BFBB 4XGRA 3AI1A 3QE3A 1VCNA 2O5CA 1PT9A 2FQXA 3WKDA 3ZK9A 1L5HA 1T0HB 1WPRA 1KS9A 2O7RA 2YRXA 5H02A 4FGSA 4I14A 2HEGA 3MJ4A 3SR3A 5LLDA 4AKGA 1PK9A 3EIUA 4E5KA 3N0RA 1LRLA 3M1IA 1E5XA 3QLVC 2YNMD 1Z18A 2EQAA 3HI4A 3OIWA 4MLDA 4RH1A 1JJ7A 4D26A 3ZCVA 1NVXQ 3RVOA 4KVGA 4N0QA 3HFGA 2QIOA 2GPSA 2GF0A 2HJRA 1NSTA 4IIBA 4ALJA 2VYVD 2BFPA 1CUAA 2Q2NA 3HDTA 1VBKA 3I9V1 3ZW8A 3CS3A 4AYXA 5A9RA 1QP7A 2ZB2A 1H8ED 2BCJQ 3B5IA 4HTFB 4YUWA 1TMOA 3CXUA 4OI1A 2KHZA 4S1VA 3TR0A 2G9NA 2WYVA 3TQOA 3AW8A 3DH0A 4G63A 3FD8A 4ZDWA 1PW7A 3NTOA 2DR0A 1Q20A 4RDXA 1Y3AA 4D9MA 1KBOA 1C3LA 1KETA 3FKJA 1T6BY 1MVNA 3U3DA 3EGEA 4NY1A 5C5DA 5AYVA 4YRAA 3BAZA 1J21A 1ISGA 1XAGA 3IL2A 4R1PA 2JAXA 3RYTC 4H7JA 1DAKA 1NVVQ 1RAAA 1Z4QA 3MBIA 2PK3A 4IDOA 3BRQA 3OOEA 1N1DA 1RZRD 5CB4A 2GCOA 2JH8A 4XFJA 5KYVA 1HDEA 4GL4A 1L5GB 3R7WA 5EGNA 1D1PA 3WGKA 3O92A 3VPGA 3AOEC 5IWCA 2OYCA 1OC2A 3QJYA 3ZEAA 3HN6A 1QBGA 2DTEA 2CLDX 3CRZA 3QVWA 4NJEA 4E69A 3J7TA 3R3ZA 2FR8C 3ANYB 3O8RA 5TF0A 1KP2A 2IHNA 2XIJA 1QO9A 3FF4A 3LPCA 3DWFA 3QUSA 2I6BA 5ILGA 5D7BA 1RMQA 3LKBA 1DUVG 3JW8A 4M87A 4NCJA 4ZPJA 2G40A 2YY7A 4EL5A 2QAGA 2WF8A 4Y9UA 1KR2A 2EZUA 2Z2KA 1AF7A 2RAUA 4KJZA 5FWAA 1ZEJA 2CDNA 2PT6A 3K5PA 2I65A 3RIEA 4ZRDA 3BSFA 2Q6LA 3TW6A 4A4DA 1EXNA 2REOA 2HDWA 3ANXA 3GEHA 3NFYA 1HDOA 1M5TA 3UF0A 4XKJA 3SBDA 1CDOA 1VG8A 2YXTA 2BEWA 1IUNA 5BVGB 3CNQS 2F7SA 1UJBA 3FNRA 1KAGA 4FFLA 1KZHA 3QJGA 1C50A 3HICA 3RY7A 1CE8B 4E8WA 1RDFA 4LZAA 3GVIA 2VO1A 2QN1A 1M72A 4UBMA 3LA8A 4AVYA 3CRRA 4LOJA 5EZ5A 1NF2A 3TZLA 4DLPA 4IF6A 3R5JA 4J49A 4RD6A 2O8FB 3NBXX 3USES 4FN5A 1YH3A 2EW8A 2P69A 2XQGA 4GX1A 4AJOA 1P2DA 4OMFG 1TM5E 2PANA 1OV6A 2OMEA 3PVCA 4L9WA 5EWMB 3L6DA 3CX3A 3G5MA 3W6OA 5CDHA 3P9IA 5E2BA 2ECOA 5HK9A 2NWHA 4U7XA 1E1CB 1P2VA 3JVIA 1QAOA 3QVTA 1G16A 4DXAA 1E92A 1XLWA 2Z8YA 4YONB 2HBYA 4R0VA 2FOXA 1SVMA 4CLDA 4ZVVA 4EUHA 1LSOA 2X0RA 3KR9A 4HS9A 1KJ8A 3ANMA 2WKRA 2HWWA 4KK3A 1HDIA 2HLHA 3DPIA 2ZAGA 4S1MA 2CFCA 4QOJA 3U1TA 2ZB4A 1SBHA 2BFDA 2XT6A 3GD7A 1T2CA 1U5AA 1MGOA 1YCDA 3M6WA 1H2YA 1KMHB 3DFZA 3Q1LA 3TW4A 3UT5B 1FFXB 2PUHA 3W90A 3H75A 3ZZTA 1KI6B 3UA4A 3NONA 3GNSA 1N7IA 3IMFA 3QTLA 2BGWA 1QDLB 3ZZUA 4UM5A 2DF8A 3W04A 4DUGA 3BGSA 1VMAA 1NIPA 2WPNA 4O4JA 2GPBA 4WV3A 4DU5A 4EA7A 1II8B 1VPDA 1UF9A 4X66B 3ICEA 2XNDA 4ZXPA 2P1ZA 4EUNA 1W88A 2JFNA 2C4VA 3MOSA 2ENWA 1KYQA 4ZVMA 3IH5A 3Q88A 3KQWA 5DU2A 4P8RA 3I0NA 3OEED 4BQFA 1MQ8B 1N1EA 2CUTA 1L9KA 4K9IA 4OGKA 1KVUA 1HDYA 2XMSA 1SIWA 2J0UA 3AUTA 4K6HA 5FPHA 2JHAA 3IDSA 3T5TA 4C01A 4PZUA 2HQ1A 2D1QA 4E88A 1GEEA 2C3PA 2Y0DA 2C2GA 4LOHA 3GEMA 3H6GA 2YDXA 4JBLA 1MIHA 3IPLA 3H2YA 1E3LA 2VI5A 1KJYA 1CVRA 2H29A 3BUSA 4JA0A 4BP3A 2RKBA 3AEUB 1CZRA 2PL3A 2H2WA 2UYQA 3W3AD 2GN9A 1VL1A 3GN1A 2RI0A 3GELA 4GEKA 4JLWA 3A1SA 3VAAA 2JAHA 3D4NA 4ZTBA 3T9DA 1K88A 3TSCA 3B89A 5DT9A 1Y5IA 4ASUD 5FTWA 4Q1VA 1TU4A 1G3UA 3QVVA 3RTGA 1BS2A 2RH4A 5HM6A 1IUOA 1H0SA 2FW0A 1GVNB 3B70A 4IJ5A 1E8DA 4WESA 3FUCA 3GQBA 4KAHA 2GO1A 1M34E 2FN9A 3JQAD 3VR5A 3O31A 1DELA 1ZCAA 1OWNA 3HXTA 4OTZA 2AE2A 2X42A 3ME5A 1RRMA 2I3AA 2N9UA 1RM4A 2BFCB 5K3CA 3WNVA 4A8JA 4QVIA 4QTYA 5JNLA 3G2NA 2X8LA 3LOOA 1JYEA 2X9LA 3OX2A 3KXKA 1H93A 2GCOB 3W5IA 2HJWA 3IQHX 3S0JA 2C03A 3HJ6A 2EDAA 1O9HA 4FMCF 4R9SA 4L9SA 2H59A 4FHCA 3JYOA 3DKKA 2X15A 2XR1A 1L8LA 1QMGA 1S8NA 3IQFA 1GQRA 3HKBA 4U6NA 3UUGA 5LXTB 3I92A 4RHYA 1II9A 3JVEA 2P78A 4UMEA 1YDHA 3EXHB 2C5GA 4O2AA 4WBNF 2ESRA 3LIIA 4BZZA 4ZI2A 4N4AA 4CG0A 1JJAA 1ZH0A 3GP5A 4GPZA 4MQMA 5B36A 4DHWA 2NXWA 3FLMA 4IDEA 1CEYA 3FPFA 5M04A 2R7NA 1Z4IA 4ZOBA 4ECAA 1REQB 3GOHA 4P7FA 3LQ2A 4NMHA 3UJBA 3GHYA 4G4IA 3P4XA 2JG1A 4NR0A 4KQ9A 3FVRA 3GLRA 1TM1E 