3RRBA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with amp
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
489
structure length
489
Chain Sequence
b'MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 177
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrbA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrbA02
3MBHA 3RO7A 3UMOA 3PZSA 1RFUA 3N1CA 4JJPA 5F0ZA 2QHPA 2I6AA 3B1NA 4K9IA 3UQEA 3RRFA 5BYDA 5C40A 3CQDA 3KEUA 3NL5A 3LHXA 3GO7A 2HW1A 3DRWA 4LBGA 3RQ6A 4YWRA 4C5MA 4S1IB 3ROZA 3B1OA 3K5WA 2R3EA 3RSSA 3PL2A 2AFBA 3NM3A 1LIJA 3RM5A 2HQQA 2AA0A 3ROGA 4KBEA 1V1BA 2ABQA 3B1QA 3ZS7A 3HICA 1TD2A 3LOOA 3IH0A 2PKKA 2DG2A 3QA2A 4XF7A 3ROEA 4EUMA 5F11A 4KADA 4O1LA 2F02A 4U7XA 3UQ6A 4K93A 1RKSA 2I5BA 3BGKA 4O1GA 1RFTA 3RPZA 4XCKA 4DU5A 3RRBA 3QAIA 3RQQA 4E3AA 1V19A 3EWMA 3IKHA 3RTCA 3IQ0A 2DCNA 3RTAA 3D3JA 3RU3A 3NL2A 4N08A 1V1AA 4C5LA 3H49A 3IN1A 3RT7A 4B8SA 1EKQA 4E84A 1VI9A 2V78A 4C5NA 3KD6A 3KZHA 4GM6A 1VK4A 3RU2A 1BX4A 3RTGA 1V1SA 2JG5A 2XTBA 3H74A 4YL5A 2AJPA 3RTBA 1JXHA 2AJRA 1EKKA 3B1PA 4KANA 3UMPA 5CGAA 4B8RA 3B1RA 3RS8A 2C49A 1WYEA 4C5JA 2R3BA 2A9YA 3Q1YA 1LIKA 4K8KA 3VASA 4E8YA 3DZVA 3NBWA 3UBOA 2JG1A 2O8NA 4KALA 5BYFA 4EBUA 3FHXA 4N09A 1JXIA 1GQTA 2C4EA 5EY7A 3MBJA 4PVVA 5CGEA 4EN4A 4LCAA 2PKFA 4K8PA 2QCVA 3GO6A 3RY7A 4K9CA 3HPDA 2ABSA 1YGKA 3FHYA 3I3YA 3NBVA 3NCAA 1RK2A 3BF5A 3ROXA 3UQDA 3RNOA 3IE7A 2PKNA 2NWHA 3B3LA 5B6AA 2DDOA 4KAHA 1RFVA 2HLZA 1YGJA 3RTDA 2YXTA 3GBUA 4DC3A 3RQ8A 3RQHA 2AB8A 4UBEA 5TQIA 3RTEA 3NC2A 3D3KA 1RKDA 4S1IA 4JKSA 3RQ2A 2AX3A 5COJA 1LHPA 3RREA 2PKMA 2DDMA 4S1HA 3NL6A 3W4SA 3RSQA 4K8TA 4E8WA 2A9ZA 4XF6A 3JULA 4LC4A 4S1MA 2F7KA 3RSGA 1DGMA 3RPHA 1L2LA 1TYYA 2Q5RA 3NM1A 3RQXA 3IBQA 4E69A 4LBXA 5EYNA 2DDWA 5C3YA 1TZ6A 4C5KA 1LIOA 5BYEA 5C3ZA 3RRJA 3LKIA 3NC9A 3RO4A 3RT9A 5C41A 5CM5A 1JZTA 3RSFA 2RBCA 2I6BA 3Q92A 3LJSA 1KYHA 3VAQA 5BYCA 1UA4A 4JKUA 1C3QA 3HYOA 2FV7A 1GC5A 2AWDA 2YXUA 4K8CA 4E8ZA 4EOHA 3K9EA 1UB0A 1VM7A 3KTNA 4X8FA 1LHRA 3UQ9A 1U2XA 3OTXA 3RQ5A 1ESQA 1LIIA 2JGVA 3NL3A 1YHJA 1RKAA 5TRWA 1TZ3A 1ESJA 3RS9A 4XDAA 4WJMA 2VARA
