3RRBA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with amp
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 177
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrbA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrbA02
2YXTA 3BGKA 2ABQA 1UB0A 1KYHA 3MBHA 3NM3A 1DGMA 3VASA 4B8RA 3KD6A 1RKAA 4S1IA 4JKUA 1C3QA 3RT9A 3RS8A 4PVVA 4LC4A 3RQQA 2C4EA 2DDWA 1VI9A 5BYDA 5CGAA 2PKMA 5TRWA 1LIIA 3UBOA 3RTAA 2ABSA 3RRFA 4K93A 4S1MA 3UMPA 3HPDA 4DU5A 1TD2A 3QA2A 4JJPA 3RTDA 4EOHA 4LBGA 5F0ZA 3UMOA 4E8WA 4EUMA 4K8KA 5C3ZA 2AWDA 1EKKA 1RFVA 1JXHA 3FHYA 4WJMA 3OTXA 2HQQA 4YL5A 5EYNA 1RKDA 4DC3A 5BYFA 4LCAA 3UQ9A 3NBVA 1LHRA 4E8ZA 3RPHA 5CGEA 3ROGA 3ZS7A 3NL3A 4C5JA 1V1BA 2AJPA 3PZSA 3RU3A 2JG1A 4K8PA 2DCNA 2I6AA 3IKHA 3RTBA 4YWRA 3RTCA 4K8TA 2QHPA 4KBEA 3RSSA 3RO4A 5B6AA 4N08A 3KZHA 4K9IA 2PKFA 2A9ZA 3GO6A 2F7KA 3RSGA 3K5WA 1RKSA 3RTEA 4C5NA 2PKKA 3LJSA 3FHXA 3VAQA 5EY7A 4B8SA 1EKQA 1LIOA 2R3EA 5CM5A 4E3AA 3D3JA 3RPZA 3PL2A 4XDAA 3DZVA 4EN4A 4K8CA 2JG5A 2I5BA 1WYEA 3NL5A 2DDMA 2R3BA 4N09A 2YXUA 1YHJA 4O1LA 3W4SA 2HW1A 2XTBA 1ESQA 3B3LA 3Q1YA 4K9CA 3IE7A 3RQXA 4C5LA 3IN1A 5F11A 2QCVA 3DRWA 3BF5A 1V1AA 3EWMA 3RQ6A 3KEUA 3LKIA 3LOOA 4KANA 5BYCA 3B1PA 5C40A 3B1OA 3RO7A 4JKSA 3IBQA 3RS9A 3NM1A 3IH0A 4E8YA 2A9YA 3RM5A 2DDOA 2AA0A 3B1NA 3H49A 3KTNA 1UA4A 1VK4A 4C5MA 4O1GA 3ROZA 3HICA 1LIJA 5TQIA 1RK2A 1TZ6A 2HLZA 3ROXA 3B1QA 3LHXA 3NCAA 3RTGA 3RQHA 4KADA 3JULA 1LIKA 4GM6A 3N1CA 3RSQA 2VARA 1GQTA 3MBJA 4E69A 3RREA 3RNOA 1GC5A 2AX3A 4S1HA 4E84A 3I3YA 1JZTA 1V19A 1TZ3A 1VM7A 4S1IB 4U7XA 2V78A 2PKNA 3UQEA 3NC2A 3D3KA 3RRJA 1ESJA 4UBEA 2AFBA 3UQ6A 3RRBA 3GO7A 3CQDA 3H74A 3RU2A 2FV7A 3NBWA 1L2LA 4KAHA 1YGJA 3RQ8A 2O8NA 2I6BA 2JGVA 1LHPA 4XF7A 3RQ2A 3RY7A 5C41A 1JXIA 3RQ5A 3ROEA 4X8FA 4XCKA 3RSFA 2Q5RA 4C5KA 3GBUA 3HYOA 3NL6A 3QAIA 4LBXA 4XF6A 2NWHA 5COJA 2F02A 5BYEA 2RBCA 1TYYA 3NC9A 4EBUA 3RT7A 1V1SA 2AB8A 1RFTA 2DG2A 3IQ0A 3K9EA 2C49A 3NL2A 1YGKA 3Q92A 4KALA 3UQDA 3B1RA 1U2XA 2AJRA 1BX4A 1RFUA 5C3YA
chains in the Genus database with same CATH superfamily
1THTA 3FDIA 4BU0A 4F2GA 4H7HA 2WF7A 1GUYA 3MF4A 5JSQA 1P1CA 2Q2NA 5LU9A 4PSDA 3IUEA 1ZOIA 3LHIA 3O94A 3TB6A 1AKYA 2GVDC 1T2UA 1JNYA 1VJGA 5JAHA 2C0CA 1NXWA 1Z5VA 3WMWA 5C8XA 3U4CA 1XFDA 1QQAA 4QU8A 2IPOA 4E51A 4QTZA 7YASA 2WVAA 4ZJYA 4G4SP 2E2WA 4JR0A 4JJPA 1QYXA 2G0TA 4K0KB 1T4GA 2JA1A 1ZUNB 1QP0A 2FPPB 2REXB 3COPA 5BW5A 4E8WA 1JEQA 2VHXA 2C94A 2I87A 2F9MA 3Q2OA 4P53A 4US0R 4UNSA 4XJVA 3USCS 3UWPA 1PJCA 4YCNA 4OSOA 3KV3O 5TQ2A 3QXXA 1D6SA 2B8TA 3UKDA 2P9ZA 3JAMA 1VA4A 3AI7A 4O2RA 4YRCA 3KQSA 3ZDRA 2FFQA 4KDEA 3V8QA 2FMXA 4YN3A 3IO5A 3WQSB 4L6IA 2FCRA 1VG1A 4DJJA 3BA6A 1RFLA 2VWPA 4L8YA 2QRJA 3U4IA 4HT3B 2YUTA 1J1UA 3HO8A 4ZU6X 2JI7A 5ENZA 2GPWA 4LHXA 1X7WB 3CZCA 4IY1A 1B14A 4PWZA 4G1VA 1CJUC 1BE0A 3OURA 3TJRA 1MIOB 3WB9A 4L9WA 2CUTA 5JZVA 2KB0A 2F7KA 2WPDA 3F78A 2BMWA 2JB9A 2MSCB 2J7PD 2VTKA 3CO0S 2J3IA 2OV8A 3FXAA 1M75A 4P5PA 2C99A 3STTA 3IP8A 1PK9A 4J75A 5BW8A 1YMUA 4LJ5A 4Q3OA 3GK3A 5DPMA 1KAOA 3F74A 1L8QA 2C8KA 2R751 2XAAA 3ONNA 2FX2A 1Z4JA 5C5CA 2ETXA 2SCUB 5DCUA 4YRNA 3A70A 1NMSA 5FTLA 3KHUA 1NSYA 1EVYA 3ANLA 3NHJA 2JZOA 1VLLA 1IDN1 4K9NA 3ZY2A 4XJSA 2VS1A 4YASA 4UCXA 4C22A 3F90A 3CZQA 4BQFA 4YAJA 1B8NA 5EE1A 1W30A 2HZBA 2VSYA 3G0BA 3K7EA 3QFTA 1P3JA 3FMPB 4B4OA 2WWIA 3Q3GE 5A1TA 3KYCB 2IH4A 5ESWA 4BMDA 1ABEA 1D7OA 1FJ2A 4MVJF 2APJA 3DL4A 5EUCA 1GSAA 4HDKA 2CEAA 3V80A 5AM3A 3L06A 4TWRA 5KNDA 2HSJA 3A3YA 5YASA 3SHFA 2M98A 6NULA 3ZU3A 3KJXA 4KH0A 4C7VA 2WE7A 2QN9A 4ZVUA 3RUEA 1IONA 4C3ZA 3ZU6A 4HS9A 1I2MA 2QTGA 2MSWA 3MJSA 1JDJA 4ECAA 2CXQA 2QSYA 4C4RA 1P73A 4G24A 4PIVA 1DDOA 3UJNA 4FC6A 3KQHA 3B53X 5HQ3A 1GT6A 3PEFA 2MMGA 3Q7EA 2W6PA 4YMIA 2ZRPA 2WNHA 2EX0A 4BFLA 1QK5A 5JALA 1KSJA 3VH3A 4FHDA 1RKBA 5BN5B 1OPRA 3IURA 3KBOA 2GYUA 4ZN6A 5I8WA 5LFAA 3EPRA 1A82A 1TU3A 2EZ8A 3T4PA 4EBUA 3MFYA 1R6UA 1YB1A 4II7A 1AZWA 4HPJB 1LLUA 3ODGA 3F6CA 4RY8A 3CNBA 3FROA 5T6MA 2Z1MA 2VRCD 2Y3IA 3T3OA 3CPJB 4BB5A 4GPZA 1AZTA 3EE6A 1KMNA 3DDZX 1EZ1A 4FZVA 3SBXA 1BWRA 2CW5A 5BWMA 1WS6A 4XCXA 4TVKA 3HXOA 1X9HA 4Y6LA 4PXSA 1BE6A 1E3WA 1J0BA 2VL7A 4XTRA 4BKUA 4EMBA 4Z6KA 2IOFK 5CGAA 3U3MA 1I4OA 4KE7A 4NENB 3IEXA 1M9NA 3B1WA 2JVJA 3QV2A 4HDKB 4BP3A 4EP1A 1ZM2A 2Z04A 3LXMA 4I6GA 2ZIAA 5E7QA 2AK3A 4J6EA 4DJTA 4YRTA 5IULC 4JR2A 1T5HX 1T3LA 3LGAA 3P4XA 4JI6B 2PKWA 5C3ZA 2HNBA 2WU4A 1DC6A 1QFSA 2ZPAA 2GN9A 2G28A 3N8GA 4IUDS 4MRSA 1PKXA 4DC3A 1UF9A 2IDMA 2X2OA 4EB8A 2G25A 3KG2A 4JIMA 4YUZA 3C3YA 5EXPA 2WSSD 2C77A 4BZQA 1OGIA 1V1RA 1U8ZA 4C1NA 2HAEA 1E2JA 2WFLA 3H4TA 3NOVA 1JA9A 1R3DA 4EF6A 5JS7A 4TKMA 1RFGE 4BO3A 1IG3A 4IZ6A 4XEHA 5I3CA 1C8BA 3OQHA 3ZCQA 1O08A 1BXKA 4PLVA 1MO5A 1SY7A 2WPNA 1DAEA 4MW7A 1JX6A 1R27A 2YS7A 3DLPX 3AHHA 5M7EA 5FFFA 4E3AA 1W87A 4EHBA 2C92A 5KCZA 3VHLB 5SYMA 2IEDA 3QH4A 4DIBA 3D6JA 2ZIVB 2XUOA 4FMCB 2V5VA 2DU8A 2HSDA 3U19A 1HNZB 1H2YA 4GFDA 4ARZA 2GCIA 3BL8A 1T3ZA 4TXLA 5FNVB 3FJOA 1NMZA 4C2AA 2BN4A 4AJJA 3LOOA 4RVUA 1OW3B 1OVMA 4US1R 4CXMA 