4A82A 2HMVA 3IAXA 5CB0A 1PK7A 1ZXBA 3C6KA 1V95A 2O8CB 3TL6A 4FBLA 1AZSC 2QY6A 5H82A 3EAGA 5CXXA 1QQTA 3HBLA 2GO7A 2XJ4A 3QI7A 2J07A 4B45A 2WYIA 1BCSB 2XEDA 1YUBA 5GGXA 2GUWA 4FDTA 3N0XA 3EVBA 4U7FA 1M1NB 1Y7TA 3OZCA 3EVDA 3O3OB 2XE6A 3PDHA 1ISJA 2NYRA 2RC5A 2RBKA 3IBTA 3K70C 1O8CA 5CAEA 5AXBA 2LIVA 3ZEIA 3JD4A 3AR3A 1YDMA 1XC7A 3A28A 4MS3B 2CCGA 3QG5A 2Q4DA 3EEIA 1JMVA 2IDKA 5CLJA 5B7GA 2QVCA 2WE8A 5ULLA 1WU8A 2PR7A 3AKYA 3K6KA 1TVMA 4JLVA 2HF2A 2AFVA 4KBGA 4URHA 2X0FA 3EEBA 1KBQA 3VX4A 4GVPA 1U63A 1V6AA 3D2LA 5CGAA 2IOQA 3DOFA 3GNQA 3T1QA 4KYTA 1BJKA 2VWPA 4LXGA 5KYYA 5IF3A 2IV3A 1OW3B 1BE6A 2BFDB 1ZL0A 1V8ZA 4F12A 4C05A 1L4FA 5BN3A 2NZXA 3D7RA 2QTGA 3EIXA 4OUDA 4MQ4A 1PUJA 3QFTA 4JEIA 1TJ4A 3BEOA 4EG5A 5CDYA 8ATCA 5JU6A 2XXAA 3GRVA 1FEZA 3II6X 2ZS7A 4PHCA 1WM1A 5CVUA 3A6ZA 1SB8A 2WKQA 2VQSA 4JLAA 4D4GA 1CY4A 2D62A 4GEGA 5EP4A 3MWEA 4KAJA 3AMVA 1M8PA 2FZ5A 1Q11A 4G3XA 4WLFA 4YRCA 2W6OA 3WBJA 2QGFA 4DA7A 2IUTA 4NH0A 1FFDA 3FLAA 4GLLA 3HFSA 5B4TA 1P0MA 1T0UA 2ODAA 3OU2A 1ZVQA 4LBWA 3FF1A 1E1QA 5HIJA 4F4IA 4NBTA 4WEQA 5CW1A 1DKPA 5C5EA 4W5QA 4C1BA 3AB7A 4XD7D 1RYHA 3O7WA 4CKCA 3D4BA 3N8DA 3PITA 2J0UB 1U0BB 1E2HA 5C8YA 2XUAA 3FJYA 4ZKEA 3AY7A 4EF5A 2R87A 2J6HA 3GPCA 3O8NA 1T4BA 3S2EA 1LPPA 4IS3A 3VO9A 1WBBA 1IQUA 1EEXB 1Q7GA 3BRCA 3N76A 4R01A 1JAYA 3MT7A 4BJHB 5HBRA 1S9HA 2ARKA 1UC8A 3F6EX 1MQSA 3DMRA 3L18A 2N46A 2ES4A 5EKXA 5U9CA 2BMEA 3VSEA 4E2YA 3B3JA 3HNOA 4ER6A 2UZ3A 4GI1A 4RVOA 1DKRA 1YMVA 3TPCA 3JZMA 3PYXA 5FLXA 2XGJA 4DUZB 1E2GA 1MXFA 2PH5A 2PL9A 2QF7A 4TQUS 4GBJA 4WESB 3GY0A 3T7CA 3MTJA 4IH9A 4B17A 4W7IA 1W73A 3WO1A 2PWAA 5E3IA 4UCQA 5DI9A 5ALEA 3CQ9A 3WRVA 2P2YA 5TRWA 5IM5A 5AESA 4BZWA 2I2AA 1NFQA 4YA6A 1HT1E 1JHXA 1RYEA 3I12A 3HBAA 3ISJA 5LQAA 2C29D 3H05A 2F8SA 2OPBA 4A5OA 3QELB 2CUZA 5DGCA 1Z6PA 3PI6A 3ZCUA 1C1XB 4H1HA 2QW0X 3LCVB 2QORA 1DWUA 1AKEA 2V5UA 5CMLA 1CB7A 4EMBA 3SXPA 1D1TA 1YZLA 3O8OB 1H9BA 2ISCA 3EGIA 3RWOA 3VI4B 1V8OA 1QRRA 2VK8A 1JG4A 4EI7A 1MZPA 2H85A 1ORRA 4WHMA 3R7FA 1WZNA 1WA5A 4MI6A 4UEQA 5F1KA 3JPYA 5EE3A 3UQEA 2HXGA 1JAIA 4O2AB 2CZQA 2JAWA 3UAWA 3KJNA 1D2EA 5ALKA 2I33A 1DUSA 1Z12A 2PXHA 2ZR9A 2ZTLA 3I4FA 4IGAA 5F7JA 4S24A 4C4RA 5KX5B 3C8ZA 3QCZA 4JA2A 1GZUA 2OHHA 1LK0A 2C2YA 2C9CA 4UXIA 5FBWB 4Q37A 4WDRA 2B21A 1FLNA 1KEVA 3B52X 1EGHA 4DA6A 3WL4A 4ALIA 2BONA 3MRVA 4J1TC 1B41A 4P7BA 4E32A 2ZROA 5B1YA 1EZZA 2HMYB 1JDZA 4AMUA 2XWSA 3K8YA 1A82A 3GFRA 4IHJB 3RLIA 3ZY2A 2VJLA 1SG0A 3CMCO 1RM3A 1MABB 1GGEA 2O6LA 1ZLXA 4XTCS 3QWAA 5F4BA 1ZR2A 3GIWA 4RULA 2PRSA 2JEOA 3F97A 5FTNA 2AFHA 2R7AA 2RB5A 1E6WA 1IDOA 3I61A 3AG6A 3IJPA 5H1YA 2WJVA 3NIDB 1CRPA 4PHFA 1N2OA 2RHCA 4I8DA 1E9SA 8OHMA 2DLNA 3BD6A 3CKMA 4BX3A 2YXUA 2FJUA 3ETNA 4EVIA 1W5SA 5L3QA 4ZZIA 1CF2O 3T3MB 3ZE6A 1SWWA 3GFBA 3MXTA 1EX9A 3OTHA 3P0FA 4PVCA 1NKSA 4JP3A 1EFVA 4IGIA 4Z8YA 3ZI7A 4Q4CA 1UBUS 2POQX 3FGZA 4DCUA 5J23A 1SRQA 2A30A 3ZVMA 1VZ2A 4Y9DA 1X1RA 4RC9A 3ZKWA 1PV2A 5BN3B 3ZH9B 2HWKA 4FEEA 1FLAA 1S8AA 2WWTA 5FUXA 1M5RA 4J7AA 2O2EA 3HY4A 3GUHA 3QX7A 1V45E 3SF8B 8AT1A 1GFIA 3PUYA 3VH4A 4YAUA 4JJ4A 1RJFA 4IDHA 3DVRX 3FTCA 3GFPA 4MKXA 4X7RA 1QRTA 3VJLA 2K5UA 3W5CA 1XYYA 1E2PA 1U8XX 2AMJA 2ZWPA 2VUSA 2MJLA 3DBRA 1EP9A 1O6ZA 2FSUA 5G0WA 2YFKA 1OJLA 3PNMA 2QX9A 4I9FA 5EIFA 3PDIA 3T7KA 3SWWA 3CZ4A 3A6HA 5JVDF 4QOSA 4YRLA 1OLOA 1C4KA 4KADA 4EUMA 2YWJA 2VHWA 3RQ2A 4KYUA 4OGFA 3BWCA 1J56A 3D8BA 3PWSA 4LJ7A 4MRRA 2FSPA 1FE8A 1D3AA 2V97A 4PYJA 1Y1TA 1EVLA 2EJCA 3JVDA 1SXGA 1K4MA 3KVYA 4JGBA 3OT5A 4K6OA 4N3CA 4NV1A 3WZ2A 4AY4A 1TZMA 2YC2C 4PO8A 5T6BA 2VLIA 4JQCA 5KJ6A 1CVIA 4UAJA 1Y7IA 2Q5QA 5FV7A 4FC7A 3RAGA 1LWOA 1VG0B 2OHXA 3CZ9A 2QM0A 2LRHA 