chains in the Genus database with same CATH superfamily
2NU6A 3D54D 4KPUB 5BORA 3OTWA 1TYEB 1D03A 1JI0A 7AT1A 3MAGA 2OA0A 3U4HA 4F92B 2DUWA 1QZTA 2DEUA 2PNJA 4BVLA 3KPJA 2G07A 3EC7A 1J56A 1J5EB 4DWWA 5FWXB 2BHTA 5DBFA 4FYXA 5JBQA 4UU8A 4MTLA 4WKCA 2O8DB 1B7GO 4TRNA 1ICIA 2BGLA 1QIHA 3C1TA 2HK9A 3UJBA 4BECA 2VXOA 3FH0A 3NMUF 2VHTA 4OJMX 1YC2A 2QTLA 5IJWA 4EK9A 3L8DA 3PGJA 1JGTA 1UC4B 3WV4A 3RV4A 1E66A 3G7NA 4HS4A 4TMYA 2AK3A 1KAGA 2E89A 1ZVMA 3GFSA 1JEQA 1SVKA 2AEEA 2NXWA 4B6PA 2WMDA 2XNSA 5B4TA 3G8BA 5GTDA 3UATA 4QM7A 2G1KA 3E84A 4QGAA 1USWA 2AN3A 3GA7A 1OAAA 4UATA 2AG5A 4LTDA 5KVAA 1Q15A 2JFQA 4DZRA 2XTBA 4Q16A 2MYNA 1MH1A 1WRBA 5CH3A 3ZWWA 4ZOQI 2GARA 3QMMA 2VWQA 3VZBA 4DC1A 5B2FA 5B1SA 5IX8A 2PL5A 3GVXA 1AU9A 4PYOA 4AL4A 4BV8A 5BUCA 3F6CA 1WEHA 4HRAA 2GN2A 4DGSA 3B12A 3C85A 2OV2A 1I7NA 3C8HA 3H1AA 4PZAA 1ORWA 1QFYA 1TFRA 3ANXA 5H82A 3D4OA 4HB3A 5B2EA 3VYTB 3DO8A 3PWKA 3O8QA 1BE6A 1CR1A 1XCMA 1HDIA 4LDPA 3RIXA 4L4RA 1RRPA 2QUJA 1P2GA 2GYYA 2P9HA 1Z2CA 5I4IA 5KYGA 4M53A 4MQLA 4LOIA 1JHOA 2JF0A 5KMGA 3IPLA 1DWUA 4I1VA 2YRWA 1ZJ6A 2FUEA 3N0WA 1OYWA 3OY2A 4JR2A 3N2NA 2DVMA 2AFHA 1FSGA 1IUKA 4EJSA 1TAQA 4NH0A 3ZZTA 1WZUA 2JPDA 3EIHA 4P1ZA 2B98A 4HDKB 3DBRA 3QFTA 3E9RA 3FPHA 3DDZX 3PL1A 2Z2XA 3R6LA 4PNHA 2YZNA 3DDUA 4CIWA 5KINB 2W58A 2HYDA 3FRIA 3HABA 4TKMA 3IUEA 3PNBA 5IDVA 1FU8A 1RTKA 1KERA 3WWPA 4MIEA 2ZZMA 4L75A 2R7KA 3TW0A 1XVAA 1ZGCA 2P1RA 3AH8A 3DUFA 1ZJYA 3HXTA 4PO9A 4YJHB 5JBNA 4ZDIA 4UJ5A 1AV6A 4BQOA 3I76A 3VKWA 3UHOA 2P9TA 3F5SA 1BWRA 3PGMA 2BL4A 2YVKA 2WM2A 1CF2O 3WADA 4D9CA 2A6PA 4POOA 1Z13A 3LU1A 2EJTA 3LPLA 1S2MA 4JI8B 5HOQA 4X6UA 1P5JA 4CI9A 5CLIA 2R6ZA 