3KOYA 1UZNA 2HF8A 1P2VA 2O8BA 3IJPA 3GZNA 1I3CA 1JN0A 2FV8A 4DM4A 4ZOLA 3G5TA 2RARA 4ZPJA 4MLZA 3CIFA 5EJ9A 1EJ6A 3VO2A 2EYQA 3UQZA 2EV9A 2FPIB 2X8JB 1ORWA 1EXMA 3VZRA 3G2QA 2J33A 3CVVA 4PQRA 3KSBC 1C3XA 1U7DA 3A14A 1EM6A 1CCWA 2EAUA 2GZ3A 3HCOA 1U0NA 3DV2A 5THXA 3L8FA 3SZRA 5BWCA 1AGXA 1PKEA 1PQPA 1XN1A 2B0CA 4BE7B 4AMBA 3U26A 4QC2A 1M1ZA 3KOMA 4GC9A 4ID9A 1YBFA 3SU8A 2Y1KA 3V8RA 1KDPA 3BG5A 1XXLA 4B3TB 3KJGA 1DO0A 1FW6A 5CBPA 3E0QA 2ZPTX 2BKLA 3K9GA 3IHKA 1PNTA 1E98A 2DKOA 4R8LA 3SF8B 1K1EA 3VJKA 2HGZA 3I0ZA 2M6SA 5JTTA 4UTVA 2ZZKA 3SBDA 3BXFA 2ZSHA 1SD2A 3FWKA 1PIWA 1VE6A 2JL1A 2VSOA 3MYYA 4YDRA 4QATA 2Z95A 4F5EA 4HNTA 4KQIA 4UM8B 1CETA 3DTYA 4G1EB 2C4NA 3BGWA 3EIWA 3R76A 4DBLC 1E77A 1M5TA 1DRKA 1ISPA 4DCPA 1U2XA 2H1SA 2IBTA 2OCKA 3HGQA 4JASB 1GTJ1 1KFKB 1QTRA 4L73A 4PFJA 1T29A 3N0XA 3RJ5A 2QQ5A 4PC6A 3NWJA 4CDMA 3OY2A 4GYYA 2VJMA 5JYBA 3RVKA 2RSLA 1P17A 3VKFA 4NYMR 4HQRA 4AKIA 2Z9CA 4I55A 5E6UB 3Q98A 4HNUA 1VYVA 3MQFA 3EULA 1ESNA 1O8CA 4H08A 4FFSA 3P32A 2MWMA 2C5EA 1QLHA 1G8PA 4RFSA 3ZYCA 4CL0A 4JV5B 1OC4A 2J32A 3CJRA 5TGZA 5IUJC 4YVFA 4K8KA 1GKYA 2ONYA 4EL0A 1NPYA 4OQFA 3SSOA 1NN1A 3VPHA 3TCNA 1V5IA 1XMQB 1GRCA 1HR0B 1V7CA 2IYTA 4HHEA 1L5GB 3FHJA 2TS1A 1WUYA 3RGGA 4ZV4A 2FYTA 4XYBA 1DWPA 3JXEA 1DL5A 1GZ7A 4DGSA 3EQ7A 3WXMA 1F8XA 1RYMA 2C4TA 3TZ6A 3L40A 3WLQA 4I8IA 2PD3A 1QFYA 2IWRA 4B8ZA 2IXFA 1IMOA 3FNFA 4IUCS 4B34A 3UCEA 3ZHQA 2CV0A 2Q29A 3JYOA 3RUPA 1JRLA 5EERA 5K0NA 3PC4A 1M73E 1NF3A 5CDTA 2FEPA 4A2CA 2XYQA 2VDQB 3BJMA 2PLRA 3FOWA 3HU2A 1AKMA 4HNAB 1YRAA 4KUEA 1Z37A 4D3ZA 1C80A 4EQ6B 3IUNA 3UA3A 2CL0X 2MR6A 2W90A 2W4IA 3A3PA 3HZZA 4TT8A 5K3FB 3FPEA 1ZP6A 2V5UA 4HGZA 4Q24A 4RZHA 4TXNA 3TFQA 4GL4A 4LQCA 3JQGA 2G6BA 5JY1A 2J3HA 5LZ7A 3VYTB 3TIGA 3C98A 2O5VA 1N5JA 2RGEA 4MHTA 3X2EA 3V2UA 4PNZA 5HSGA 3O8QB 1NRXA 5CW1A 4RETA 2FPGB 1HC7A 2QMEA 1ODTC 1P81A 4R2IA 1FNSA 1UK9A 1XRRA 2X6TA 3L0OA 3W9YA 2WR8A 1VI2A 2Y93A 1UZAA 4QSHA 2R4QA 4NCKA 5HJ2A 3B1NA 4KRXA 5TS2A 4HBGA 1EDZA 2GZRA 4KK4A 4MLCA 4HMOA 3G9TA 4MQ5A 4FB4A 1Z17A 1XZFA 4ZQIA 5AQEA 3STVA 5IH7A 1RK2A 4ZCQA 3OZGA 4N47A 1W35A 1XHLA 1Z08A 3Q9SA 4Z8YA 4QWWA 1TOAA 4FKBA 4B3XA 2TYSB 1U1EA 3BN3A 4O33A 4BFXA 3O74A 1QYDA 1POXA 2FGKA 4LCJA 4C0SA 3F5MA 3FFXA 2CMFA 3JQAD 4MW2A 5HF6A 3QXJA 3U80A 2OCAA 4NYIR 3KXKA 1J09A 2XOXA 2Q46A 2ZE6A 2I2XB 4AY5A 1XEAA 3IQDB 2BE9A 4XEUA 4XF7A 1KC1A 1IXSB 3R6DA 3K05A 3BSYA 3QLVA 4AYXA 3BZUA 1S9HA 1QTNA 3EFHA 4WNIA 4ZALA 2R00C 2Q45A 3K92A 2BHNA 4OBXA 1ATIA 3O95A 2SHKA 1NG1A 2XE6A 4KXWA 2NQ8A 1JHYA 3F6YA 4LKRA 5CFPA 4MMZB 2CXOA 1D8AA 5SZHB 2B21A 1QNLA 2R6DA 5K5EA 4G23A 3C0KA 2OOSA 1ORDA 1YZLA 1DAHA 2OM2A 2QLJA 3C7TA 4RDXA 3GAZA 2XUHA 3GNQA 5LUBA 1C3QA 3AIMA 2KJQA 1IUNA 2FUCA 4DWVA 1DNPA 4CYMA 1JUDA 1TYEB 2WFMA 3JW8A 1TFRA 1I4LD 1JNXX 1CZNA 4PLFA 5BYDA 4ARZB 2A0FA 5B58T 2A5YB 2WM2A 3G89A 3OD5A 4QAQA 2I6UA 1KO4A 2C3OA 2V0NA 3NAMA 3OWXA 4IEFB 2GWHA 4RL6A 4V24A 4YNBA 1HT0A 4A1OA 1GOTA 2P5YA 4FYHA 2VA8A 4G5YA 4FZJA 4J49A 1BD3A 3AOEC 4AF8A 2PH1A 4JS0A 1HETA 1H0SA 1H23A 3IMGA 2BAGA 1OJLA 2YV5A 2WOOA 3E2MA 3H7AA 1LI4A 1J9ZA 2F3TA 3D6FA 3QF4A 4YRDA 4R8SA 2P6MA 3PHCA 2CUZA 2XT0A 5HMLA 4BKMA 4DYVA 2MR5A 3QEOA 2GDZA 4IDPA 2B1JA 2BFCB 5J4LA 3UB4A 2RHWA 1A27A 5DKFA 3SJZA 5ILGA 1MA3A 2O5EA 4IIUA 4Q3CA 2BI8A 3E48A 5FH9A 1XDSA 2AJDA 2NAPA 2OPHA 3WLNA 1H9AA 5EP1A 1ZK1A 2R7KA 4UULA 3IAS1 4ZFNA 1XZBA 1B0PA 2OD7A 3A3KA 3HEBA 4H7JA 3PHLA 2ID9A 4O0LA 4JLMA 1FNCA 1TM3E 1KGSA 1U7WA 2JPDA 1BAPA 4XX1A 4CUJA 3WGTA 4TL6A 1Q1QA 3CVOA 4LY3A 1CQZA 4YXFA 4HWPA 1R4ZA 4MB2A 3AR9A 5K8IA 5KOIA 2PJRA 5JZOA 2DUNA 1DV1A 2NPIA 2B92A 2IHNA 2O2CA 4MWDA 1II8B 2P0YA 2OV1A 2ZCUA 1JR6A 2IY8A 5E7IA 4CF6A 1U2GC 4ABTA 1OLSB 3KELA 2Y1WA 1XHFA 4HTFB 4J0HA 3ACDA 3QW2A 1VLHA 4PCUA 1H2ZA 2JIPA 2XMQA 3PPWA 4O2AA 2RH4A 2RBGA 4LOIA 2BM0A 2IIPA 5BSTA 3WNCA 2ZM6B 1K6MA 2HF9A 3C5WP 2Y6UA 2W2KA 3BSFA 3E5NA 3HJAA 3HKDA 3P2OA 4P0TA 2V6JA 4ARVA 4F97A 2B4YA 3DL7A 4JX9A 1LIJA 4RZUA 5JDCC 1YDWA 4UUBA 3GFVA 2EDAA 2VXBA 1CU1A 2WG0A 2ZUWA 3H2BA 3W34A 1QPGA 3L0PA 4NJEB 4YGXB 1JKJA 3AR6A 4RADA 4JLWA 1JMVA 4DCMA 4ITVA 3AUYA 1KI1A 1VIMA 3KTAA 3OPQA 3PDUA 3W90A 1ESJA 1JG4A 5LP1A 2IU4A 5KSYA 3P9KA 1E92A 4AAYA 3N53A 4XWYA 1N0UA 3E22B 4RQAA 4UATA 5JH7A 2NZ8A 2OXFA 3WWEA 1K75A 1ZGAA 2OBNA 1V2HE 1B0UA 1M66A 2V3VA 4MQFA 1T6BY 1BEZA 2QGNA 3LVBA 5ALOA 2O6HA 2L19A 4E15A 1JHMA 3NV9A 1V7PC 1J8MF 2WUGA 5E4TA 1CZRA 2WQ6A 3MGGA 4M99A 4IIHA 1UEXC 3CZ5A 4Q3LA 4RH1A 3TX2A 4ZI3A 5D3KA 1E69A 2W8BB 2Z2YA 4GI5A 1QE5A 1XVAA 3SM3A 5KX5F 1QX3A 2QQGA 5K3CA 4ENRA 4BAGA 1TUGA 4LNAA 2ATEA 1NP7A 4AROA 2QSUA 4CKCA 1CJBA 1OTHA 4HH0A 1J8DA 3ANMA 1W29A 1W0JD 2D1TA 3ISJA 3PD0A 1Z06A 1WX1A 5CVCA 1FSZA 1IXRC 1J97A 4Y18A 3NS7A 4LN1A 1V1MB 2DWOA 1PWEA 1TZJA 1V16A 3GT3A 5DYYA 1NIPA 4C1BA 1HY3A 4LZWA 1V5EA 4M1TA 4J7CA 5CTJA 5JO0A 3A6ZA 2A78A 1T4CB 1ZMTA 1K66A 2HX1A 4H4EA 4GI2A 4ZJUA 1WU7A 4J1QA 2BW0A 2WQZA 2OXRA 3OOWA 2GEJA 1F48A 4I1RA 3VNQA 4D79A 3NYRA 1K86A 1CY1A 3V1MA 1BS1A 4WADA 4IR7A 1JHPA 1PL0A 3U3DA 2NUPA 3EF0A 3W1WA 