2H54A 3FCEA 1CJSA 4MWTA 2NU9B 3A4YA 3R3YA 3X44A 1R4AA 2KPOA 4NNOA 3U49A 4QQ8A 5IKOA 3AL3A 4G6ZA 4RVUA 5WRFA 3EA0A 1B15A 4RS3A 2P9QA 2Z58A 3EMBA 4TPKA 4OQMA 4UJ5A 1YVDA 1VKHA 1GGVA 2NO7A 2QRPA 5KC8A 4QKQA 3CGGA 4IMPA 3P9XA 3EXFB 1USUA 4RHTA 4Q1DA 5EWLB 1QWSA 5BSUA 3Q8MA 2GSDA 4QHTA 5CIYA 1EKKA 1XU7A 4LDJA 4YQYA 3SZGA 1ZUNA 2H5IA 2CZCA 4ZAFA 2XJAA 5FA6A 1U90A 4ZCPA 2WF9A 3RUPA 2DUNA 5FWYA 1Z6ZA 2Q4BA 3IQWA 3F8SA 5KNCA 5CEEA 4OXKA 2ZZNA 1X86B 5AW0A 3KTFA 1O6GA 2RKOA 3HY6A 1ZA1A 1ZD8A 4MVJH 2Q6OA 5LQMA 2Y99A 5DLQC 2FPPA 2OCDA 1WY5A 2XYRA 4YPVA 5I7HA 4YRSA 2C1EA 2M9MA 1NXVA 1DVRA 4DKJA 1SU7A 3T06B 1FZTA 2J87A 4M0PA 3DMTA 1Y6GA 4FDMA 1QO0D 2WILA 1Z39A 4AG5A 4FE4A 3E9YA 3N75A 2PJRA 5K4HA 2XB2A 4G0UA 3LY7A 1Q0LA 4L7QA 1RHUA 4ZP1A 4HDRA 3KSUA 2D59A 2IYRA 3KFLA 3L8ZA 4HWKA 5JWHA 1OFHA 2D2IA 4BNFA 3M34A 1HM5A 3D8TA 5ELLA 5JNTA 3FYSA 5AI5A 2O3UA 5CJJA 1ECLA 4D80A 1UBRS 1LQTA 1H2BA 4IKOA 1Q1ZA 2XMQA 4U7GA 3CUWA 1Q44A 1U8ZA 2O2CA 2PSFA 3EVEA 5SY6A 1RIIA 2DY0A 4TWRA 2ZLBA 3OTWA 4PO1A 3MELA 5EZYB 1NQWA 2ZYTX 3ZUPA 2DT8A 1J00A 4BVBA 1SKMA 2I1QA 2OV4A 1Y89A 2GPTA 2CXPA 1L8QA 1XCOA 3E7WA 4PXSA 4PGHA 4NKRA 3NU1A 4PCVA 3WGUA 4IMJB 4M37A 2LKDA 4OQYA 3W77A 5LU8A 1IXKA 1PK8A 1XKLA 3GLIE 1UKEA 3IA7A 1OKKD 1T4CB 1UXGA 1ETUA 2PWZA 2X9NA 4LXQA 2VT3A 4DR6B 1CU1A 1PFVA 2O2SA 2FWJA 1Q19A 2JBWA 2QN8A 2X4GA 1RLIA 3KPVA 1AA9A 3Q5EA 4JQOA 4MUFA 3SSOA 3I45A 2GZRA 4BUJA 5ICMA 4KN6A 2R4QA 5JSUA 4AQ7A 5K8TA 4K9KA 5FX2A 2YMPA 4URUR 5AK0A 3U3XA 4EQ6A 5L3QB 4E70A 5HWSA 2PSEA 5BSTA 2O3SA 4DZTA 3F1KA 3T1VA 4M7PA 2O5VA 4GUAA 3ADCA 4FYXA 3WFIA 2FMIA 4EWLA 3PIDA 3A1DA 4RE6A 2VJQA 3A0UA 2AX3A 3FSGA 1X87A 1NPDA 4B4DA 2L18A 3OY7A 1LVUA 4RCYA 2C78A 1P74A 2QE7D 5AW7A 4CF3A 2DDWA 3KOZA 1JHQA 2FX5A 1UBGA 1CPYA 4QYXA 3K71B 4EJ0A 4ZMBA 1KU0A 2R1UA 4XCXA 1EUYA 1AQ6A 2WHPA 4KXNA 1CSEE 1VKNA 1IWOA 4HWGA 1YCGA 3RSFA 3AR4A 2XBLA 4KWCA 1UMDA 2FJ0A 2SKCA 4PZCA 4FKZA 2CSXA 2VK4A 1Z28A 2H57A 2NU7A 1Q16A 3C4QA 3K2QA 2FZ4A 4E8YA 1I14A 1GFSA 2F2TA 4Z9FA 5CM2Z 3EGOA 3I28A 2XCRB 2VJOA 2Z5FA 1NSFA 2I6XA 3CE6A 4GL2A 1GG8A 4BNWA 1P73A 1C8BA 1U2TA 2OCKA 1T26A 2GHTA 2DQ4A 1ZI6A 3AF4A 3FN4A 2H17A 4OD0A 4A2WA 4B8SA 1TLTA 1U5CA 1V1SA 2HZBA 4HUQB 1IN7A 1UBOS 2V98A 4UCXA 1GADO 2J7KA 5IDVA 3UMGA 4D9BA 2FP3A 3CXRA 2A4MA 2AGVA 3TI7A 1ZU5A 3QBDA 2B99A 2FMHA 4L5JA 2BM9A 3MXOA 1A97A 1HT2E 2Q49A 2I6TA 3BE4A 3GBVA 4AJ1A 4BX2A 3VDMA 5A0TA 3V8BA 4DRYA 4GVLA 2P30A 4H7KA 4QELA 4RUKA 1TF2A 3ESYA 4MKZA 5AKJA 3EBOA 3ZGYA 1KEPA 2PXCA 5K8UA 2D2XA 2RGNC 5DX8A 3OD5A 3RT1A 2HO4A 1TEXA 1ZUNB 1N32B 1MVLA 3E7FA 3QEMA 4TUYF 5KO2A 5I51A 2PKKA 2D5CA 4QFBA 4TROA 3B1PA 1I2AA 1J9ZA 4DAEA 3OZVA 2CC2A 1SZDA 1VE5A 2E18A 3V46A 4JLPA 3MAJA 2WRZA 1OXXK 2MOKA 2RGEA 2Y8EA 3ZW7A 1HNZB 1TQ6A 1VDZA 2I8AA 2FFQA 3B53X 3TM4A 4C2AA 1AHHA 3BA6A 3IJ5A 4KLNA 4WBNA 1EG7A 3WHLA 3W8RA 3ZHOA 5AVSA 1CEXA 3OZRA 3P9CA 1O1YA 3R1IA 4FJ1A 1YU6A 1BWSA 2CF5A 4U7HA 3GRRA 2WU0A 2VHTA 3RSSA 3WC4A 2QXYA 3GPLA 4FMPA 1VCIA 1KZYC 4RD4A 1GA6A 1ACJA 2ZRGA 4ZMRA 4WCFA 1EVYA 4HRYA 1U2EA 3ESXA 3T9BA 5AM2A 1L7BA 2YUIA 2OZLA 4Q3DA 4UZFA 5BNTA 5T57A 2TRSB 3MMZA 5JZ9A 1MOZA 4WH0A 1JB1A 2YJGA 3HUDA 4I5DA 2YV5A 1G4AE 3K20A 3JQDA 1KO5A 5AKKA 4KWHA 5CH8A 2JGKA 2VUIB 2V7GA 2OD9A 3I6YA 2BV3A 1IHUA 4YPFA 2BMFA 3EZ7A 3QUAA 5LR6A 1M3SA 1FPQA 2PSJA 4GWKA 1H22A 1QONA 3SQOA 3ZWAA 1NMZA 4MVJP 4RF2A 1S3FA 2WTNA 3A58B 3FDFA 2A9FA 3IP1A 1YDFA 3MBKA 5ALSA 3GLFE 4PRLA 3AY0A 3PL1A 4GVXA 3NHJA 3RVPA 4M53A 2ZDQA 3T3IA 3CC8A 2DUUA 4D4KA 1E61A 3GDFA 2HF7A 2R6R1 3FJ1A 2VP4A 2BFFB 5IFKA 2YV4A 3IAS6 3TYXA 4BFXA 2QXUA 5K7SA 1GTRA 1C9NA 4Q7MB 4A0RA 4K1XA 2YBDA 3EG9B 3ISVA 4HQ0A 4C89A 4IQFA 