4UVIA 5AKEA 4RE5A 2YWCA 2KE5A 5HBRA 3CUEF 3EIQA 1NXTA 2XTAA 2OECA 3DOIA 1CUHA 4NK4A 1QHHB 1D1SA 1P9NA 4F2HA 1M7GA 2EW2A 3AFOA 3X1ZA 4F9FA 4AJEA 1YKGA 3H5NA 1YMVA 4IZOA 3IQGX 1EBFA 3HCRA 1R0LA 4M0MA 5GQSA 4O63O 3G0HA 5A7FA 3CW9A 1WKBA 3FVRA 3T5MA 1SGWA 2YVQA 2YZMA 4GNKA 5J5VA 3ZJVA 4LOHA 4MVYA 221PA 1C7EA 4MQUA 5IZ4A 4A15A 1VSVA 3A2NA 1KO1A 3DAPA 3AESA 4LBGA 3P2IA 2ZYIA 1EFKA 1JRLA 3NHKA 4X91A 5LLDA 5KOJB 5FBZA 2IDJA 3WOVA 1CEEA 1U6JA 3LYAA 1VE5A 4MS4A 1GZVA 1QC5B 5J2TF 4ZAWA 1J21A 1E63A 8LDHA 5KYWA 2NSJA 2C8KA 1WETA 1L4LA 4K9QA 2Z6AA 4BXOA 4HNVA 2AZDA 5G41A 2N1MA 1KMMA 1Y3BE 4MOWA 3RSHA 2O8CA 3KSDO 1JA0A 4Q4AA 4TM8A 4DVJA 4L5AA 4MB2A 4GR4A 2JIMA 4YP1A 5MGNA 5FR2A 3UEOA 1CF9A 4GI5A 1DBIA 2LP4Y 3OU6A 5DN6A 4BE7B 1KH2A 2VPXA 2GCOB 2J5QA 3HKEB 4F1KA 2NACA 1Z47A 4WVFA 2KMLA 1VHJA 2JFXA 4CM9D 4KACA 5K4AA 5ARBA 3ZD8A 3CNNA 1WOYA 1BJTA 1KK3A 2IYWA 2QA5A 2V54A 2VQSA 1V5GA 1T10A 2ZFUA 3KKOA 3BJZA 1P2VA 1GVNB 4X1KA 5HTKA 1EX1A 1VMEA 1ZOSA 1U7WA 2QL5A 3EBLA 3L7KA 1EFUA 3GZNB 2JLAA 3G5TA 3PT5A 3H1BA 4R1OA 4CLXA 4E8YA 2D8MA 4BO3A 2HRDA 3E9EA 1INLA 1MENA 4HDMB 3MS7A 2IS2A 3DCIA 3K53A 4YC7A 4YIHA 1DC6A 1UC9A 1OR8A 4KB5A 5DBIA 2VDVE 2FQQA 1JFLA 2B83A 2O2DA 2WYIA 1K8QA 4HDRA 5AW7A 3PGKA 3KPWA 4ARCA 3QHPA 4E13A 4OH7A 2XAUA 5F98A 1LKZA 2OT3B 2QXUA 1BE8A 4HEA1 1J4AA 1C2TA 1ZUWA 3NBZC 2P1ZA 2VT6A 1A04A 1RWVA 2D2XA 2X1VA 1OFUX 3DOOA 1R6BX 3KVRA 2X3UA 3LGXA 2UUOA 4IIYA 4TTIA 3NV7A 5E1MA 4BNIA 2HLZA 1XEWX 4W9RA 3GLGA 4QDKA 1FTYA 2DUJA 5ECGC 4FD3A 2Q49A 1Z6PA 4G0MA 3NC2A 4KVAA 2IXAA 2O3JA 1YL5A 5DT2A 2R44A 4AMYA 2O7QA 3RYHB 1WDLA 2ZI7A 3UXMA 1UBFA 3H4VA 4EA6A 4MI3A 1PFVA 1O2DA 1WCIA 3VNQA 2W2LD 4EJMA 4ZFNA 5KUTA 3OM1A 2GCNA 3U4CA 4HDAA 2C1ZA 3VYVA 2JEYA 4RS4A 2A5FA 2J30A 2CDAA 3NH9A 5GZ6A 4IYJA 1BCRA 1SELA 4EB6A 5IUJC 3TDNA 1P44A 4QEZA 4U8HA 1C1HA 3A4VA 4JJGA 4WKBA 1YBFA 1FFCA 2H08A 2ID7A 4UASA 3FGNA 