3RQ8A 2C4KA 4XA8A 5K2OA 4A1FA 2I3GA 3K0SA 1VLMA 2YKGA 1Y3BE 3LY9A 5CHYA 3CH6A 1Z5PA 3IXQA 1P9NA 4JBHA 3U7IA 4MO2A 3J80A 4JB0A 1DELA 2DCNA 3HR8A 4JOBA 4XGRA 1PJZA 3EQ9A 4QG3A 2Q3EA 5JIBA 2W2LD 1FTQA 2QMUA 3HBFA 1DKQA 2FEMA 1YBVA 1MABA 1Y3AA 2EKPA 3CVWA 5L45A 1W7AA 2ZIGA 3CM0A 4ZT4A 3EGWA 4I1OA 3RM3A 5ITWA 3V4FA 4MQUA 1N33B 1W4ZA 3MWKA 1LB1B 2ZIXB 4HNAA 3MM4A 1KE1A 1Y4AE 1K0UA 2Q3JA 4BO1A 4OB7A 3ZIAA 2FF5A 2X6QA 2J0UA 2FKAA 2XYRA 1ILWA 2YJ4A 2ZRBA 2WHRA 3ENKA 5ALYA 3D7NA 1IVSA 4CMCA 2M9MA 1XVUA 2JATA 4TRJA 5IW8A 2WIJA 3BAZA 1G7CA 2D13A 2XITA 3Q0EA 1UQRA 5F1PA 4BQNA 4CL2A 5JUWA 2WHPB 1JG2A 4X24A 3CE6A 5KYTA 4BBAA 5K3EA 4RF3A 2WYWA 3WRXA 4G2TA 3LX4A 1ADCA 3RFTA 1OLUA 1TYAE 3A0RB 5IABA 5ALQA 3ZQ6A 4JUDX 2RGCA 5AH0A 2X2PA 3PGMA 2GDJA 2NZ2A 1GV1A 3BK2A 4BWFB 3PNMA 5LB2A 5F98A 3KKPA 3HXMA 1JPJA 3FKSD 3ANTA 3QQPA 2W00A 3HYRA 3JWGA 5LD2B 1NQXA 4YP1A 3NIDB 4PSAA 4S1OA 2PL3A 4DR2B 5HF5A 3OM0A 3GXBA 3ADKA 3G23A 3KLNA 4MW9A 4JBIA 3UAYA 5JCOC 2F55A 5BN4A 1L8AA 5B1HA 2ZYGA 3IMFA 4JLKA 2PUJA 2ADFA 2JFNA 3R2JA 4O3FA 5CBKA 4CG2A 3DT9A 1DQNA 1E9DA 1KAHA 1SQ5A 4JEUA 1P61B 4M86A 4J0DA 3RYHB 4IS2A 1EH5A 3H5NA 3STYA 4B85A 2PQ2A 4CQJA 1KJZA 3S7ZA 3WADA 1VKRA 2FR8A 4A27A 2F2TA 2QXYA 1I80A 3P97A 2HRQA 2YYAA 1FRZA 4OA5A 1XQ6A 1WXXA 1AN0A 3F7NA 1TYZA 3G1TA 3ORYA 1AHHA 1Y4ZA 2ETVA 3D6AA 3FCXA 3O4RA 3ZR4B 4LJ4A 1WHSA 3UJAA 1EX6A 1JQBA 2WD9A 2V97A 4NH4A 3T3GA 1PZNA 3K2IA 3GPCA 5K0BA 2G9ZA 1SWWA 4X44A 4IX1A 5B3LA 3AY3A 3FY4A 1N0VC 1G5RA 3WA7A 4LV6A 4BNTA 1ISSA 1US8B 3KS9A 4OOEA 2OG2A 4EGJA 3N8NA 2D00A 4EVQA 1XZPA 3T5MA 2FUNB 2HT1A 4CR8A 1R5OA 1RACA 5CPBA 1CDZA 1UKBA 3Q6IA 4H6PA 3WLPA 3WKBA 2OY0A 1A69A 3D7KA 4I46A 4B7UA 2VPWA 2WAXA 1KI6A 4Q47A 4AMZA 5F0ZA 1LQTA 3NEPX 1LSSA 2VSFA 1XC7A 3L8ZA 4ZGBA 1PDVA 2I4TA 2BHSA 3LV8A 2QY6A 3GVCA 5F5LA 2VTDA 4ER0A 5KZMB 3PEYA 4I8DA 3FETA 1Z6YA 1UPUA 1DRJA 4M53A 4WY2A 1SHKA 4G2NA 4U6NA 2J9FB 5DSTA 2E5WA 3BD8A 1XCGB 3KKLA 3RANA 1JECA 1RIFA 1FU4A 1W6RA 2MDTA 2PZJA 4ZEOA 2NN3C 3NTOA 3HWRA 1OILA 4UKDA 4ARBA 2R5FA 3GY0A 4G5RA 1XTBA 4D9KA 3I2FA 6CHYA 4PRKA 1F12A 2ENWA 3LC0A 2X0NA 1W36D 3QPWA 1NUSA 3GO6A 1PJ2A 2XUQA 4I66A 3AEUB 2GZAA 2D54A 5DBGA 5I51A 1J20A 2OBXA 2IV3A 4BZWA 5JNTA 2PUGA 1ML3A 1LRKA 2FQQA 2IP2A 1M1NA 3KB1A 4R2JA 3C7CB 2VQ6A 1ODKA 4EPWA 1KY3A 1MMFB 4MUJA 2X1LA 5IAGA 3QIAA 4MZXA 4EJSA 1I10A 4NE2A 1UBNA 1IY0A 1JS1X 2WF9A 2XOKA 1BRMA 4I14A 2XNSA 4O25A 5KWJA 2XADA 4LBVA 1E8MA 2WOJA 4B4UA 1SZJG 4EKIA 3EEIA 4D4GA 4Q6BA 4OK3A 1KEUA 3NDRA 1LZKA 3A6PC 5NULA 2VBFA 1H5UA 3EWMA 3QX8A 4Q02A 5FOUA 2E48A 3EQ8A 1OKKA 5H59A 3DCJA 2KMLA 4V0OA 2AVDA 1JJAA 1VMIA 1YUNA 2DHEA 2W6CX 2CWWA 3RS9A 4LYDA 3JV7A 5LOVB 3HY3A 4E8YA 1XU7A 1XEWX 3K3PA 3RM5A 5BN5A 1YB6A 3KTNA 3UG7A 2C98A 2EL7A 3GN2A 1X1BA 5ED0A 5P21A 4DLYA 5JANA 2I78A 4U8GA 3TW0A 1KEEB 3HICA 2EFHB 2C8LA 5EEHA 5KTRA 4ND5A 3M49A 3MQ4A 3EVGA 1PR4A 3PJDA 1VBKA 4E7OA 1H5QA 2P6OA 2VK1A 4ETNA 1PNVA 3HDJA 3IEPA 4OXIA 4CM8B 1M6NA 4KIFA 1XZAA 1N6RA 5EWLA 3BCUA 2GJAA 2X7JA 1KZ9A 4B9EA 4BGIA 5IS2A 4WD3A 2PZEA 1N5OX 3NFYA 3DMGA 2XYPA 3PJEA 5AVYA 1K5HA 1YH3A 4DA7A 1AS3A 2EQBA 2D1RA 1K98A 5LBTA 3O9VA 1OLXB 4KPFC 3OLVA 1NA5A 1UJNA 2GLXA 5BURA 4RXMA 1W25A 5T64A 3LMKA 2REQA 3HYOA 5JARA 1B42A 4L1KA 3ZTYA 5SICE 1T91A 2C9DA 2VNJA 3JD2A 4GC5A 1HL3A 1WPQA 2WV9A 3AG6A 1D6NA 4K6MA 1I8TA 4BQQA 3DAOA 4XWKA 3IEUA 1I32A 1NUQA 4P7KA 4PINA 1CZKA 3FAKA 4Y67A 3URMA 4LVCA 5LZ9A 2YXDA 4MNTA 1CD5A 2GBPA 4BVAA 3HLTA 1GTMA 3DWIA 4BNFA 3L1HA 4BS9A 3LA6A 2XTJA 4GSLA 5ALSA 3UCXA 4KGXA 4W7SA 1NU8A 5E1DA 3W9BA 3RQQA 1XV5A 3NWOA 4J0GA 3EVTA 4OD0A 2RGNC 1YQGA 4RABA 1G291 4FEEA 5IM4F 2D0IA 1AHIA 2VJOA 2W2MA 3GOQA 3PT5A 5DH9A 5I7HA 3K53A 3R0QA 1VIVA 1EFCA 2H63A 3G68A 4AJPA 3QX7A 1KI2A 1Z4LA 1QB8A 1UXIA 3EVFA 3PHGA 4G1FA 4WINA 1OB5A 4PN3A 1DVRA 3DTVB 4BMCA 3S2UA 2DWUA 3L5OA 4RCYA 2FI1A 2VQFB 1CLEA 2CF5A 2HWWA 3OMLA 3BFPA 4M88A 1NQOA 2NNWB 4RD4A 4Z4CA 1AV6A 2EZTA 2F48A 1QGDA 1IOZA 4K87A 2GRAA 2X0RA 2EJTA 4HQ6A 1AM4D 3JASB 5IJXA 3F3SA 1Y0BA 3OPNA 5K0GA 1E62A 6ABPA 4ZZ0A 2X0KA 3SOZA 2HIMA 5K0EA 1CY0A 1W49A 2H4YA 3O1HB 5AP9A 5JECA 4FKMA 3BWXA 1GKLA 2JFXA 2BT4A 2N9UA 2ZWMA 3D0OA 3F0TA 4UU8A 1GZUA 4NAHA 4FYXA 3AMVA 3RWOA 3W8DA 4D46A 1K0FA 1UMCB 4O8CA 3HRKA 5A9SB 5FWYA 4CVMA 1G18A 1RXIA 2EP8A 2EBFX 2GRUA 3VSBA 1XKXA 1K8RA 2NOAA 4QGFA 5CAEB 4R6XA 4HLUA 3LHDA 5C4GB 3B7PA 5CM5A 4NMLA 3R5XA 4JZKA 3H1BA 3VVBA 3TNDA 1VE1A 3NTRA 1RWOA 3QU4A 3RBZA 3AF2A 4M21A 1C30B 2ZVDA 2QN7A 4WXPA 4KITB 2FW7A 3QUQA 1IRXA 3ZZUA 4NMMA 4AT1A 2Y9MB 3DE1X 4ZEXA 1E1DA 3GUZA 4G5SA 5I4CA 5AJUA 5B6PA 3RFVA 2GAFA 2ZS9A 3KSUA 1V1AA 3P5SA 3TQRA 1HDCA 3KEUA 2H1RA 1ZRMA 4C3OB 2NP7A 3QVWA 1N3IA 4KRGA 2XMGA 1XLTA 3LVFO 5K3FA 3UJDA 1V7ZA 3CZRA 3RS4A 2EX4A 2EC5A 4L0CA 4EJ6A 5DO9A 3SDBA 1ZUNA 5DNDA 4EKYA 2R8XA 2HFJA 1NXSA 1YQEA 2I33A 3E5HA 4O4IA 2Q3CA 1P60A 2EYUA 2Q1YA 3OIGA 3W1VA 3TTYA 2BE7A 1E2KA 2ZJ1A 5J23A 1JBEA 5J2TA 2GERA 5EHIA 4A7PA 2MINB 2AE1A 2JLYA 1ITZA 4YBZA 1JZTA 2X4DA 3GVPA 2YTZA 1F38A 3EHEA 4XOUA 1YJCA 3ZIAD 5IT9A 4DB4A 1SXQA 