4EQ6B 3TMYA 4RS4A 3C6MA 2DFPA 5DHQA 1FPMA 1Y9AA 3ZWCA 1F2DA 1X7XA 4A92A 4QUAA 4LY0A 4AXBA 3H3FA 4NEGA 3HBMA 5B37A 4PO3X 2QUHA 5ECWA 3OCVA 4OBWA 4WBSA 1T35A 4MPPA 3LMKA 4C78A 2AM2A 3MWLA 4TZ6A 3KDAA 2P7IA 5JAPA 2PKEA 1NGSA 2C20A 2FGJA 1W2GA 4DQUA 1X7YB 2F8LA 1NN5A 1G19A 1LA2A 1P2FA 1HE1C 1VMIA 2WHPB 3I53A 3QQ5A 1JKMA 3KT0A 4MVJM 1XB2A 2XUZA 5ADHA 1FW6A 3O94A 1C81A 1BXKA 3DBVO 4LF6B 3ASUA 3PDWA 4YUVA 3TFOA 1ZM4A 4XB6B 1FS5A 5EHQA 4JB2A 4XWKA 1WE2A 1QCDA 2NU7B 3QKSA 4OJQA 1P6QA 5FI5A 2DR2A 3ZTTA 4D1YA 2B6NA 3OLXA 3GLFA 4TRMA 2E5WA 2GJKA 1HURA 3TZHA 5EJ2A 2I4NA 3LTNC 1QIGA 3NL3A 2A0XA 2FFJA 2XB6A 4JVMA 2YMQA 4A2PA 2J4FA 1DQZA 2UYYA 2H4YA 2N42A 3A1WA 3L0DA 3D3KA 1V8DA 2Y1XA 2V1UA 3UWSA 2FA9A 4Y6GB 2VPTA 4AMBA 5K8VA 4C0BA 2BAGA 3EMVA 4FUQA 4Z2AA 4RWZA 4N0MA 1DO8A 1H0RA 3PPXA 4IJKA 1PN3A 3I8OA 5JD3A 4LRXA 2ZJOA 2ODWA 1R5OA 1YS2X 4BV3A 3ZY5A 5YASA 4JKUA 1WPGA 3OO0A 4O08A 1GG2A 2Y1DA 4MSUA 3KP1A 4R31A 2HCTA 1OC4A 4RJ2A 4RY2A 1LSUA 3JARA 2DKFA 3RBVA 1SMKA 3KBBA 1GVHA 3N0TA 3KKOA 5CJPA 2WV7A 1ZRMA 4I1RA 3V4VB 4U7DA 1R9JA 1ESEA 4FMCB 3TZCA 1KL7A 2ZYGA 3HU5A 5HG0A 2O7SA 1H5NA 3UBOA 3F6RA 3FPBA 3O8CA 2MR6A 1RQLA 1LK7A 1XZJA 3KPJA 5A5GA 3NJRA 2QTTA 4UTZA 3G6KA 2EAUA 3AKCA 1PWXA 2WY2D 1P0PA 3B1KA 3L46A 1GLGA 2Q5FA 4JDUA 5C4MA 4CEJA 1PD0A 5BYFA 2CFIA 3Q0IA 3KUKA 3VKUA 1U04A 1ZK0A 2QIPA 5KYUA 2QU8A 1GSHA 4OMDA 5KTRA 3B6IA 4EGJA 6AT1A 2OV1A 3J81k 3E58A 3OF2A 1BFDA 2ZYWX 3NZEA 1LFDB 4XCKA 3UAZA 2EKDA 1H8HA 3L7YA 2JA1A 4JZYA 2XW6A 4FWTA 2WJYA 3GVPA 1RQRA 5J5CA 2ECKA 3VM6A 2OECA 1YVEI 1WEKA 3GJ0A 4P53A 1JLSA 1O57A 5P21A 3SLRA 1UCFA 2ZBQA 1ACMA 1Q0HA 1VPVA 4X93A 4ZJYA 3L0SA 4JGIA 4PFQA 5BT9A 1ZIOA 1W59A 2XGGA 2B2XA 3Q85A 1ITZA 3W9YA 2OLKA 1GTSA 1RKQA 3C85A 3JAWB 5LQJA 4OUKX 2ZRKA 2MYNA 1RXUA 3A1EA 3LY5A 5BYBA 4MVJD 3EMDA 1N77A 3G85A 3IDAA 2HWYA 2A7XA 1G21A 1CUVA 2RAVA 3ENZA 2PS0A 3AV0B 4JMPA 3VR4A 2G67A 1E4VA 4LMRA 1M2FA 4H35A 3V2HA 1VHLA 2CDRA 3QXXA 4LPKA 1D6JA 1W1UA 1HQCA 2V6BA 4DLNA 2GZSA 3DZJA 5I4CA 2F67A 3UV3A 2PGOA 4Z7OB 4J3JA 3VR5H 1D0IA 2FQQA 4JI8B 1U3TA 1ONBA 3B3AA 1KMNA 2CMGA 1TYYA 221PA 2JLBA 2H5LA 4IP0A 2A0YA 2R2GA 4J94A 2JI6A 3RPHA 4LC1A 2AN1A 4WGGA 1ECCA 1PJBA 2NU8A 3L3BA 4C4ZA 1SBYA 4YJ2A 3RHTA 1CUSA 2E89A 2H2IA 2CJYA 3H65A 1T43A 2OG2A 3O3CA 5FI1B 4D41A 3EX7C 4BO6A 2WP0A 2WWYA 2J7PA 2LGJA 1R10A 1C1DB 1QX4A 1DEKA 2Y93A 3HJGA 3KJEA 4GMDA 4TZTA 5C2JB 4C7XA 2DLCX 3GARA 4CFSA 3A6FA 4RL6A 2EKBA 5LQSA 3UCXA 5JVDA 1CRZA 1G20A 3I72A 1AD2A 1AZLA 4LJAA 1EEHA 5CRIA 1OFIA 4IEEA 1CS0A 1L7RA 3DBHB 3GJZA 2CCKA 2VJAA 5F5XA 1FNSA 4Y1GA 3GCWA 4G2TA 1JPVA 2QAGC 1R27A 2QRQA 3GLFB 1UR5A 3C24A 2D5BA 2WJ3A 4HDSB 3B1VA 4M38A 2FF5A 4NCHA 5BYEA 2AE1A 3FPKA 3NL6A 1U3DA 2X8JA 1Z16A 4RVSA 5HCNA 2B9EA 4ZJZA 2ZKIA 4DCOA 1KQPA 1JEYA 2W2QA 2EF0A 4GQAA 4ZKDA 4MCIA 1EAYA 1KSJA 3HYCA 1F3LA 2FWRA 5GONB 2PZFA 3BHNA 1EUDB 1NW3A 4NEQA 4A8TA 4QFDA 4RVFA 3DE0X 3O9ZA 2O3TA 2YHAA 3IAUA 4IR7A 3DXXA 1KSGA 5KDOA 3BREA 5D85A 4FYJA 3ET5A 3JQQA 4Q4HB 5EE1A 1CK4A 1J7JA 3A9VA 3CLKA 3QV1A 3L82B 3QKRB 4OIMA 3L5OA 1R5NA 2BSAA 3AEKB 3B13B 1JLLA 1U5BA 1TM4E 2FZGA 2VDPB 3EGVA 1K97A 1RAIA 1Z0ZA 3MF4A 1V7ZA 4OM8A 2G07A 2G4CA 2OHOA 3QFHA 4P5EA 5DXJA 2YMLA 2V8BA 3QRWA 4B44A 1MF7A 2O0LA 3CNHA 1J0DA 4LHEA 3S27A 4AJ2A 1CEQA 3OQMA 1LIJA 1ICEA 3HH8A 4UPDA 4B7CA 1H6CA 3DE2X 5AW6A 3N2NA 2OKCA 3BXOA 2ORVA 3AIMA 5BV2P 5EMKA 5E7JA 3RLFA 4M8SA 2XX3A 5AJYA 3ZU4A 4B75A 3L4JA 3A31A 4HDOB 4AJJA 4KO8A 1FFYA 2LBPA 3LX4A 4KW7A 1SC3A 1ZLYA 4QHYA 3NP7A 2IP4A 3HU1A 3IXQA 3IRUA 4L1KA 4DDHA 4Z1MD 2DB3A 3ROTA 3JY6A 4CEJB 5BXYA 5DNEA 4PXYA 1DIGA 3A27A 3CISA 4NZNA 3QE9Y 2GKGA 4DPMA 4MROA 2JJ2D 1VYUA 3RJTA 1E94E 