4TMKA 4M7WA 4B3XA 2R11A 3B7GA 3U3OA 1K7CA 1I8TA 3AIKA 2BZ1A 6YASA 1KI2A 4QODA 3BMNA 2WJAA 3KVYA 1CUJA 2QGZA 1IH8A 2G9RA 5H4HA 1C2YA 3CH4B 3ORHA 3MRTA 3O8LA 2PQ0A 5IJ0B 3F5QA 1QCCA 1WTAA 3DDHA 5FOWA 2DLNA 3I52A 1G6Q1 1E5DA 1W4RA 3L04A 1QOZA 4LECA 1L7XA 2B3DA 3JQAA 1CU1A 3KQMA 4RSMA 4XDAA 2AXQA 1QJCA 1W8DA 4MUKA 4FW8A 1FFYA 2PQ2A 4BFWA 1JJFA 4NDZA 2A86A 1P0MA 2HIHA 5JZBA 1HM5A 4PX2A 3NJ4A 4Z9XA 3HUFA 1GLNA 4QOFA 4Z9AA 3D8BA 1X3SA 2BGTA 1E4OA 2BTQA 5BQFA 4LC1A 4V3CA 2WKPA 3CZCA 3NJ8A 5TRTA 1SA0B 2X9LA 1YQWA 4CDNA 2VTEA 3G2HA 1KQNA 1N75A 1Y8CA 5NULA 3ZPXA 1UZMA 2AR0A 1LA2A 4YRSA 1MDFA 1UT5A 5CCBA 3Q8MA 5CHEA 3EXFA 5L6LB 3FZGA 3CN9A 1JR4A 1SC1A 3UUEA 4OXIA 4U1RA 3HVKA 1YBAA 4A3SA 2B5VA 5ITZB 4B85A 1P0IA 3URKA 2Z9BA 4LYAA 1NOIA 2G76A 3GNLA 3T1QA 2W6NA 3ZCVA 1LJ8A 1EFPB 1PR4A 2H2GA 4YJDA 3SJCA 4RK5A 6AT1A 5LPNA 1J70A 4FB4A 1EXVA 3AB7A 4LVCA 4Y2RA 1V8PA 2C4WA 1CUAA 1XRSB 2AM1A 2LVBA 4WKGA 2ZJ0A 4RA9A 1GTG1 4GMFA 4DMRA 4GWGA 4R3UC 3WR5A 1RAEA 2C9DA 4KR0A 2M1XA 1E2DA 3CF4G 3BJIC 4HVAA 4MI1A 3WLKX 3OLXA 2Q8NA 1IK6A 2ECQA 4KN8A 1HE2A 4G01B 3G23A 3LTEA 4UM9D 3ZWXA 3A6EA 4TSKA 4O2BA 4W8OA 5CA0A 2V3WA 1JS1X 2XHEA 1X0VA 1YTLA 5ADWA 2REQB 1GGKA 1XQ6A 3ZDCA 4LZWA 1T5IA 1MJNA 2WF5A 5G1PA 4A0QA 3AR3A 4NY1A 1FE8A 1PU2A 5IZCC 1FY2A 1V0JA 5C7OO 5CLFA 1HNWB 1JF8A 4LZJA 1TCBA 2GEKA 4BNLA 3COPA 3WMRA 5L3VA 3FPGA 3LFTA 4BL5A 1DC3A 3C87A 1AH2A 1RACA 3S2EA 4KQCA 3UQDA 1DQRA 2C7GA 1MAWA 4MGHA 2OZPA 3ZJ5A 3LFHA 1FUIA 2DJIA 5BSEA 1E89A 5FBKA 5I8PA 1SCJA 4MVJI 2Q1TA 3BSFA 5AMXA 3ON5A 5H02A 3P0RA 4KE9A 4MWGA 4R0NA 3ZLVA 5C5IA 1JNYA 1ZI6A 4NJOA 4WBNB 3QUCA 1RKDA 5ALFA 1QQTA 4MARA 1Y1TA 3V1TC 5DNEA 4BKRA 2XUZA 3K1AB 1AK9A 3WRYC 3PU6A 1BHQ1 1GU0A 4D46A 3O5AA 2J0SA 4J0JA 1QU3A 5DI9A 2VC2B 1NR7A 3OO0A 1F12A 1MC1A 1IBSA 2HRCA 3E9YA 1RLTA 2OBNA 3CE9A 4TTQA 1US8A 3O73A 1N6NA 4KGDA 4JFAA 1ZNQO 1XE3A 2FFRA 2Q3JA 3NNSA 4L76A 