4G1UC 3SZUA 2R7AA 5J4HA 4F6CA 4KLZA 3KZNA 4CFYA 5KVSA 3A4NA 4MR8A 1PWZA 3MWGA 3H74A 4Q16A 4WASA 2FLVA 2F3PA 3NPMA 3A10A 3ZXXA 4EHHA 3DDWA 4C7OA 3C3DA 1L4EA 4QYWA 3DKKA 4D4IA 2W98A 1J0XO 1XIVA 3E9MA 1PL6A 1MB4A 1ZYUA 1KFCB 2ISSD 2JKZA 3GRZA 3TBHA 3UH0A 4TRNA 3W4JA 1N2HA 3FIJA 3L0YA 2NPFA 1R9GA 1O8BA 3AKEA 3SCZA 1O7JA 3ZGLA 5LZ5A 5LKRA 4I36A 3CR7A 4H7FA 1K2WA 1TMKA 3QU7A 5EZYA 3BWMA 1Y9JA 4HEA1 4C0HA 2YXTA 1I9CA 2PWPA 3HJUA 1KI8A 4KXVA 4UMFA 2R60A 4JYZA 2K7ZA 3LC7O 3HVJA 2WWHA 3P9QA 5SZKB 1COWD 3OZXA 4JYBA 4OX9Y 5KTPA 3G59A 2VP4A 3T5PA 1CZHA 3M4NA 4ENWA 3QE3A 3PHJA 1MOZA 4HRYA 4M7PA 1EM8A 3T06B 3E5RA 2NP6A 4G3XA 2J09A 2FRDA 4WI1A 1RZVA 5DLQC 3PYLA 3KL2A 3GMIA 2X15A 1RPZA 4K6HA 1ZK0A 4IP0A 2I55A 4IDFA 1IJKA 3S0JA 3MHPA 3BE5A 1ZESA 3QY0A 4BMZA 2DR3A 4ZVKA 3ADCA 1JWLA 4M1MA 5LDGA 2ZWPA 5AI8A 3IRVA 3OTXA 4MYSA 3LIIA 3N2EA 1NI3A 1UXHA 4L4UA 1ZXBA 3I42A 5GZ6A 3R8XA 4C7XA 1ONPA 3P96A 4JYPA 4HZUA 2OYSA 4DA6A 1GZ3A 1AQUA 2G1JA 3SR0A 3B8EA 3WHLA 3HDTA 4LG1A 4NDZA 4C5JA 2HM7A 1RS0A 2C5AA 2NVBA 1Q12A 4EX6A 2M1XA 5ERYA 3ZWMA 5C51B 2CV1A 3DZGA 3QEJA 721PA 1IN8A 3DT8A 3ZW8A 1T1RA 3BM5A 4ZT2A 4S2EA 1EGQA 4V0QA 1TVKA 4A6XA 2Q0SA 2R00A 3AUFA 3K6JA 4O4JA 1VXOA 3MGKA 1X3LA 1IL0A 2PAFA 3JQCA 2J8ZA 4F5ZA 5KQLA 3AWDA 4RDIA 1E59A 3RTEA 1G7RA 1ECBA 1X6VA 5U4QA 1H85A 1TJ5A 3EQ6A 2D62A 3EFBA 4YPVA 4YP9A 5KTSA 5AVSA 4D9IA 4N5IX 4P7GA 2VF7A 3F7OA 4ZHQF 2Q5LA 1U8UA 4CIWA 2ZJ8A 2G83A 1IG0A 3JR7A 5FV4A 2AQ8A 4UCWA 4U2EA 1LF5A 3Q1YA 2PVCA 1BX1A 1YZNA 3EIHA 4L8FA 2ZT6A 2I2AA 2TMKA 3K4HA 5FKJA 3W8NA 2ZBVA 2ZROA 3AB3A 1RD4A 2H52A 2R3SA 2WWTA 5AOCA 1U7OA 2I4OA 2A88A 1G2QA 3L1VA 4Q12A 4TOIA 3WLLA 3CT6A 5B3AA 1E2GA 5BSFA 3D2LA 3A4YA 2JCYA 4IDDA 3TQTA 4B6EA 2DPHA 2O7SA 4ZMSA 1I3KA 3M3DA 3H9JA 2IXTA 2WI8A 2Z8XA 4YDHB 2IZZA 4AXXA 4ZEMA 1YC2A 2F3QA 5DX0A 5KYYB 4RFSB 3FOCA 3QWBA 3O4JA 3E58A 4LV5B 2HBRA 3UFBA 3VYSB 4A5SA 2I6XA 4RD2A 3B3QA 4FBMA 2JAOA 2IX9A 5GINE 1PZMA 1XMJA 2QTCA 1GV0A 2BI7A 4FJ2A 1OFGA 4JHXA 4B4WA 3DLHA 2O19A 5ADVA 1VBFA 3DAFA 4QUHA 3O75A 2H0QA 3KCNA 3SOPA 3GZTB 2AI2A 1RPNA 4J1TC 5F4ZA 3UJPA 1BVUA 2A94A 2QRZA 1Z2PX 4BX2A 3SC4A 3OZBA 2DX7A 5A6SB 3RU2A 5D3ZA 4BNWA 3HN6A 4D0LB 4ALIA 1WW2A 5LXTF 4EKEA 2AH5A 2W2PA 3RQ2A 1DCFA 2ZR0A 4ZV7A 3S99A 1X87A 2ZTVA 1YJQA 3L6BA 3UW1A 4DTCA 1T9GS 2Z5FA 3ZXYA 1RR6A 3ZU2A 3QAIA 1CQJB 1I51A 1CEXA 4PZZA 1ODFA 2GK6A 3DXFA 1K92A 3IS3A 4MHOA 4YGYA 5BSKA 3R5SA 3VR2A 2CDCA 4TUYA 4QUDA 5GZ3A 2PLNA 1O0SA 2AXNA 3OOEA 5ALVA 2XIJA 2ZBEA 1QIEA 3LCJA 2YIMA 4Q34A 1Y7LA 4IH9A 1JBWA 1UMBA 4R1MA 1KAMA 4KBFA 4DNOA 2OCXA 4F3KA 2F1RA 4MUFA 1TUBB 4DWOA 3PEEA 4FOSA 1FYFA 1QGUA 1Y6RA 4CM4B 2EFCB 2IOYA 3NX4A 4HN2A 5AM5A 3LXUX 4CKWA 1VI9A 5BRNA 4UBNA 1R7RA 3FRJA 4UM9D 1YAJA 4XXHA 1AZSC 1A7AA 5INTA 3F1KA 1JFRA 4AP6A 2W48A 3UWDA 2ZUDA 3UMFA 5JJ5A 3A1UA 4GDMA 3HSYA 4TLLB 3BH6A 2Y0DA 2CLLB 4GS5A 1LUAA 1PSDA 4YR7A 4MYUA 4YI5A 4ZA2A 4Z2AA 421PA 1VZ3A 2LDBA 1NXQA 3D64A 3FUXA 2EWMA 2Q49A 8LDHA 2B83A 3RFFA 3L0CA 2P6NA 1W8DA 3AL2A 3GZNB 3RGWS 3TW8A 4PTYA 4BYGA 4CCYB 1CUCA 3RU3A 3QEAZ 5AXCA 3OIVA 3R0VA 2VRWA 3C16C 4QXQA 3MC1A 3M1AA 1LPPA 4F4DA 4IW3B 5I7SA 1UBKS 3C3XA 2EGGA 3MIZA 4I19A 4NFYA 1EWVA 4WE3A 1E2NA 5LYJA 3V9PA 4UM9B 2G0NA 1ORHA 3WLRA 8ABPA 2ILTA 2O7QA 5KYUB 4TTSA 1GPKA 4RKRA 1USKA 4AG3A 3CXUA 4ZVLA 4DREA 4P0PB 3KPUA 4OYHA 2XVAA 1CJTC 3Q0TA 4RHYA 2EJUA 3T7EA 2E49A 2O4UX 5EE5B 3CN9A 4HDMA 3GNTA 1KTIA 1TUEA 3MJCA 4ER5A 1B6SA 1AY0A 4BNDA 4CF5A 4F4UA 5AWFC 2MSLA 3WIDA 2Q7OE 2WP8J 2WYOA 2ATVA 4C08A 3HBAA 3UHOA 2I6GA 3C4VA 3IE1A 3DEJA 3KPWA 1SJ9A 3TWOA 1SD5A 1T3SA 2EVWX 5FJIA 1ZEMA 2BEVA 3G1WA 3DA8A 1X7XA 2ZI7A 2PL9A 5AKHA 4EF5A 1XU4A 1CUDA 2RH5A 3N58A 5AW3A 3TOXA 2A9QA 1DG9A 1FPQA 1K3UB 1NM5A 4FOLA 5HYVA 4L5AA 3GHHA 4WCFB 4TKUB 2TMGA 2HR1A 3W5UA 4C14A 3DVAA 2P0EA 4QNRA 1F4VA 5CRIA 5EWLB 3W2FA 1XZKA 2CL5A 5AHKA 1WKBA 2ATIA 2X5OA 3O26A 4MB6A 1R50A 1IXKA 2QZ9A 1UAYA 3S3TA 4E84A 2JGDB 1EB9A 1HQKA 4QU5A 2OO5A 5TMBA 5AFSA 3ZEAA 1V6SA 3QKIA 4HPWA 2IEGA 4IQ8A 4WKNA 2OXTA 2XCSB 1PBTA 4FW8A 4OAPA 3I9OA 1NVEA 2JCSA 3I92A 4C0KA 5FBWB 1YCDA 1DIHA 3SAJA 3K0BA 4BKRA 4LDZA 3W3AD 1W36B 2ZT7A 3U13A 2I6BA 2PDAA 1HSOA 1KBOA 3HY4A 4LF9B 1R18A 3H4IA 2XCOA 1S96A 2VWQA 4GYJA 1XMOB 5HE9A 2RJOA 2VT2A 3CS3A 5H5JA 3CO5A 4H17A 2Y1DA 4NWIA 3RVLA 4Z4EA 3ZWQA 4QM6A 2FEXA 4PYJA 4MS4A 4LIPD 1N5LA 1PR3A 5L4SA 4ITRC 3PSHA 5C1PA 3HRIA 4DR7B 4LSMA 4I50F 3D6VA 1KI3A 4DM7A 2F1OA 1PJSA 3WQQA 4DILA 2HSGA 5HIJA 3KQPA 4LGMA 4YK7A 3LVQE 2GN2A 2H17A 3EXEA 4X1OA 2NZUG 2VHVA 5EI5A 1PUIA 1N92A 3GLIA 3Q12A 3FNIA 1Q84A 3ZD9A 2FLWA 4ZCPA 4F1JA 4QJIA 1MO4A 5TPZA 3A32A 1PGOA 4YROA 3ZJ4A 3AJ9A 1HEUA 4CTKA 1M2WA 2BUCA 1SC9A 4OQ4A 3SQDA 1ZR2A 1FUEA 2WW8A 3E70C 4EO9A 5IASA 4DDWA 1GG8A 3DAGA 2Z6AA 1L5SA 3UWKA 4GKKB 2I1QA 5IRCD 2G82A 3B12A 1WTCA 2G08A 4Z7JA 2IYEA 1UDCA 5ITZA 3G6WA 3R41A 1ZGZA 5IN4A 2BYTA 3AOGA 4PNPA 1TM7E 2WUFA 2JASA 4G81A 3S8MA 3WISA 1NBWB 3Q5GA 4UM7A 1LBSA 1SU4A 5JCOA 1F8UA 4QWMA 3G7NA 4K26A 4DNQA 4RVSA 3SYTA 4K9LA 3AZPA 1BJRE 2WJIA 4BFUA 4KB5A 3MCZA 4W5JA 