4BVAA 5B30A 2DBVO 2XMRA 2YFYA 1G7TA 4UASA 5KNBH 4Q9AA 4EKYA 2WMOB 1M2JA 1OLXA 1CW2B 1V4VA 1FTGA 2H6EA 2XYHA 4ZOCA 3E70C 3O8DA 3CF2A 5AMXA 1EDEA 2D1FA 3NNNA 1SVOA 4XQEA 1D1SA 3AFHA 4FNMA 1AY0A 4XQ0A 3UEOA 2ZYRA 3V1UA 5AM5A 4HWSA 4UHCA 3B6JA 3F5DA 2GN2A 5TE9A 3AF0A 2ZJZA 1CF9A 1EK2A 1KH2A 2BBTA 2G7ZA 3DC7A 1ABBA 1UZAA 3PEFA 1LPAB 5BQOA 4OYHA 1IG0A 3LDHA 5JQGB 2P40A 4S04A 4DV4B 4GGMX 1K4KA 2DCUA 3A4TA 4KZKA 5EJAA 2F9LA 1BMTA 1B3RA 1XNHA 2EERA 4HVCA 3U1BA 2ZUDA 2QGNA 1NRIA 1MNQA 5DO9A 3PQ2A 5K0NA 4IDGA 5DHTA 2YYSA 4HH0A 4BAGA 3T5PA 1F4VA 1MN6A 2HWUA 4FSXA 2XUJA 3UMJA 1X1EA 4X63A 4DC1A 3KYJB 3QFFA 3VJMA 3RC7A 2ZM5A 2GLUA 5IJZA 1RMYA 4LCAA 1LV8A 3DEZA 1VLMA 1ZGGA 1GKLA 1NW9B 1SY7A 4U0JA 4XRGA 3A05A 3RIGA 2WP8J 4C7OA 4A8JC 4LBXA 3SOZA 5IVDA 1SQ6A 2AFHE 3D6FA 4Q3LA 2F1OA 5B1HA 1KAQA 3SVZA 4CKXA 4DE5A 1CQIB 3L43A 3UMMA 2GD2A 1U1DA 3NDBB 2ZRQA 4AY3A 4UC0A 4GR5A 3EB9A 4FZVA 1NONA 4PZZA 4UM8B 5FPYA 2F9FA 1OBCA 2FWIA 3PX2A 2R96A 4KHZA 4D43A 5LBUA 3AGQA 5JVDB 2KI5A 3HGMA 1G20B 3MMSA 1G6HA 4KO2S 5FKJA 4IEIA 4K7JA 3B6MA 4DY4A 1KPIA 4FW9A 3ZHSA 2IDMA 1NKVA 1HGXA 4BUZA 1N33B 1Y3CE 2I3GA 4ZCMA 1CETA 4TMWA 4KKVA 4D0RA 4YP9A 3KEQA 4IUBS 1EFKA 4NECA 4QSMA 5ENZA 4CGYA 2B83A 3SZUA 1ZZEA 3IEKA 4YMLA 3TL2A 1HOXA 4LZWA 5CH3A 4BAUA 1G8AA 4ZZ0A 5BW4A 5LOVF 2PKMA 2I6GA 1JFLA 2YQ4A 1XLTA 2YXLA 3HBNA 2CJPA 1M6EX 2X8JB 3HCNA 4PC3A 4PFKA 2D7JA 1QCCA 2F48A 4WKNA 1OWMA 2JF0A 2G9QA 3BEDA 2LDBA 2J41A 2H52A 4R7GA 5EPEA 4URFA 4A6DA 1ND5A 1FNNA 1WDMA 3X1DA 3EC2A 3NIGB 3LSYA 3CEJA 2QWXA 3DM5A 2LIPA 3DE1X 5HOQA 3RTDA 1HE4A 2HIMA 5KEIA 1HRDA 2Q6TA 1F48A 1K68A 3PHIA 3WKEA 1Q7RA 3S8YA 3HXQA 1FP4A 4TUYA 2BUBA 4IDCA 1PZGA 2Q46A 4FNAA 2YIJA 2OHFA 3KOMA 3TRHA 3AM4A 4PTLA 3T5MA 1XX6A 1VGRA 2N1BA 1MUUA 4XWTA 1K2VN 2Q62A 5M34A 3ACDA 4MW4A 1DKLA 3KETA 3ZU3A 2OCAA 2X1HA 4OB8A 3HN2A 3KELA 2D1RA 1Z47A 3TLGB 2C9YA 3TMAA 4YRJA 3ZWMA 5C1IA 3QPAA 3M2PA 2JLQA 2GZ2A 1MU0A 3IP5A 4R1TA 1RW4A 4F56A 4EELA 5IJ0B 1ZNXA 2A3NA 5TMEA 5ARCA 3WL6A 1WXXA 4OLBA 1N3LA 1NQTA 3VPBA 1NJ2A 4L75A 4FT2A 2B4TO 3NGXA 1PT6A 4PANA 4RZXA 3WGMA 3ZV3A 3DVAB 5JSYA 4A23A 4G5HA 4IJWA 3FMIA 3RVLA 2XF8A 1GOTA 3A1NA 3VPFA 2ADMA 1IBCA 5L45A 3IIMA 4R05A 4P36A 5CFMA 1GQOA 3FCCA 3M5CA 3CUEF 2VC2B 3P9SA 4RTPA 4LTMA 5KHAA 3REOA 2OCXA 2AN3A 1IVSA 4MIEA 3AVVA 1M6VA 4Q9LA 2PWPA 4LYGA 1OLXB 1VSQA 3GJYA 1IJBA 3AP3A 3KKPA 4PS0A 1E66A 2WA1A 4NPCA 5C52B 2CV1A 1EK0A 5C7YA 3EGDA 3FM9A 1A27A 3GA7A 4XYMA 4NBRA 3X2FA 2IZ7A 3OOWA 4B4UA 2GAJA 3ZDEA 4D8TA 4DLLA 1XQ1A 4MLCA 4IXDA 2BDUA 5ALJA 2RHWA 4QUJA 5ILQA 2VYNA 1VL2A 3HJRA 3T95A 5CCXA 1JILA 2NU6B 2AOTB 1AUQA 3MWJA 1PEKE 4LNUA 5IVIA 1CXZA 2XTJA 5J43A 3COJA 4Z51A 1RI1A 2P6PA 2O0MA 3IE7A 3QWHA 3KYDA 3GXBA 2FVXA 3HABA 4DB2A 1YGKA 1QIHA 1WCIA 1Z25A 2C5LA 1IHYA 1MNAA 2G5GX 2UAGA 3JD2A 2Y4NA 2CNWA 1LPNA 3NUQA 4HDNA 2IYLD 4MR9B 4AO6A 4CR7A 3KKEA 1NUUA 3TD2A 1F8UA 2W6QA 2O8DA 1UAGA 1R4MB 3WA7A 2CL5A 2B36A 3FHLA 4GX0A 4TTAA 1LIOA 1U2RA 3PCTA 1YVUA 3V1MA 1VM7A 2KSQA 3SQLA 3GK3A 2CL7X 3BHJA 4HUJA 2WVJA 1F12A 2OM6A 2Z56A 3PGLA 4TM8A 4C7OB 3BHMA 4DIUA 3ILYA 1HYHA 2YWHA 1KORA 3D54D 4INPA 1SPXA 3NEYA 2UXDB 2QQ0A 3HVRA 5ANRB 3H99A 5LC1A 3HO1A 3BILA 4NCBA 1ZCBA 1MR3F 3IVRA 1IPHA 4KWEA 4B3IA 4B5KA 4FYMA 1XTBA 1IMOA 2X8WA 3T7RA 2OXRA 3HCEA 3HNRA 1QFZA 2OBNA 3OI7A 4UE6A 3RVDA 3JQRA 4JYAB 2WIKA 4PC7A 2QRUA 1CV2A 1WCV1 4DDVA 1MV5A 2I8LA 2NSLA 2GN1A 2F8MA 3D6VA 3JQGB 1ZMBA 1FDTA 1HTWA 3N28A 1X7WA 4PYQA 1G5QA 1Z4PX 3F4LA 3NP9A 5BRNA 1DS6A 3CVYA 1U1EA 3UC5A 1B0AA 3K0FA 4RD2A 5KTMA 1W5FA 1BVHA 2C9DA 1G5HA 1PQPA 3C6XA 5EXDA 1ZGHA 4MCHA 1NURA 2IH4A 4IJ6A 1I6KA 5KSPA 2QLJA 4I4LA 3WL3A 4E5UA 1GARA 1D8TA 1WSDA 