3K0AA 1IWPB 1IFXA 4MLPA 1GRCA 3R20A 1GG5A 5HZHA 2UUBB 1E8DA 4YQYA 1I14A 3NHBA 2X76A 4AQDA 5L7TA 1GTL1 3DDWA 3RUIA 4QPZA 2G5PA 4ZVQA 5KQPA 4EOHA 4E21A 2H1LA 3IT3A 2HPZA 1PG5A 4DV3B 1JKXA 3GLHE 3SF8A 1J49A 3PE4A 3DAHA 3DF7A 4UM7A 5DGIA 2UZ1B 2I6TA 5FD8A 1QO0D 2XGOA 1H8EA 3RVMA 1P9OA 1G3QA 1JIKA 1ULTA 3D6JA 4JUDX 3U1BA 4XYGA 3LFUA 3S2ZA 2OZVA 2IHZA 4YAEA 4DN6A 1J7JA 4GLOA 4PZYA 3F3SA 3WKCA 1IC6A 2DWQA 1K66A 1Q7TA 2ST1A 3AR4A 3FYSA 4C5MA 5HW0A 1CR2A 3JQAD 2NT4A 2QVYX 4D3SA 2C2WA 4J8PA 4CTJA 5H3LA 3ADBA 5GM1A 4TWIA 2AOXA 1O97D 2ERYA 4GMDA 4I1PA 4IJ5A 3V8NA 2JLVA 1PWEA 1G8KA 3C3EA 4LZLA 2VHQA 2JGRA 4LNAA 3CV3A 4GMGA 3P8ZA 4LWOA 3U7JA 3WIDA 3TG8A 2BSAA 1BMQA 1BOOA 2FSPA 4NR0A 3BWVA 3OCXA 4TV9B 4GBGA 2F4VB 2E21A 1OAKA 3BCSA 1H6DA 2GEJA 3GDFA 4AKSA 1VGQA 3BIXA 3U1VA 3DVSX 1NN1A 3IQDB 3R3SA 3UMGA 3SZGA 4BB6A 1L7OA 4CG3A 2UU9B 2E5FA 4P5DA 1CZOA 2J08A 3BDAA 3O6VA 5U1PA 3WYCA 4FEEA 3Q0IA 4CU5A 1MEEA 4R2KA 2B1JA 3W8EA 3N2GB 1ZXXA 2PRIA 4K2HA 1XDZA 4YONB 4F3RA 2YYAA 4F5ZA 1TD9A 3GLTA 1AKWA 3THOA 1IIBA 1QHXA 4HNAA 4L7QA 1Q3TA 1QPZA 1OX4A 2Y4OA 2ZWAA 5EWMA 1QP0A 1G2QA 5C35A 1K89A 3EN0A 2IF0A 3AY6A 2P78A 1CVLA 4IXMA 1L5WA 4C4PA 3ELUA 1E6UA 1E3SA 1EUCB 1G7TA 2JJ2D 3WGQA 1I2BA 3A4LA 3X2EA 5JMWA 5BY2A 1I13A 2F55A 1T5DX 1Q0SA 4LVOA 1JDBB 1KMIY 2NSLA 1HX7A 2Y0DA 3SSAA 3TQHA 3I3YA 2Y9MB 1Z35A 2Q6OA 3OLWA 1I0IA 1K5DA 5B53A 3RE1A 3WK4A 3THWB 3E4CA 3DMTC 1JX6A 2CJYA 1UM9A 4KOAA 1ZH0A 4G5YA 1FS5A 4W1RA 3TN7A 4UPEA 3ELDA 3DEYX 3LPCA 3GBUA 4GM0A 3ZM5A 5TQIA 3HP4A 3O38A 4PO1A 1AQIA 4J4TA 5EJ5A 3CLTD 3RC7A 4BAUA 2VP4A 2JI7A 3C1UA 3DTTA 4CXMA 4AJ2A 2PKMA 4Y2JA 1I2MA 2J67A 3A9UA 1PL7A 2ARKA 1W96A 1CSEE 3LQFA 1VLMA 4JU9A 2PUVA 3GF4A 3VDXA 3ASVA 4OMFG 1NE7A 2BISA 4UQPA 2X8AA 3K70C 1EK1A 1G9TA 1CVIA 3D7NA 4FMCF 5KTSA 2HT1A 1XZAA 3PC4A 2IP1A 3PR2B 5AR1A 4BQIA 2AQHA 2GEUA 3B6ZA 4M89A 3NTRA 5C41A 2ZBUA 4BLVA 4BX8A 