4GXRA 4YECA 4BFZA 1XZMA 1R9MA 3UMCA 3ZY3A 5HKBA 3DZCA 5BSEA 2ZUTA 4EZBA 1QORA 3TOZA 5BYAA 1YRLA 3V00A 3WP0A 1GTL1 1U2ZA 1CG6A 3EXAA 4GUAA 2V6IA 4FBGA 4O02B 3LDHA 2CE7A 4AKTA 1OH7A 3GJSA 4KEAA 3O47A 2DLCX 3BGVA 4KQMA 1J21A 2QUZA 4FK8A 3WL6A 1IOLA 3OA2A 3Q4GA 3I62A 3LAWA 3W1EA 3ZLBA 3AR2A 2Z2JA 4Q4HB 4B7XA 5EIAA 5L7TA 3D43A 1NJSA 1P6XA 1V3TA 3KOWA 3LECA 4PYKA 4YH1A 4B6OA 2R96A 2VNIA 5DBEX 4F6LA 4MCJA 1MHTA 4LRTB 4GDFA 5ES3A 5K0JA 1NVUQ 3NLLA 1RRKA 4DQKA 4QHTA 2CUNA 2EFJA 3GLHA 4NECA 5FT9A 3WIBA 4D6XA 4HZIA 4E4RA 3IEMA 1UA4A 3Q9NA 3K0AB 4BCBA 2B4RO 1J0EA 2VDJA 4MS3A 1GR0A 4QT0A 3AHCA 3LI2A 4EYQA 5LJIA 4G1BA 4UTXA 2OZVA 2I2WA 1W5AA 4HRVA 1AHPA 1ULHA 2QUBA 2ST1A 3K0EA 3N2GA 4GI7A 4HB3A 4IJQA 2JAXA 2P4UA 3ENVA 4LW8A 2AX3A 3L7LA 1T0BA 4QBIA 3RQIA 3VR5A 2HPVA 2E5FA 3GGPA 4RTNA 5DBOA 5E95A 5IDVA 1E9FA 1GILA 3AERB 1HM5A 4Z2YA 4K6GA 4MWGA 3NM5A 1YVDA 4OK5A 5I9LA 4GKBA 2A1TS 3CT4A 4RSRA 3TRJA 2J6CA 3GDFA 3TUIC 1EPUA 3KSRA 3SICE 4OHYA 1C1YA 2ODPA 3OF3A 3ZPXA 3NOQA 4YI3A 5JXHA 2BGTA 1IIBA 4ZVOA 4G4JA 3P2YA 4RPLA 2Y0CA 5DP1A 5IARA 4B32A 4ZYTA 1OYWA 3FTDA 1XQVA 4KI7A 2Z57A 2H1IA 4UVHA 5F51A 2WKQA 2P2DA 2BSXA 3PHBE 2ZGVA 3U7EB 1P5FA 4ARCA 1DEHA 4JI4B 1TF5A 2K6GA 1KH1A 3I4FA 3MOGA 2ZQYA 5CW2A 2IXBA 2JJ1D 4P31A 4QOEA 1Q0RA 4KNVA 1QONA 2E4UA 3TOSA 3MJTA 5KYKA 2QBYB 1TDJA 3NC9A 1VPLA 1QP8A 5TPWB 4O8ZA 1A8IA 4Q4HA 2C83A 3JATB 3M5WA 2QVZX 5LDDC 2G7MC 5JR3A 4RGVA 3N8KA 2XXAB 1GU7A 5K20A 3BFJA 2WEKA 4OBWA 5AK6A 1WPGA 2ZIXA 3D3NA 4H3VA 3K0AA 1GGHA 2FZLA 1CVIA 2X9NA 5B2FA 2ZIWB 1J2UA 2C3PA 3FCUB 3JQDA 4RVCA 3GFGA 2RGDA 4EPVA 1HT3A 4HP8A 2WD8A 4ASUD 1JQ5A 2NU6B 3BREA 1NUTA 1PJRA 3T8YA 4N41A 1YR9A 2QJTA 2VC2B 4JBYA 2QTZA 2Z4SA 4XDGA 5KSOA 4D0SA 3LOUA 3EA0A 1JH8A 1AX9A 2I2DA 2IF2A 2O3TA 1NZFA 3NCHA 1SBTA 4Z0NA 4ESVA 1G6KA 1ND6A 3FGZA 4WMLA 4GPEA 5C80A 3CUSA 4JT4A 4WCVA 3TAUA 4A8JA 2IEIA 4DSOA 4LJKA 1SBHA 3PIDA 1C9NA 1A9XB 1G8FA 2H48A 1OZGA 3NIGB 4Z4HA 3NRBA 1F0YA 3GXOA 4OH7A 3ILXA 4D6YA 3H2KA 3JQEA 5CLFA 4JAVC 4FFVA 3RIXA 1I7NA 1OGYA 2EX1A 4HNQA 1YXMA 2ECKA 2BEJA 2ZRLA 1E1CB 4H1TA 4O3MA 1G4UR 1R00A 2RI1A 3GLQA 3R8FA 3QLEA 3R7WA 2QP9X 1LW7A 4BLTA 1EA5A 3OZUA 4D26A 3OQ1A 4AN4A 1HFEL 1ULUA 3OSUA 4JEIA 1Y81A 1XPJA 3VU0A 4YRBA 1CVLA 4I7EA 3LCRA 1AQNA 3NORA 1CHDA 2CN1A 3C41J 3D1VA 3PL5A 2YRWA 3KAPA 4WJLA 3LSTA 2GLTA 4DCJA 1EHYA 1ZJJA 2L17A 2E6KA 5B1DA 4BJHB 1CE8B 4BEBA 2C2GA 1E2IA 3DDUA 1DC4A 5K2MA 3VR5H 1FDUA 1Y37A 3WNVA 4DN6A 3KXIA 1KEVA 5JDIA 3I39X 4KOEC 5JCPA 2HXGA 1UINA 2PMDA 4GPTA 4HBZA 2BV3A 3EW9A 3AG5A 2I2BA 1KBQA 4UTOA 3I6ZA 3SHOA 1FMFA 4RPIA 4TSKA 1NI4A 3W6UA 1W88A 5DM0A 1UKVY 2EKZA 4TS3A 5F1OA 1PFGA 1Y6FA 2EW2A 4PE5B 4TROA 5DK4A 2OFXA 4HXYA 5C34B 4EYOA 2OHVA 1F20A 2XXAA 3KU4A 3LS2A 1RMQA 3FBGA 3DAHA 3FN4A 1SXPA 1T43A 2YHBA 1AN9A 4UPDA 2PX8A 5REQB 2IZ6A 3B3FA 5DW0A 2ZUFA 5KWEA 4OBBA 4OBEA 5GV8A 1HG0A 3EIOA 3F5DA 1OFUX 4IDNA 4FEYA 2H06A 3ORRA 4Y2UA 4XQEA 1ZH4A 2P6UA 4DCVA 4HDQB 2VPTA 4MR9A 3IVGA 4UBOA 2WQ7A 1V96A 3OX3A 1O97D 5SZJA 1YZKA 5B37A 2QS9A 3H2HA 2FXIA 3T3MB 1M83A 1UXOA 3N28A 4L28A 3NAQA 1JHDA 1MN6A 2FMKA 1BTOA 5HF8A 2AUNA 3QKUA 4OQMA 2H65A 1SK9A 4MULA 1FNMA 2GPJA 1J4AA 3M6FA 4N4AA 2FUG6 4PZ9A 3TGWA 5ELXA 7REQB 1E3SA 2FVXA 1NR1A 2VDWB 1PJTA 2Z30A 2ZWVA 3NOXA 4Q4AA 1AKVA 1QC5A 4M38A 4Z8XA 4GL2A 4TXJA 1A9XA 3WWOA 1Y4SA 3W7AA 3OEED 2EFGA 4UHFA 4DYHA 5JI3E 1Z7BA 2QYOA 3ZVKA 1USGA 4GRAA 1SVMA 4GM1A 2Q6KA 1T6XA 1U8TA 1BKYA 1MIOA 2FQWA 3P0JA 3S27A 4DANA 1AK9A 2HWXA 4CKXA 5JSHA 3SBEA 3IOBA 4LJ8A 1E61A 3EGVA 4HDOB 1OAOC 3AUTA 1ZZGA 2DZDA 4NBWA 4TUYB 4UMDA 3COZA 1VB5A 5CG2A 5IWAB 3OU6A 1KAGA 2JBWA 2AZDA 2P2CA 2F3RA 3CSUA 1Z22A 3ED5A 5E8RA 4O63O 4N5MA 1JQKA 5HUHA 5JZ9A 1BXRB 4QYIA 4LISA 1DTWA 2NXCA 3AI2A 1JQJC 2OBLA 4U7JA 4BGVA 3W5CA 1GHTA 1LPOA 3K20A 4M8SA 4YA6A 3ZS8A 1ZIPA 3IDZA 3QF4B 4QTUB 5LA6B 4CM1A 4XRGA 5A04A 4V0SA 5FPSA 3E18A 4G0XA 4XE5A 3E1GA 4BE9A 1C7IA 1KO7A 4GBGA 3L6DA 2WWWA 3RS0A 1L7OA 3W5VA 3IMKA 5A03A 5FOTA 4IICA 1T9CA 4RK0A 3YASA 5G4KA 3DBRB 4QBHA 4HN9A 2XODA 5ALWA 4L15A 1KQ3A 4UEKA 1LNSA 2BFEB 4KQWA 4XX0B 4PX2A 1BX3A 1NJ6A 5MN5A 1C3OA 1FMCA 4H35A 4MVXA 5M5BA 3PUXA 1WXGA 1UPTA 1YIOA 5KVVA 2W70A 2V65A 1NTRA 1XCOA 3GR6A 1WZNA 3VDMA 4LXHA 3IEKA 1Q7GA 1NYLA 5TQ2B 3R7BA 3E81A 1TYDE 3JSXA 4CODB 3HGTA 3R9WA 4RPKA 4QO7A 4UE3S 2O07A 3CV3A 3DOIA 2HDWA 2XA9A 4O4LF 5BV2P 3OC6A 1H3EA 3FMIA 4GQIA 1HZZC 3B9PA 5TJHA 3IBGA 5HCUA 1HFJA 3TD2A 2PN1A 4H0CA 1Q6YA 4UBKA 5EHQA 1Y7TA 2RHGB 2ZJYA 4N8EA 1JPVA 3G5UA 1QOPB 2YJZA 4LXQA 3WFZA 2XNDD 4LZPA 4A16A 3VDXA 4DFDA 1HKHA 4MI3A 1WA5A 5DISB 4OXYA 2YJGA 2O8FA 4RVGA 3CPSA 1DWOA 4DF3A 4F5YA 2YHSA 1QZXA 2BUBA 3UB2A 1R88A 2F8MA 1ODSA 1S4QA 3QVMA 4ZT6A 4IQ0A 4X6YA 8AT1A 2GD2A 4JCCA 5E7JA 3V1TC 2HK8A 3I9V6 1WMEA 2PK3A 1J33A 3Q8LA 1RJ9A 1OX4B 2HCFA 1KOFA 4YS6A 2H11A 4RVFA 4BFVA 5B7GA 1AUPA 2PH3A 5IDYA 1MJ5A 1VM6A 1GITA 1G16A 1U3WA 4FCVA 4KVGA 4BWYA 2PUFA 2YR0A 1N6OA 3QUTA 1Q19A 4XIGS 1XVVA 4MMYB 5EPUA 1FXSA 3CW9A 4W9MC 5TPZD 4BX3A 4GYWA 2HSZA 2OSVA 4LRSB 1Y9EA 5GV7A 4LX8A 2A30A 4Q9KA 