5A4IS 2R84A 3ICCA 2C98A 1OXUA 3OZFA 3R0QA 4JU8A 3WMRA 1GG4A 1XQXA 1XVUA 1YBHA 3K05A 1NMEA 2CV0A 4LRWA 1PEYA 3F46A 5DI3B 4N5LA 1IULA 4J07A 2PZBA 3AERB 1G7RA 1STOA 1S4MA 2F64A 1U0RA 2NG1A 2FPGB 1Z5NA 1RQ2A 4HLCA 4XUDA 1IK6A 3U62A 3AUKA 3KBOA 3RYIB 5ICCA 1Q7EA 5JNWA 1LDYA 3PV0A 3QVUA 2QG9A 4U2BA 2UZAA 2QD4A 2DTDA 3L4BA 1ABEA 4TUYB 3K6SB 4BGDA 1HMYA 2RGBA 3Q8XB 1NW4A 3QKWA 5HEKA 3EPKA 2Z8ZA 3N1CA 1E5QA 2CNBA 1FGSA 3DEYX 4JL5A 3DHVA 1SH7A 5AJUA 2ECPA 3MBOA 1PSDA 4XWWA 1PLKA 2PIAA 1WETA 5BPHA 5AW3A 1ORWA 4O1HA 4LRTB 1I9CA 3ZD8A 4X0EA 1OH6A 3VV2A 1EWKA 2ZW9A 3OMWA 4Y2XA 1JWLA 2IEDA 1BKSB 2I4LA 4WJKB 1PFGA 4BB6A 4C6RA 5BY2A 1RKSA 4LX0A 2Q4OA 5DMHA 5G53C 1HBJA 1AIPA 4N03A 1SN7A 2ZBPA 1NJ1A 5DHAA 2CXHA 4PYLA 4OHRA 2I87A 5D3QA 4M1WA 4IS2A 4HX5A 3JR3A 3P1JA 1LTKA 2FU5C 4BAZA 5JSZA 1W4LA 2G9UA 2QU7A 3PUVA 4OBBA 2O8BB 1KJJA 1D1QA 3GT0A 3I76A 3WLOA 4UVGA 3WAKA 1M6VB 3ZTYA 1DMSA 3FR7A 3K1AB 3DB2A 4Z0NA 4D25A 5F9HA 1V8BA 4L0DA 4EGCB 2I22A 2IHYA 3DUFA 1R00A 1AK1A 4FOOA 5DBEX 1QYRA 3FG9A 1LBEA 4GM4A 3WK8A 4PPQA 3BCUA 4H6WA 1DKNA 1RJ9B 4KIUA 4TGLA 3T5GA 3TDKA 3OE7A 3QI2A 4CIYA 4NYJQ 3PKZA 1DDOA 3S1AA 1UMCB 4LNUB 2J5QA 4YHHB 4LV8B 1TGVA 1QHHA 2XMZA 1GNQA 3MILA 2KW5A 1P5JA 3IV7A 2BUCA 2ZIXB 1SOAA 1OI2A 3L05A 1CCWA 1DOHA 3TNLA 4Z4HA 3KQUA 2ADOA 1V1BA 4JP1A 1J07A 4L8YA 4J43A 1PWZA 3KYDB 1N0VC 5F9MA 4RL4A 4BNVA 3PUHA 4C4YA 3I5MA 5HP4A 2ZUEA 3JATA 1SVIA 5EHIA 2G09A 5FQOA 1ESMA 1N2EA 1NVAA 3TLJA 3VMMA 4B4WA 2O8DB 3AM5A 1QX3A 3KOOA 1RADA 3MJVA 3INYA 4QVKA 1J2RA 3LWBA 5K3SA 5IBQA 1MO5A 3VGJA 3VU9A 3WWYA 5KNBD 1ES9A 3INNA 3IBYA 5CPFA 4D9GA 3D3NA 3GO7A 1WXHA 3NC2A 2J4DA 2Z6VA 3S29A 5B2FA 5L40A 1GNLA 2QPTA 4TYNA 2RAPA 1PJTA 2DKNA 2H92A 5BQFA 5F51A 3WISA 1E3WA 1EWTA 3RJZA 3DEJA 2JA2A 1NXTA 3D43A 4P92A 1TYEB 1DIAA 4Q3NA 3EK2A 3E9EA 4JUAA 2XLCA 3QVGA 5DYWA 3V9AA 4OK3A 2CEAA 2BJVA 4H7DA 3GDWA 2AF4C 2EWMA 1YDEA 4M22A 1KGSA 4CIXA 5AVKA 2OY0A 3DMTC 3QUQA 3TRIA 1IXZA 3BQMB 1JFFB 4XYEA 4L5AA 1X7WB 3Q3VA 4IOKA 1OIWA 1C1HA 1GPJA 2A9OA 2PLNA 2P9EA 5K4AA 1OLUA 2NPFA 1R18A 2BLNA 4G9BA 3FI0A 5DASA 3U0VA 1TO2E 4OIFA 5DBIA 4EW2A 4PGMA 2NP7A 3M7IA 4FJ0A 4MQ5A 1S2MA 1YS9A 3K6RA 5HJEA 3QU5A 3ZNNA 2CXXA 1LY1A 1WF3A 1VMEA 1EFUA 2I7CA 2R1ZA 1EX6A 4NMXB 4U9HS 4UMDA 4TN5A 1V19A 4KO3S 4EB6A 1LDBA 1T5OA 2BISA 1KTIA 1MTZA 2PL5A 3NALA 2P9TA 3OIFA 4C3OB 2WYHA 2WU1A 1PVOA 1U7TA 2BPOA 3JSAA 3P9RA 3FDIA 4QAJA 5IARA 3KSZO 2R8YA 3QXCA 1T3SA 4DR2B 5AKHA 4ZEMA 1IZ0A 3UW1A 3R8XA 3FVVA 3KZMA 4LOKA 1UQUA 2N75A 2YV2A 2Z2IA 3E7PA 4MA5A 1JKJA 2WA2A 3B9QA 3I9OA 3U7EB 3I2GA 1GAXA 1CYEA 2BHNA 1X15A 2Q21A 4BCCA 1VCMA 2GPAA 3DE3X 1EI9A 1VBFA 2ZBFA 1SHZA 2I1VB 3ASZA 4WKPA 5K01A 1MORA 3ECSA 4TSKA 1OYYA 4TWIA 4EPYA 1QFXA 4R5HA 1X80A 1YT5A 4Y7DA 3C87A 3PNSA 3ZXUB 1E6MA 3EFBA 3LY9A 3WHPA 2MSKA 1ZIPA 4CIVA 4KPYA 1WSBA 5ADUS 3HM9A 2AI3A 5ITVA 4BMPB 1J9EA 2F1IA 4YV0A 4MW9A 2DQYA 2PDAA 4U5QA 2SECE 5AXAA 4DZZA 3G2IA 4LNHA 2OCPA 4ZVSA 5JSZB 4INJA 5FNVB 2AR9A 2JDIA 3HWRA 5SYAA 1SJ9A 4NE2A 1EHYA 3JQ9A 4K46A 3RJ9A 3RVRA 2ZBVA 1TJNA 2GGSA 3AVUA 3G7SA 5DTQA 1LUAA 2B4YA 2ZJ5A 4IG9A 4QJIA 1K27A 3R7DA 4TM7A 2B8JA 2IC5A 1J8QA 2OCIA 3CNLA 1SUPA 3GG2A 2AXNA 4UXHA 1Q1GA 2ON6A 4R7ZA 2I0FA 2NSHA 4MDYA 5IABA 2HK7A 3QE0A 2WM2A 4UHHA 5G3YA 5JCPA 1SXJA 4D9NA 4F71A 1F2TB 3O7MA 2VNJA 2ISQA 3A9RA 4KFTA 4M7RA 3G2JA 2XCOA 1GR0A 4DLWA 3ON5A 4M54A 4YAFA 4DREA 2OHVA 3H86A 4PPYA 4HFMA 2HCFA 4JC8A 4N01A 4Q4JB 2LZ0A 1CDDA 3T5AA 1IXYA 4ILKA 5ALVA 3K9EA 3JQBA 1ZMOA 4BTEA 2GK3A 3GX1A 1KYHA 1KYTA 3OUTA 2EX1A 3HYLA 5KOHB 5DM2A 4P82A 2J08A 3BN3A 4TT3D 5AVUA 3JPWA 4WQMA 3AXSA 1WW8A 2C54A 4G8BA 3QGMA 1YTUA 2IBMA 1RWBA 3LK7A 1QR2A 4UDXX 