1U2SA 3TAHA 1BNCA 2JCBA 3PDIA 5IABA 4FJ0A 1QZZA 5BSFA 3H86A 3AGQA 3QBJA 2QD3A 3TM5A 4BDSA 4ZOLA 5F5LA 2VP9A 5HEKA 2IFTA 4RHYA 4XQ0A 1DOZA 2AWNA 4V0RA 4KBGA 4D4IA 1WZIA 4EUEA 3QWAA 4AG3A 2WYHA 2ZOSA 3WFZA 3WIVA 3NHUA 1NW5A 1A97A 2OBBA 3WTBA 1QIFA 5B1IA 3ZDYB 3LCUA 1HGXA 1KBZA 2OHXA 1WABA 2LCIA 3JQBC 3S7ZA 1Y3FE 4G09A 1K6IA 3D5EA 2X4IA 3Q8LA 3VKGA 2PPVA 3VJLA 1DRJA 3UWDA 3RFVA 2BDEA 4N03A 5L40A 4JH0A 3QFHA 3R3ZA 4FI3C 4TWZA 4MLZA 4R7GA 1H8ED 1ENYA 1NUTA 3PLNA 1W59A 1C7JA 2FZKA 3QOFA 4ZO8A 3SE7A 4B6EA 4DMCA 1BVUA 3GEPA 1UFRA 1YB5A 2XZTA 3DDNA 3GUUA 4G1CA 5BUZA 3IBSA 6ABPA 4IWYA 4PC3A 4O1LA 2V1UA 4C30A 1GGMA 3E22A 3K2QA 1LDEA 4F5WA 4GR9A 5KTOA 1T0HB 5IYZA 3GX1A 4QKQA 1JZSA 1D0IA 2FVXA 5KJ6A 1NSFA 3E5MA 1DKPA 1XPUA 3EWMA 1PR5A 3G0IA 5LL6P 2GHIA 1Z29A 2PZJA 4F8YA 1DSSG 3B2EA 3EVGA 3WVNA 4UUNA 3R6TA 5FNVB 3I37X 4C4RA 2GB4A 1QFMA 4L4YA 1AKRA 1YS4A 1I1NA 3CZ9A 3FCSB 5FI0B 1RZRD 3IPCA 3SHTA 3TDKA 5A4DA 1JXOA 4MLDA 4IRUB 4X7BA 1U7UA 3T7EA 3VX4A 1RXEA 3C43A 1YS1X 4MRVA 3DVRX 4GOJA 4XM0A 3UCXA 1SCKA 1X80A 4Z8YA 3IUJA 1RD4A 1JQAA 4O02B 4RYLA 3UO8B 4KR7A 5DPMA 5BN5A 1QZXA 4OA8A 1VPLA 3LVQE 5THKA 1L5HA 4DQKA 3AUFA 2HJSA 3RANA 3D02A 3UA3A 2ID8A 2GPBA 3VVMA 4FS3A 2PZAA 1TJ5A 1P31A 5DU2A 2A78A 1T26A 2PL9A 3HCPA 2I7TA 4G85A 2NXNA 4U2FA 3ZYCA 3DZHA 1ZD8A 3UMVA 1WXXA 1WP9A 1GUAA 3T4EA 2GM9A 3B7WA 2C9ZA 4GSYA 4MWDA 5KTMA 1ESEA 2B30A 1Y82A 5CT8A 1TAHA 2DETA 2G9VA 3W7VA 4X90A 1XHEA 5BV7A 3KOWA 2NWQA 4M54A 4NJMB 5FUXA 1MF7A 4UFPA 1SC3A 5CPBA 3ETGA 4UW9A 2D0DA 3ZI0A 1Z39A 3KHSA 2GHRA 2FQXA 4QTZA 4A2PA 3RM3A 4D56A 3CWQA 5DO9A 1O94A 4Z4GA 5FULA 3DCNA 2F6RA 1A8PA 2PKQP 4RK4A 3KBOA 3N8GA 1JEAA 4MV0A 3OKAA 3KQSA 3RLFA 2WFLB 5AM1A 2ODBA 3GLVA 4LZZA 4DLZA 1E8NA 1LRKA 3FOCA 4PG4A 4WBSA 5KVQA 1DARA 1A69A 1D8AA 2OHHA 1XKQA 4URYR 3HV2A 3S28A 3LQQA 1ACJA 3DOCA 4GBED 5AW3A 4XSVA 3PTLA 1MO3A 4AZ3A 4BQRA 5I47A 2RBCA 