3K5HA 2QDKA 2UYYA 2VF5X 5IYZA 1H0RA 4V0RA 3EXHA 3ND6A 5TQJA 4H3KB 3BWYA 4AP9A 4EFDA 3WWYA 3BGKA 4D5GA 5EINA 3NM3A 1Q21A 1AVTA 2PRJA 3Q87B 2YWCA 2RIRA 4DC9A 4JI0B 2A5GA 2D5IA 1OIVA 1ZDMA 4D9HA 2FU5C 3OIFA 2G7ZA 4J0CA 1UUFA 4CNQA 4TZ0A 3QEKA 5B1EA 1WPXA 3IO3A 4NBKA 5E6RB 3MOSA 4V03A 3KKNA 4XIFA 3UGKA 1W85A 4I5EA 2PVSA 4JJGA 4P58A 1MRNA 1AO0A 1RXWA 1JG3A 2PZKA 3KJQA 4L74A 1YBMA 1OT3A 1BNCA 1I7LA 3B7WA 1WBJB 3C3CA 1DXOA 4WFQA 4B83A 4IIGA 1HYEA 1HX7A 3WMGA 1VG0B 3ID6C 2H00A 4ILKA 1RJ9B 1ZCJA 3UMYA 4F9EA 5IZ4A 1P0QA 2W6MA 3H3JA 4E1BA 3AHEA 3QPCA 4FHFA 5K09A 4N48A 2CFOA 3S2IA 1VE5A 3COWA 4UTRA 1V1BA 2DJ5A 5FUBA 3TZQA 1M1YE 3WMXA 5F9FA 3U40A 1Z74A 2CLIB 5IHXA 4YCAA 4LHZA 1OVGA 3EGDB 1JDVA 4WNAB 3KXLA 4IMIB 4NCXA 4PBRA 1DKOA 2L18A 2X14A 3TRDA 1QU3A 3N0WA 3CKYA 1N9GA 1XTUA 2JCXA 3HXQA 3ND8A 4TYMA 2BGKA 2Y0PA 3BJRA 5TQ0A 5DHFA 1MV5A 3KR9A 1JL3A 3OF2A 3QG1A 4M9XA 2ID8A 3TRFA 1UKZA 1CRZA 3V4OA 4YX9A 3I5XA 2WJJA 2D4AA 3N0TA 1LY1A 3OZVA 5LBIA 4YCLA 1AUXA 3UT5B 2OQVA 5C1OA 3HXTA 2IJGX 2VWGA 2UXCB 1C4WA 4G56A 4GKJB 1ZINA 1TI7A 4JFRA 4QBGB 3GYGA 3KCQA 3MMXA 1PAUA 4PHCA 3HCPA 3REQA 2DPMA 2WJPA 3PFBA 4HNHA 1MX3A 1JE0A 1RADA 1ZGCA 2TRSB 4LOHA 2DB3A 1G41A 1HV8A 1G7SA 1XAJA 2YYZA 4RJJA 1G9SA 3PQ8A 3RYCB 4PSVA 4F2DA 3EXHB 2VYVD 5CEEA 4XUCA 4BFWA 3TW8B 1SA0B 2CBXA 4F38A 2H57A 3KL4A 1JEYA 3IHWA 3TIFA 2OV2A 2GZDA 3X2SA 2P9BA 2WHYA 3PS9A 2OLEA 3PXAA 4R81A 5F3WB 1UOPA 3R5KA 5DYWA 1N6LA 2W58A 3H1EA 4PLZA 4WK0B 5K8JB 1Y33E 4IIXA 2A4KA 2O5RA 4U6QA 5CA1A 2XQGA 2Q6OA 4N40A 5LLSA 1N1MA 4JBGA 5E4FA 1C7RA 3Q2IA 1LJUA 2OO3A 4WESA 4CG1A 2H92A 4CMGA 1KJQA 4XVCA 2W2LA 2O0LA 2AG1A 3H99A 4B5LA 4BO0A 3E05A 1N2CA 2PS3A 4Y0VA 1L4FA 3T3DA 3I5AA 3LUCA 4RCVA 2DE0X 1IPFA 2BTQA 3QFSA 4D3XA 4L3VA 3LBFA 1JFLA 5BNWA 1E99A 4R8VA 2H2HA 2ODBA 3HH8A 4D97A 1UBGA 4XOIA 1HTBA 1QK3A 2BFEA 2YVAA 4FIZA 4G25A 2PE5A 2NYRA 1YZVA 4FWIB 3H13A 1YZTA 2FZWA 2O2GA 1I94B 1XROA 4MUYA 3UGQA 2PIAA 4XDYA 1R8QA 2Q6TA 3RS8A 1VG8A 2MHCA 2RHJA 3KEMA 2GYVA 3TEMA 1Q0TA 4JSYA 4I3FA 5JQGF 2PVPA 4FDAA 1L3IA 4K3VA 4GMFA 3IERA 3GU3A 1E1YA 4QPZA 2YV2A 5BN4B 1ZH2A 1P4SA 3PC8A 4R0NA 4QODA 4O4IB 1W8IA 4B76A 4ZDJA 1GLGA 3F73A 4U2DA 2ZBGA 1J5XA 1UJBA 1RLUA 5TMDA 3SNHA 3UK6A 1QKKA 1PUJA 4P3XA 5HCIA 2BDEA 2YHAA 3H4MA 1OJ7A 4TV9B 3LT2A 2B36A 1GPLA 1V5GA 1OFIA 1U2DC 2OG1A 3ADPA 3EG9A 3MJFA 1TXGA 2VYFA 1ULBA 3CPEA 3F6RA 3Q7SA 2B8EA 4M0MA 4Q1VA 3Q88A 5LDHA 2QX6A 2G06A 3B1FA 4UNIA 3W5DA 4E4TA 5EMNA 2ZRKA 5D84A 3SDSA 3X0DA 4E8ZA 3W4KA 1OROA 5MGNA 3A9UA 2V74B 2DOKA 1SBCA 3MT7A 1UMBB 1Q57A 3HXPA 5FUXA 1L6IA 3GF4A 2BZGA 3U3RA 4C3VA 2GN6A 4QRDA 4FFRA 2SECE 3O4VA 5LIPA 3FYUC 4FQ8A 1OV6A 1U7HA 4HUJA 3GEEA 4QHSA 1AT1A 1SUBA 1UPCA 1G64A 1OBHA 2GN4A 3KFVA 4F7DA 1MTZA 2C4HA 1ZR4A 3QM1A 1RZRD 4KVAA 2AFHE 3T5CA 3GMSA 5F7ZA 2X4GA 2F64A 1VHLA 4CKBB 5LVAA 4WXEA 5JYDA 1TL7C 3NTVA 1H8HD 4S05A 1FQJA 2DBZA 3NCTA 4CQMB 2COEA 4DLKA 1TC2A 2H4WA 3U7RA 3B3LA 4PZUA 4JCOA 3UT6A 3VR5D 3WIUA 3LKDA 3L7BA 3SNKA 4IQ4A 2QSZA 4F4IA 3RVMA 1N8TA 4LRWA 3OZ7A 2W43A 2FHSA 2YHIB 4LY0A 4FHGA 1KGDA 4R1LA 1NV8A 4F04A 4PG8A 2CMDA 4X71A 3IH0A 3N86A 2ZAYA 5EPOA 4R2WA 2CKDA 2N0SA 2B3TA 4NAVA 4DCSA 1RBQA 1GQFA 2J6IA 4JBWA 4NE9A 1F2DA 1CZUA 3DKIA 3GLUA 4HSGA 1NDUA 1ZHFA 3OFKA 3I2YX 4IDGA 2BMAA 2NO4A 2Q7XA 2VDMB 3E3LA 3PVSA 4MAFA 4JXXA 3VKWA 1XMPA 2H7VA 4AZ3B 1KYQA 2NV0A 4LSWA 3RK1A 2FSFA 5HM6A 3BTOA 3ER8A 2J5KA 1PJ3A 1X3SA 4PBSA 4TYPA 2JLBA 3AJ8A 4OJNA 4DA8A 1XD2A 4D8VA 4MV9A 4Y2HA 1SXJD 1ZICA 4PS1A 1MB2A 5H4GA 2EZUA 3U49A 1W4RA 3GA7A 3SIXA 4YCBA 5D6NA 3O8QA 5GQSA 1SXIA 3WGUA 5DNCA 3M6UA 4AQYB 1O5TA 3ECCA 5D3MA 1JSZA 1T5SA 4LRXA 3H83A 3MRVA 3ZQUA 4C4XA 4FGJA 2R7LA 2AZXA 1VIAA 1QDUA 3EVEA 1CRQA 2YQZA 1ISGA 4QPDA 4BXOB 5DMHA 2ASVA 2HRCA 2QM8A 3C97A 4CQMA 3OLYA 4BEWA 5I4BA 1TYYA 4TQAA 2PBZA 2QZZA 2BPOA 4EHJA 1C9JA 2DHCA 3T9EA 2HN9A 1FNDA 4G5GA 4B84A 1J0DA 3NYIA 2JI9A 3H11A 2AV6A 2RGUA 4ILEA 3AILA 3UKJA 4FN4A 4EPRA 2GBFA 1VXRA 4RH3A 2GPNA 1MD9A 1P8AA 1PW7A 2O3RA 2O4CA 2R1TB 3EUEA 4YV0A 2H07A 5LL6P 2YVLA 2B94A 2IYXA 2RH9B 3PFIA 3QE4A 4KLCA 1T0PA 2KBEA 4MX8A 4PAMA 1FU8A 2WJWA 4HAXA 3DBVO 1MRSA 1SXHA 4GXTA 2KYRA 4L27A 1FRVA 4EIWA 1ZIXA 3DAYA 3VX3A 3CSSA 3ZUGA 6AT1A 5A4FS 3CNQS 1DAGA 1E6LA 1I6WA 2NO7A 1C7EA 3BMQA 1ZK4A 4UAGA 4IIYA 4UUMA 5IC4A 1QXSA 1P91A 3GUVA 4RA9B 1NMEA 1JTVA 2QLNA 3OH8A 4KQHA 1SUPA 3BWBA 3IOEA 5JSZB 2VZ8A 2QLLA 1QG2A 2QTTA 4CMHA 2WLTA 4E4YA 3HP4A 2JI8A 3MBIA 2ARKA 4LPSA 3RKUA 1YOBA 5LB4A 3DZKA 1E20A 2I4LA 1FDTA 1SXGA 2JFHA 4GUDA 5KNCH 3A9SA 3L4KA 1HBJA 2PWZA 4M22A 1R6DA 4C7MA 2PSFA 4V2IA 4RV5A 3TH5A 1YQ9A 2GXAA 2I99A 2XF2A 3BXPA 3SMVA 3JVIA 2L0XA 3SQWA 5BV0A 4TWBA 4EKDA 4MKHA 4B8SA 2Q4OA 1OQAA 2M2IA 4RKQA 2Q2VA 5CUQA 3UPUA 2CY0A 2LE0A 2ILVA 2IY9A 5FBQB 1DX4A 1LQ2A 4G65A 3TUJC 4QL3A 4U6SA 1WY7A 3WWZA 3AFIA 3B6KA 1P2FA 3KUKA 4LBWA 3HM2A 1N9KA 3JVDA 5BVHA 2XNDA 3EZXA 3N3AC 3LKIA 4K8RB 4Y9DA 1NRWA 5G1PA 1G20A 3S8EA 1XMXA 3H5RA 3MCWA 2H1OA 4K88A 2HTEA 2R1UA 1UFKA 5TR9A 1RWBA 1US8A 4GXQA 2C7QA 1Q15A 2NU7A 3VMMA 3ST7A 4WKBA 