1G21E 2HV8A 1KMQA 1FTNA 1GN9A 2XSZD 2UUCB 1GQTA 2B1IA 3OX1A 3KHTA 5BORA 4B8YA 2JIZD 3PJGA 3TBFA 1RJWA 3ZHVA 4ZCTA 3B3FA 2HYIC 4CWAA 1RLUA 3QVGB 1I1HA 5FPQA 3TSAA 1U94A 3BGOS 2ATCA 2IODA 1FP2A 3BDAA 1ZGAA 3TEMA 5BP7A 1SHLA 4WKBA 1XCLA 4URYR 4QQKA 4F9TA 4N40A 3S2GA 8ABPA 1JHDA 3KEOA 1W581 5LOVA 4G1UC 1YRHA 4CRWB 4D8VA 4WCFC 4C5MA 2Q3DA 1NASA 1Q12A 2XOKD 4D9IA 1VP3A 3N6VA 4G67A 1OLUB 4L57A 4K9SA 4MB6A 4G0VA 1WDKA 2VK1A 4DR1B 4RWEA 3DUWA 3TLXA 4ZGGA 3U56A 2NT4A 3RAFC 1SOVA 1U0SY 1B4DA 2XVAA 3OJLA 4MJ3A 2OV6A 4WGFA 5C1PA 4UNQA 3KWMA 1UK6A 1AMNA 4NMMA 1RWXA 3UB2A 1IM8A 2GNOA 2SICE 2V54A 3NWPA 4IO1A 3CW9A 4N5MA 1JB9A 4Q03A 5ARBA 2QZ9A 3E82A 3FOWA 2C2OA 2FQ1A 2Y77A 3E81A 1R64A 5A4JA 2CYAA 5AOAA 4V1CI 2BBOA 4R2MA 3N5CA 4W82A 2ZULA 4UUPA 4CQJA 3BH7A 4K0KB 4IHQA 5FI0B 1WMBA 3FFTA 2OO3A 4X1YB 3K31A 3RT9A 3HPRA 1ZOLA 4AKTA 4YHBA 2HT1A 2W5UA 3A1TA 4O2BF 4UUNA 3FE2A 2XCIA 4QBFA 2VT6A 1EDZA 2Y3IA 3GIDA 4N54A 3WNCA 4AT1A 2DY1A 4K81B 5CDUA 4ZGBA 1ZQ9A 4C5BA 2XTNA 1VP9A 1U4NA 4J0QA 2QX4A 4GECA 1CJTC 3C4JA 4XQGA 3VYWA 1PFKA 1VSBA 4RPJA 3MW8A 3SG0A 1X80B 2NQTA 2PRKA 2RFLA 4PX3A 1WUJS 2V0CA 5MF6A 1XXHE 2G3YA 4NDAA 1DOAA 4FGUA 2W6JD 4OQEA 1KY5A 2W0SA 1IRXA 2WKSA 3LUAA 2VJYA 3ND9A 3OPXA 3OPVA 3R4CA 5EJ5A 2YZKA 4JI4B 2LP4Y 3OQBA 3TXXA 1YDWA 1NV8A 2C58A 5AVRA 4DV1B 1FNMA 1ZA2A 1Z13A 1Z07A 2H4WA 4HVTA 4MV5A 3KAJA 1EMDA 1HZZA 1CYDA 2GSWA 2EJWA 2IGBA 3BL5A 4P1ZA 5DCLA 1KEUA 4HYYA 3SSAA 4DKXA 4HLQB 5K8LA 2BM0A 4X97A 1YZTA 1KJWA 3AFOA 1PP4A 1P5FA 2RGCA 2I2BA 4GSKA 1B0ZA 1YKFA 1Y5LA 3PTAA 2GJSA 4AP6A 2Z4RA 3MINA 1OA0A 1L6RA 5JJIA 1EFTA 1V1RA 3GBSA 3O1IC 2WWRA 2FYTA 3P45A 4JC4A 2FMUA 1I1NA 3WGGA 2OAQ1 1DEAA 2IU3A 2WOJA 4IV0A 5L7YA 3P2IA 3LWDA 1BHSA 1V11A 3TE6A 3ZZ0A 3ZVNA 2RHGB 3TEFA 4UUQA 2J33A 1NU6A 5LKAA 2AUTA 3DYBA 3GFFA 2GDZA 3PFBA 5BT8A 4NZYA 2FN4A 2P1RA 1AH2A 1QHIA 1RRFA 3DFUA 2SKDA 3E03A 2N47A 3PXBA 4I4CA 4U4AA 3TM5A 3N7TA 1RTKA 4YT4A 1APBA 1HY3A 4KE8A 5JG7A 1E6CA 2FSHA 2PXXA 4C21A 3GRZA 4F96A 5MN4A 4CLXA 2HYDA 3NVMB 1HNNA 1AGRA 2AF3C 2J3LA 1CY2A 1F8FA 3N6XA 4LYDA 3INTA 1T24A 1Z7EA 1ECGA 3E3LA 1AUOA 2VBFA 4TXLA 1XNRB 4HPWA 1J8VA 3KKNA 3U6BA 3EAFA 1W36B 1XEAA 1RCTE 3GJ4A 4IHAA 3K0CA 1F7VA 5GPBA 1KDZA 1P4HA 2Q5LA 4NABA 3OJWA 3KB1A 1YNOA 2C94A 4I7EA 3WNBA 3Q40A 2NYUA 3RW9A 3MJRA 4UAVA 2IXFA 1I2BA 3WGNA 4E5MA 4WE3A 1GZSA 1K6IA 3FZEA 1AA6A 4P0TA 4P2BA 5KJ1A 1BC5A 1LNZA 1G60A 1ZCZA 1D04A 1RRGA 2WUWE 3GO4A 4WXRA 4EBFA 4YMTA 1BX3A 2C3OA 4S2EA 5IEJA 4LV6A 4G4JA 4GPEA 2GYWA 2OHJA 3R9XA 4EHAA 5JTUA 5A0FA 4DBVO 2PO7A 4FFNA 4YRRA 1I3NA 2JHPA 2ONYA 3DEHA 3FKSA 4IZHA 4PYKA 1Q3TA 2A5GA 1IG3A 1P7PA 1WULS 2JFBA 3GRPA 3MSXA 5DWQA 2LDXA 5CEJA 2W6IA 3GJSA 1A9QA 3MUFA 5I3ZA 5C7IO 2FPUA 2CLEB 3IHWA 4HXYA 3KTOA 4EA6A 2XKAA 4BP1A 5BNZA 2DCNA 3H9QA 2NW6A 3NR2A 2GN0A 4V2IA 3JQ7B 1SUEA 5CBPA 5HKAA 4LOAA 5IPFA 4OLJA 3BTUA 2PWBA 3OTIA 4KWTA 1PZNA 4M9QA 3T9EA 4EY6A 5EIEA 5JPCA 2JJMA 4LRSB 3DHYA 5BYAA 3ZWNA 2FVYA 2M32A 2IX9A 1GJRA 3QX3A 2YVKA 4B80A 2A8YA 4DTCA 4WZAE 3WSWA 1QOZA 2C0CA 2WD7A 2UXBB 3L1KA 2Z3ZA 3H1FA 4Q3KA 2WUGA 1N2JA 4TQAA 3T3HA 3KQQA 3RIHA 1LPMA 3LIPA 5ALQA 1JQAA 5H81A 4BO7A 3V33A 4YYEA 1BIFA 1EINA 2QRGA 1G5IA 2GEKA 4E09A 5BMVB 2IELA 5THXA 5LP1A 3BHIA 1O5OA 4OQQA 3H3JA 2Z5LA 2Q7DA 2C8LA 4PONA 3LL7A 2QI9F 3PEYA 3ZD9A 1EGVB 3IR6A 3CRMA 4HAZA 3HDGA 4FR2A 5KYWA 5AM0A 4C2TA 4DC3A 1OCEA 2DWPA 3AR8A 3OECA 3CBGA 1SGWA 5ALHA 3G2KA 4DSZA 1FFWA 1FFSA 2F1KA 2HMAA 5E8JA 1ANKA 4X1IA 2AS0A 4Q9KA 4IH1A 2I3ZA 4JP5A 3N05A 4CIBA 2NT3A 3F6CA 2Z3WA 4OBXA 1Z4NA 2FUG6 3ZWDA 1X1TA 5FDFA 4RLHA 1XAJA 1GU0A 4UBLA 2ZPUA 3W2HA 4BO1A 1OBVA 4Q7EA 2XCTB 3BULA 1QF6A 3P9QA 3KJZA 4KRYA 4RPKA 