2IZ5A 2QX8A 4B3DA 3DYIA 3S29A 4C43A 5K99A 1AQLA 3NHAA 1T8PA 3FI0A 3CLUD 5ERXA 2BGUA 4HXFB 1U8YA 3MJRA 3V46A 2OHIA 3JQBC 3GJ4A 3V55A 1MNQA 4ZVPA 3SGLA 4RKEA 1JKXA 3O9ZA 3QPDA 3G0HA 1BWPA 3TW6A 4TVSA 1BS9A 5AI6A 4KN6A 4BGEA 1GVHA 4U3JB 3CX6A 2NT4A 3GCZA 5KC8A 1XR3A 1MO2A 4NFHA 5EFZA 2P9GA 4KMOA 4S04A 4DOMA 4MIEA 2REQB 3BB4A 2OCLA 2O54A 2ZRFA 4D45A 4K1LA 1EZZA 2PT6A 4BLPA 3G5AA 8ATCA 1DJLA 1B15A 1GL9B 4JK3A 3L7OA 3QA2A 4QD3A 2GYWA 3FPSA 5CM2Z 3UH1A 4HAYA 3MK31 4DUZB 1SKUA 1A77A 1X86B 2CEKA 4YJGB 5IYZF 3MINB 3WIVA 4CEIB 4K5QA 4PR3A 2WTMA 4NCHA 4MS3B 1U2RA 1DCKA 1R5JA 5GP1A 1Y7HA 3EBOA 4D98A 1JG1A 2B78A 2HRBA 3EIEA 2G09A 2YS6A 3TQHA 3AHJA 4HNGA 1NVGA 4BAZA 1N8SA 4NOLA 3ND9A 4YRZA 3ZJUA 2J31A 4X3PA 3ESZA 1MQ8B 1LS1A 4I4TA 4DT1B 5A7FA 2OVBA 3WGYA 1W75A 3D2BA 1ORVA 4QUGA 3VVLA 2YVQA 1K8ZB 1YRHA 2I4MA 3AFMA 1QKIA 1JYSA 3AKDA 3FGPA 4UPEA 2CHVA 4KFSA 3DTNA 1XTKA 3EDMA 4AMYA 1IBRA 3TMKA 4RDCA 4GOJA 4H3SA 2Y1CA 4C0WA 1WP9A 4B3RB 2XBMA 5IZCA 3DE3X 1PGQA 2KWIA 3WB2A 2D7DA 3QOYA 4UBJA 1QX4A 3IVCA 5DZSA 4NL4H 4NDAA 1O2DA 2HCRA 2QRGA 3AEQB 2EERA 3C39A 5KJ1A 1KP3A 1FSPA 3BTSA 4UOQA 1GFWA 2FX3A 2YY6A 3KJHA 3TXYA 5CXUA 3BXEA 4KQ9A 2ZRQA 1SAYA 5HRAA 2Z6VA 3D81A 2ZIUB 3JQPA 3O8BA 4HTAA 5IT0A 3LRTA 3U2QA 2D1SA 3BKXA 4XUDA 5E6RA 3SC2A 2CNDA 4N6NA 2AM1A 2YZ7A 3G9ZA 5EMHA 3ICOA 5HFJA 3RTBA 2A8YA 3ZXSA 2FWIA 4K8TA 2LIVA 5FTKA 5C9ZA 4TKUA 4I4LA 3QFRA 1V5FA 4DKJA 3O38A 3TR5A 4RZ3A 4S1NA 2GCBA 1YC5A 1M8FA 5CNJA 5B53A 4NS4A 3DONA 5AIAA 4Q03A 3GDWA 4MS4B 3LC1O 1CHNA 2ISCA 5EMMA 2IX3A 3H0CA 3A9RA 2QPTA 2W37A 1KMHA 2VPYA 3MTBA 3R44A 4RGYA 1KMIY 2VAMA 2WP0A 3H16A 3WVNA 2P40A 1C8KA 4XFJA 3PE3A 3WK9A 1YQQA 1M34E 4J16C 2WF6A 4EMTA 5JMOA 1FFYA 4C5CA 2ROQA 3J7TA 5CM8B 4MVJI 3MAAC 3ON5A 4KQ1A 4EYKA 4HDNB 1XEXB 1VOTA 2P30A 3GCGA 4WSOA 1Q7EA 1QHNA 2P3OA 1VPDA 2R7NA 3OM1A 1VMAA 1QFMA 3OE1A 2X1VA 4BMNA 3TDNA 3MJDA 1VE3A 1I6LA 2Y1GA 1SUAA 2XOEA 2Z43A 3RT1A 5A9TA 4D3YA 3S2ZA 4E0BA 2XNHA 3WG9A 1EU1A 1YS2X 3KFXA 3AB8A 4AZSA 3NNNA 1JFFA 4CI0B 4LRUA 4ALJA 4JLJA 1YNOA 4DJDC 3OLQA 2C7BA 4QUKA 2FUKA 3INNA 1PV1A 3OD1A 3RUDA 2JFOA 1PBNA 4N03A 3SFZA 4NSNA 1E5QA 5CFQA 1Y7IA 4DV3B 2UVQA 5ALGA 2RKWA 2D1FA 1LFDB 1QO7A 2J41A 2VDRB 2ZEJA 3P5BA 4QJ3A 5ADUS 5C5EA 4TTAA 5K6AA 4GOLD 1Y3CE 1OWNA 1KQGA 4QXPA 3U17A 3AF1A 2PRYA 3HUTA 4Q3EA 1NFRA 5F33A 3HHPA 1U6JA 2F4VB 5LMZA 3UTDA 3K31A 1CULC 4MV3A 3NH6A 2KLBA 1J2YA 5AQ1A 4Q9JA 4CT4B 4S3MA 4MWSA 5LQUA 1QRUA 3HZRA 5JT1A 1XMSA 4GH5A 3TRKA 1Z0UA 2QTLA 4L7VA 3QYAA 3NUGA 5E1OA 3RT7A 4WZZA 1W44A 4R1TA 3S2EA 3K9EA 3MTDA 1M0TA 3L7JA 1GCUA 3UW3A 3SDZA 4WOPA 2OSBA 4FMCF 5JBQA 5JXIA 2PXXA 4HS4A 1T5BA 2XB9A 2DFNA 1GPWB 4FX2A 2JAUA 4OJMX 3A2NA 1QQ7A 1P9RA 3CB2A 4MR7B 4ZIRA 5JS6A 1KK1A 4BQIA 3SZMA 1N32B 3BMCA 4QJBA 2ZRDA 5EVCA 4F9TA 1XMIA 1P1RA 3EPLA 1DB3A 2BR5A 2Z0MA 1ATZA 1QHFA 1YZFA 4QUBA 4PLWA 1SZCA 3HYCA 3HKBA 4EG7A 2XRFA 4FDMA 1P2DA 2XWPA 2C88A 2PL1A 2R68A 4FMDF 1PR2A 4JJZA 3KQQA 1KETA 4LJYA 1RYHA 2IYYA 3RVOA 1Y3IA 2V4ZA 4OHCA 4RJIA 2XRZA 2JI4A 5F4BA 1M0EA 1LJ8A 4YXWD 3DZJA 2O14A 2BTEA 1BJKA 4Q9AA 1ZFNA 4L8GA 4HB2A 3ZZ0A 2QT0A 3OQNA 1V8ZA 4G5OA 3GEHA 5K8UA 2YN2A 1XQYA 2J5QA 1DARA 1T8UA 4EUFA 1BWSA 1G5IA 1H4TA 3OZTA 1LV7A 5DN9A 4WKOA 3IL2A 3ZM5A 2VJCA 3HCRA 5A4IS 3C5HA 3QTTA 1GG9A 2QE6A 3SR3A 3AX6A 1R66A 3PRJA 2BEKA 4L50A 3O73A 4OJKA 4UAUA 2PZLA 3BL5A 2H3EA 2AYZA 3VC1A 1MO3A 4DG9A 5JE8A 3UMBA 3RF6A 1EBUA 3PC6A 3LLVA 3ZVMA 2PKKA 2N1MA 4F1KA 3ANYB 2R8PA 1G9XA 4PGHA 2H9YA 2QM0A 5L3QB 2VZ9A 5JWOA 1D2GA 3BH0A 3THWA 2G8NA 3Q3CA 5HW0A 4C4TA 1K63A 4W8HA 4TMTA 3RABA 3AUJB 2YZKA 1WL8A 1XF1A 2O1SA 1LCIA 2O50A 3CF2A 4BTEA 4BV3A 3QBJA 3HU5A 3E61A 3GDOA 1DFGA 3OIUA 1YUBA 3BILA 3PPVA 4ODIA 2IU3A 3PENA 1NV9A 1H3NA 4HDSB 5LOVF 1YS6A 5FFMA 2YZGA 4OQEA 3I6MA 4P3NA 3JQFC 1ZA2A 3QA3E 4YLYA 1H2EA 2FFHA 4O1GA 3CEPB 3SVLA 3AV0B 2H4HA 3LBHA 2DH5A 1C8VB 5JLAA 4JVOA 5CPFA 4B6FA 2HHCA 1C4OA 4EMSA 1RZRA 2Q07A 1YT5A 2QMZA 4DMCA 5I01A 3GJ7A 3OJCA 3HCDA 1GQTA 1M8JA 2EOAA 2QJOA 3MJEA 1JLMA 1ZU4A 2ZBQA 3MG9A 5EWJA 4U7XA 5BQFA 3HKCB 2WIBA 2I2FA 3DZDA 4DAEA 1KY2A 3LE8A 3PBKA 5CLGA 1PV2A 1EAYA 1QV6A 5T3UA 4PIMA 5A3QA 1FTSA 4IIVA 1TF2A 1SNYA 2WIDA 3U1VA 1W94A 2GBCA 4FINA 4ZIYA 1NBHA 2V9CA 3IP9A 3K8QA 4H77A 4IHJA 2VDKB 1GCAA 2A9JA 1DWQA 2GX6A 2QAGC 1PFUA 4LA4A 4MDYA 4PAGA 4X8FA 2MMCA 5ALHA 1UBMS 1ZVMA 1CDEA 4URHA 3WJ1A 2NVUB 3EJ6A 1JPUA 3NL6A 3D54D 5KJFA 1JKIA 2OCPA 2PFSA 4TN5A 4B8WA 4Q6WA 3PR3A 1JKMA 1NYRA 3PSAA 1UDBA 5D3MB 5KMGB 1SQGA 2C49A 4XSGA 3OJXA 1N25A 2VYQA 3ETEA 5C18A 2DDMA 3MEQA 4I81A 5EUMA 2XE4A 3SYRA 4X8LA 1B4DA 2HLDA 1CTQA 2YWEA 5A0TA 1J24A 2O52A 3WZMA 4NOJA 3O7MA 1T8WA 3WYEA 1A1VA 3PGA1 4K9OA 3UWMA 3AVYA 2XUZA 3S1AA 4MJ3A 3RRYA 3NBUA 5AJXA 5BQPA 3AIOA 4CV3A 4ZICA 3LYUA 3OKPA 2R1VB 4J0JA 4Y1RB 2FN4A 4AZWA 4FEGA 5GIPE 5GZ1A 3AHIA 3HKCA 4B09A 3EBLA 4ZD6A 3IAS6 3IUPA 3IAEA 1IZYA 2P27A 4GWLA 3ADDA 2AWDA 4UD2A 5D5QA 4MW1A 2PMKA 1FP7A 3VHQA 4A8PA 2RAUA 4J1NA 1GN9A 2LPMA 2VOEA 1ADJA 4A92A 2ZI9A 3B85A 3K9LA 3O2JA 3O3NB 5FPKA 5FORA 1CRWG 2JZNA 1J5PA 2NVUA 1IVYA 2Z3VA 3WLEA 1PT6A 1BHQ1 3RTCA 3NVKI 2XMDA 4DRYA 4OEHA 3BXGA 4NEHB 3FAZA 1EAMA 2ZAIA 3DL0A 4OI4A 2PUAA 1BGVA 4IIEA 4OP3A 3QF7A 3ZY6A 1FZTA 1JHQA 1PG0A 2HA7A 4X60A 1GUDA 4OIMA 4LF4B 3DKRA 1OD6A 3ZOKA 2F8SA 1KDTA 3I12A 1NBEA 2O2JA 4GZ6A 3OQVA 5EE0A 4DR5B 3L8YA 3A06A 3G2PA 4RTLA 1HDEA 1JQDA 5LQSA 4NXMB 3GQBB 4O1LA 4F8EA 4M37A 2JHPA 2QORA 1VGVA 4JC8A 3SS8A 3VPBA 5ES4B 2CV2A 2XE7A 3KQUA 1P0FA 3DNFA 2JGIA 4DZRA 3UC9A 5LYJB 1H1TA 1DJPA 1JQLB 2UYCA 4H4DA 2O7VA 1X8KA 1CC1S 4KPYA 1YSCA 4YDSA 3I01M 4I9NA 1NKTA 4X1YA 1IDOA 3ZU4A 3M3PA 3TNYA 3AR8A 4IDQA 1UWKA 4YHBA 5AVVA 5CR9A 1NQWA 1Z2CA 2YICA 3KZOA 5KC9A 3SIRA 2VP2A 1ZZEA 4UMVA 1E7SA 3EIQA 4Q3BA 1S8NA 2P9TA 4B3JA 3SHWA 3TSYA 1L6RA 3FNRA 2G5CA 3UK2A 1Z6GA 3WLIA 3GJ3A 1CJKC 2AMYA 3RIYA 2X9VA 1E5XA 3F5QA 1HFKA 3BDVA 3VVCA 4NOMA 1JWAB 1XYYA 1LSJA 2PSEA 3NGXA 2V6FA 1LGYA 3H5TA 2AKAB 4O6VA 4R2KA 5CP8A 2PMEA 4AKGA 4UBEA 5BR7A 2H1WA 1VGQA 5BT8A 2F90A 1QFJA 3CEAA 1Y8RA 3MWJA 4M8KA 5DDIP 5G1OA 4LVNA 4C7KA 2O3JA 4KR7A 1QF6A 1K4YA 3M7IA 4CQMD 3NNSA 4HEHA 4XR9A 1NOKA 4AG6A 3O3CA 1PN3A 3QUBA 4FB5A 1UBSB 2NACA 3IUYA 5ECYA 4YPFA 3PNVA 3LUJA 2B6HA 2ZSDA 3PNBA 4BCCA 3ETLA 2I65A 4R71A 2RBCA 1TJ3A 4RFLA 1MVNA 3GGSA 4IMPA 1WKVA 3Q92A 3L3BA 1MEOA 1T6YA 2W2KB 4CM6A 3F2IA 1N2SA 4ZXFA 3V2GA 3FTEA 4M3NA 1QRRA 1H2XA 1IFXA 4HQ0A 2A14A 3VO1A 2VH5R 4DXHA 2DQSA 2P77A 4ER7A 3IKJA 2N47A 3VZSA 2JFYA 4HKTA 1UFOA 2OFFA 2IELA 3A36A 4L8LA 3T38A 2I7VA 5JJLA 4LE2A 3D3WB 4Y2JA 3PI6A 3MCUA 4FFDA 3BERA 1NXOA 3ZYZA 2FW0A 5F5XA 4ZV9A 1NNSA 1VL2A 3U7FB 4X8MA 3C5VA 3BB3A 3E03A 5CGQB 2QVCA 3W5BA 1PGPA 1V45E 3FWYA 1Z62A 3TZLA 4ATNA 4RO0A 3A4LA 1XZ8A 1Z39A 2C97A 4MMXB 2G80A 2ZTSA 1QMGA 2NNLD 3IIMA 1RKDA 3H1FA 1D6JA 1DSSG 3ME5A 1C8LA 2YZ2A 1UBOS 1YVRA 1VI5A 4IJVA 2NV2B 5IJAA 3LHSA 4DQXA 4B35A 1YQTA 1QVRA 1O6FA 5FL7A 4CIAA 4Y0AA 4YACA 3GLIB 1DXHA 3CW8X 4G84A 2PS9A 4Y1EA 3JQ8A 5A0VA 4MKRA 1XAHA 3PFCA 4RDHA 2LTAA 3BUSA 3TNJA 4NTZA 3ZH2A 2E7ZA 2PKFA 3MVEA 4EW2A 5TMPA 1QHYA 5KOHB 5KSPA 2XB2A 2G1KA 5JISA 1BU5A 3DEFA 3QEMA 3AC0A 4UUNA 3OTHA 5IAKA 4L9RA 1S2LA 4KWCA 1Q3KA 4CBVA 3LH5A 4HGRA 5TV2A 4O5AA 3NT2A 4BASA 4EW3A 3LWZA 3PFKA 4B3IA 1IRIA 2ZP1A 4QUJA 2PV0A 5EXSA 3M6WA 3STWA 1I6KA 5EQFA 2X1HA 4MEBA 1PW5A 2ECPA 4RACA 4Y6OA 1FFXA 3EW7A 3MTEA 4ZTBA 1A76A 4X92A 4C29A 1W0CA 3RYFA 1O5IA 1PFVA 2IFTA 4ZOAA 1ABBA 3HJGA 1L1QA 1CF9A 1TRKA 3B78A 3FYTA 1M8GA 1L7XA 1ORRA 2CFRA 3GCXA 5CYPA 1YI1A 1UC9A 4HK4A 2PKRA 4Z49A 3UAVA 2OECA 2P2SA 3CISA 2VLBA 4ER3A 4P5DA 2OCDA 2COUA 2VK2A 3N1CA 2J7KA 1NSFA 3RUAA 1RJGA 1QM5A 5I3ZA 1U63A 3GFOA 3LQ4A 4QGSA 2DR0A 1O6CA 2XIQA 3BBPA 3DMDA 2PQ0A 2PKXA 1WB6A 2P9YA 3DL2A 2X0IA 3ZXUB 1UK6A 3KWLA 3UQ6A 4IOKA 4KMRA 3TSZA 3EG9B 3I9LA 2ZRHA 2PRSA 1E2LA 2ZQZA 3D3WA 5K45A 3PEWA 1XE3A 2UYHA 2I76A 2P2NA 4EH1A 3FTFA 3IBYA 1PFKA 2P3QA 1WB4A 5DHAA 1Y3HA 4C4OA 2I4IA 4HGOA 1ZM7A 1Z75A 1HDIA 4U9UA 2VUSA 2AHOA 1THGA 3B13B 3PHHA 3VYVA 1T3TA 2ZDGA 2FDXA 4G9EA 4X6XA 1ZL0A 4EZIA 4UE2A 4HX2A 4LC0A 1HPLA 3HCEA 4RVDA 1DBSA 4OYYA 1E2HA 1J2EA 1XU9A 3LLCA 5C7YA 1T8YA 3AI1A 4AICA 1ONSA 2WG2A 3EYAA 4OXRA 4XQ0A 4F92B 1KH3A 4RTJA 2OZLB 1PT9A 3MXTA 2A1TR 3H19A 2NIPA 3BGOS 4IJUA 4QPCA 4MGEA 4YQFA 5BSUA 2XYHA 2AJBA 5BOSA 3NBFA 1SO8A 1HORA 3F67A 3K9CA 1RQNA 1WMBA 5F3RA 3ITDA 1GPH1 3W8FA 3JQBA 4JBNA 4HV4A 2WT4A 3P2IA 3OX4A 1CJCA 4ZAVA 3L0SA 1DRUA 2AR0A 2ORVA 2HJGA 2NXNA 2R7MA 2ZKIA 2PKQO 1Q95A 1YJAA 4PNHA 1WSDA 2BM1A 4H27A 1U0TA 3WQHA 3DEZA 3IC5A 3A6EA 1CUHA 1QLJA 3DOCA 2XUAA 1CQJA 4QQRA 3BGSA 3FB4A 4IF6A 1MX5A 3ERCA 3S7TA 3ZHXA 4XVUA 1SKMA 1PVOA 1U9CA 2Y1XA 2DFVA 3DXXA 3E6AA 2P65A 1NP3A 2C7RA 1RJWA 4LCAA 4Y9UA 1YBHA 3B2QA 1E4EB 2XW6A 1YI0A 2PZ8A 1BE1A 2Q9AA 3ILVA 2XCLA 4DJEC 1WHSB 2O3SA 5K51A 5ALNA 1TZKA 3UJ3X 2UUOA 1Y48E 1D2MA 3PWKA 4JZYA 1KNQA 2Z08A 4P2BA 3KZHA 4IUBS 1VTKA 1GXSA 3AM1A 1KZ7B 4HX9A 5AM2A 2GBIA 1X7ZB 3B5IA 4KXYA 1ZNWA 5AKKA 3ZV3A 1GDTA 1BDBA 1FXWA 3H5AA 4TV8A 2Y1EA 3IELA 2IPNA 3MWYW 4R68A 4R31A 2QL5A 1NVBA 3ES9A 1MEEA 2IYNA 1ZUHA 3BIJA 3ONDA 4INJA 4INAA 4B82A 1SURA 4RQUA 5BOSB 1D6MA 1IM8A 3R4CA 4AM8A 1S8FA 3P2EA 4J16A 1M2FA 3GJ5A 2C1XA 3L8DA 1YI8A 4PNEA 4Z4FA 2XT9A 1WUIS 1CERA 4HFJA 2EHJA 4IVNA 3LDFA 3V2IA 1OWLA 4HPXB 2W22A 1SXJB 2V0GA 4MAMA 3DE2X 2C2MA 1RYYA 4KFRA 5AHOA 3W06A 2JH3A 2BL4A 3NJ8A 1G8YA 3DE0X 1J2JA 3AZQA 3ZJ5A 4TMKA 3KEOA 4AVYA 5KNBH 2Z1NA 3CUUA 4LGVA 2P6RA 4K9RA 1V1MA 2YUIA 3C2QA 5T4EA 2LXNA 2JFVA 3FBTA 2O0KA 3FMOB 2YCLA 2I4NA 5IVHA 2VSNA 3H5LA 4EKGA 5KHLB 2PX3A 1FSFA 1Z25A 5KNLA 2IYWA 4R5MA 1NONA 3PGLA 5KNDH 4OFWA 2Q0XA 2XTAA 3EARA 2A3NA 4M8NE 2AZTA 3IKMB 3P20A 3QXCA 3TD6A 3NC4A 4PIPA 1FA9A 1SCUA 4OHKA 4EHAA 1WP4A 4F9GA 4XYEA 1P5HA 3DHYA 3L5KA 4AO7A 4RE5A 13PKA 1HUQA 1W19A 1WHTB 4GLBA 1JR3E 2JD2A 3EZYA 4O2LA 4KWTA 1AMOA 1JB1A 1TQ8A 1Z28A 4HH1A 4TTVA 1TAUA 1F0PA 3QUSA 4E2FA 5HBGA 1BGXT 1T6ZA 1BHO1 2ACWA 4IVQA 1ACMA 3L18A 4IOJA 4OGWA 3FVRA 3T9CA 4BNLA 2RGRA 4AJLA 4BQEA 1EFAA 5LA6F 4YCCA 1G20E 2QTWB 4IILA 3FYUA 1YU6A 1I2CA 2Q4RA 3N0VA 3L07A 5EZSA 1KA9H 1R4AA 5BYBA 4YJ2A 3E8MA 3RJZA