4BP9A 4EFDA 3PIIA 2VDJA 3H9UA 3MINB 2GD0A 1HPLA 1JH9A 1FNCA 1LLUA 3C1TA 4DOMA 4HYQA 1T8TA 4YAEA 1E58A 4COOA 2ZWMA 2QRHA 4L8WB 2WKWA 2XQFA 3BTOA 2RGAA 3K96A 3O9VA 3QW2A 3WJ7A 5JHGB 1B42A 1N6NA 3KB8A 2MMCA 4QPCA 4MARA 4MPRA 1XUOA 4NQRA 1QV9A 4YO8A 1XRMA 3SC3A 1R8SA 3WLFA 5JSKA 5K0TA 5I9LA 3O8LA 4NATA 1NVMB 5BSKA 2CHQA 3WYBA 3L4KA 4KIWA 4OYRA 2PUEA 3LGSA 3H5NA 3GLGB 1W76A 1VM6A 1OI3A 4N6NA 1RT9A 3KSRA 4RIGA 2QMHA 1JAXA 1WHTB 4G2NA 3P2OA 1B74A 3TRDA 3HZZA 3CH4B 4PRYA 4TKLA 3VC2A 3INGA 1X2EA 1X13A 1NVBA 1J20A 2WJIA 2WKPA 1DX6A 4RPLA 2B61A 3OC0A 4DVGA 3UKOA 3GZJA 3UHAA 3G59A 2FW8A 2C88A 2GBGA 3EZ9A 1B6SA 3DE4X 1S3GA 1FX0A 2NACA 3DDZX 4DMLA 4J7UA 3LYUA 4QPNA 1V6CA 1II0A 1DTWA 1NZJA 3TVDA 2VSFA 1OZGA 4HEHA 4HLUA 1T0IA 3I9V6 4NZOA 4X3OA 4RKQA 5DP2A 5K0LA 5JS6A 1HKUA 2WYOA 3DHEA 1CDZA 3QMPA 3WHKA 1OV4A 3D0KA 3EZFA 4FYPA 4JUBA 3LQYA 3VHLB 2Q3CA 5KSWB 3Q72A 4PSCA 4QUIA 4U6SA 3W05A 2H11A 2VARA 1PDWA 1AB5A 1NR7A 1E9AA 3QPCA 3K8ZA 1EFPA 2OFXA 3ZOKA 1ISMA 2AJPA 4PZEA 4CTOA 4DSAA 3DT6A 1P2UA 1Q6YA 3E1GA 1WB9A 1VJRA 3ZGNA 2ZVQX 1ZWLA 1THGA 2CB9A 3IVAA 1PQYA 5G02A 1RYNA 2O9JA 5HS6A 3WRYA 1YQXA 4RHFA 3LRTA 4R81A 5LA6F 4DPLA 1A4UA 2HRQA 5JNSA 4V2UA 3PE6A 3TB4A 1F0NA 3CUKA 4IAOA 1LSSA 1FTSA 1Z3CA 3OBBA 3R5HA 3LX5A 1TX4B 2WIFA 4JCCA 4KU4A 4AO8A 4Q05A 2PUCA 1ONNA 1L7QA 4Q7KA 2IUYA 5B2EA 1RZUA 3LP6A 3GH3A 2RE8A 5JZSA 3Q8LA 1LK5A 2WTEA 1JVSA 2YYYA 3DCIA 4KCGA 3IOEA 3KJIA 3W9UA 4CODB 1SD5A 4GP9A 4Y2RA 3KEFA 3L7OA 2XB9A 3OIUA 3RQHA 3VVCA 2LCFA 3CT6A 4UREA 1XU4A 3FNIA 4FZ3A 1LQUA 1WABA 2WK1A 4KKXB 1TI7A 4EEZA 5IXYA 5C8DA 3JQ8B 3NC0C 1H3EA 3LP5A 4HWRA 2JW5A 1Q50A 3D6MA 4EHJA 3VTZA 2SCUB 3KOUA 3Q9LA 5KWSA 4OU4A 3RBZA 4GXNA 2EHDA 4IDNA 1DLIA 4QBHA 5C8VA 2W71A 3F5SA 4QGBA 3T1HB 2VT2A 2HCJB 5DXAA 5D1NA 1N8TA 3BZBA 4LWZA 4U7WA 2QX8A 1E79A 3L79A 4OSEA 3KZVA 4C29A 3LGXA 2PX2A 5MN5A 3BF7A 3GUUA 4BWGA 3KIPA 2CLSA 5ERXA 5DNWA 1IEQA 1GO2A 4OPMA 3U81A 4CU5A 4KALA 2GZ1A 5KYWB 1DBPA 4TTQA 1J23A 5HF6A 4RD0A 2D1YA 1NXSA 1RWNA 1NJFA 3FR8A 3FCUB 4Q9JA 5TT0A 1OX6A 2WPDD 1E62A 4AJIA 5LUBA 4D3XA 3QVXA 1WKVA 3DLAA 5JJLA 2X5NA 1RXVA 1GZ3A 4LHYA 4KMMA 1K66A 2FPIB 4NBKA 1HQDA 1GHTA 3QU7A 4MWBA 4RJLA 5KHOC 1BD3A 4CN8A 2Z6UA 3RS9A 3NHRA 1E8MA 4B3MB 3TQCA 4AF7A 3TZKA 4G9GA 3MYYA 2XUOA 3FHYA 4N49A 4HXFB 1FQKA 1GGNA 4TMFA 2VHEA 2BBSA 1UJMA 1V26A 1JP7A 1E20A 3FPSA 3PGJA 2GF9A 3I2YX 3TUJC 4ZDKA 1Q7CA 4JKSA 4GR4A 4KFCA 4LFAB 3P9NA 4R1MA 5TGDA 4H08A 2ZSJA 3I5AA 3MWDA 1ZM9A 2COKA 5ALIA 1NTRA 1QYXA 4EUFA 5B6IA 5DISB 1O9BA 3N2IA 1NATA 5EUCA 1U7DA 4NH4A 2CYCA 4GBED 3NRCA 1UJ2A 2FH5B 2GRJA 4IWNA 3K9FC 1EVKA 1X92A 4KGZA 4KFSA 3U4MA 4FPXA 4HD8A 3ESAA 1P29A 1S2GA 2QGZA 3LZCA 4J0HA 1OYWA 5I3CA 3TLMA 1GCIA 2FG5A 4IVQA 1BMFD 2N1MA 1ZIDA 3AF6A 4QNRA 3L77A 3OOSA 4HH3C 4EG4A 3R3SA 2I6AA 13PKA 1T2AA 2GQ0A 4NS1A 5ECGC 1O94A 3MWYW 2DQKA 1LRKA 3MJTA 5JZMA 2YVLA 4NENB 4P4SA 1DQYA 5A9SA 3KDPA 4QYIB 3M49A 3PD0A 4Y6PA 5I9NA 2ZI6A 1NRJB 1KK2A 4R40A 4GOKA 2OQVA 1J1UA 3CEPB 3HKCB 3HCCA 4J2TA 2HLZA 1LPSA 4OM7A 4MKFA 2ZWAA 2J9FA 3TOSA 3L6EA 1J99A 2V7PA 2R79A 4CMIB 5H68A 1K5GA 4DJTA 3LV8A 4PN7A 2X0JA 2TYSB 3NYIA 1BXRA 2UYGA 5CLFA 1E7RA 2CJWB 4OI4A 4RY0A 1X19A 1P19A 1SQFA 3LVBA 1OFGA 2P79A 3A25A 4V24A 2Z5GA 4FQ8A 3IBSA 2ZT8A 1WSAA 4U7PB 1P1FA 2C2KA 2KMLA 2RHJA 2VP5A 3K5IA 2CDBA 2YBEA 2FFRA 2QPAA 2GYYA 2Z3VA 4D4MA 4MW0A 5HDQA 1N6RA 2XADA 2JFWA 3DO5A 1HYEA 2ZE7A 1NXXA 2TMYA 1N6HA 2ZIAA 4YUAA 4XQCA 2NZYA 3F73A 4MQFA 3PIRA 3PNVA 4M4SA 1RHJA 1I1OA 3ETJA 2FLWA 1UKAA 3RVBA 4M0EA 1AMUA 2WQ7A 2W58A 5TF4A 3TTXA 2AOUB 1K3FA 3RS4A 1F06A 1BS1A 4QRHA 4W5NA 1OWPA 3HKDB 2IXEA 3EFEA 3HU2A 1GNTA 1MB3A 1OVGA 1QHGA 3N7UA 2ZUSA