4AY6A 2ZAGA 2I6BA 1DPFA 4A27A 5AQ1A 2MINA 2WUFA 5CTJA 5EJIA 3EDYA 4L73A 1ECLA 1GWNA 4ERNA 5CG2A 1QRTA 2HMYB 2W42A 1ENOA 1SVMA 2YTZA 3COZA 4OBXA 3L9XA 3HJTA 4KQKA 1TJ3A 3CX8A 4KSBA 4PGMA 4GPIB 4PS1A 3QVMA 1DJMA 4B5LA 1KOJA 2X0RA 4LBYA 5COAA 3C6BA 2FHSA 1C3OA 1P77A 4M7RA 1ZSVA 3B5JA 3CW8X 5DGCA 3H3XA 3PZSA 4FINA 3UTCA 1WDWB 1ODTC 3H1GA 3U9TA 1VYVA 1UXHA 2FDRA 4IQGA 4N65A 5LR6A 1D2HA 3E9MA 4NP6A 4HGOA 4ZV7A 3PF9A 1KIFA 4B35A 1QH8A 1DXOA 2ZIZA 5TY0A 2ZRDA 1JFFA 5DV9A 1U11A 2FP4B 1VBMA 4TYPA 3N07A 3ET5A 3QJ5A 1RABA 5BN1A 2WT9A 2NV6A 2ZP1A 3SBXA 2ECOA 3INYA 5HDBB 3BSYA 1BU8A 4XXHA 3BCRA 5IBPA 2F02A 2DR0A 2IEYA 1K4YA 3AEYA 1TAUA 4NMWA 5AK4A 3ZQKA 4RJTA 4EAQA 1HKUA 3BWYA 4MNTA 2I99A 2RB5A 3F6YA 1ZH4A 1IBLB 3CEAA 3Q7SA 2CWWA 5LDDC 1GHTA 4J0HA 1JILA 2QM8A 1U2RA 3BFPA 3PB3A 4DF3A 4PGGA 2IEDA 4J7UA 1DHTA 1Z06A 3L0ZA 1NC3A 3W5CA 3B9QA 4H7KA 1VRVA 4ZREA 4AJHA 1AQLA 2G5GX 2WHEA 1TPYA 1N1DA 2CF5A 3U2QA 5HGJA 1J7KA 2I6QA 4NZNA 2RJOA 5EHNA 3R77A 5F9MA 4B3GA 4RADA 3NYQA 1MIOA 1DLIA 1PZMA 1ZM9A 4C05A 4EPYA 3EZNA 1U28A 3GG2A 3I09A 1AM4D 4DPLA 5B5SA 2HX1A 1SXIA 3MAAC 3JQQA 4K9NA 1DBPA 5DM60 2SKEA 3IUQA 1V7PC 3RUCA 3GN2A 4TVKA 3U39A 3OPYI 4NARA 3ADOA 1K8XB 5ICEA 5DTRA 3GG9A 3IAHA 4US0R 2Z4TA 5AW6A 2RFLA 2XT0A 1FJGB 1XCLA 1Z62A 4RVCA 4X65B 3PLAE 3SYMA 3DEIA 2RIRA 1U8XX 4BEBA 4Q7KA 4EFLA 5LD2B 4D9HA 2QNRA 2JK1A 4C07A 4L85A 4YCAA 4B2LA 2RGRA 5BWOA 3HXLA 2WIFA 3FMOB 3GIWA 4AO6A 1CJVC 4RKQA 2Q2OA 3C48A 3MWLA 3MLEA 1QYVA 1T2AA 2Q2NA 2JK0A 2FETA 1IY9A 1R3DA 3O8NA 5F52A 5GV8A 1UT8A 5MHTA 4I1SA 2WHQA 3I01M 1G66A 1G5PA 2OR3A 3FI0A 4JWTA 3TRDA 3ZI7A 4AURA 2ZE7A 2QVZX 2YNMA 5KX5A 4NC9A 1FW8A 2E4YA 2VDRB 5AKLA 3QBTA 4QL3A 4G8BA 3J81k 2NQTA 2BGMA 2QVGA 3L79A 5E1BA 3SXUB 2VDNB 3K6RA 5HG0A 2JATA 2HMVA 2YW2A 4M0FA 4ZIYA 3OT5A 1Z33A 3KNZA 3KZ1E 5CH5A 1ZJ5A 2NNWB 4RD4A 5CM5A 2OOKA 4CW7A 5CTAA 3EOBI 3ER9A 1DWPA 1AK1A 3RFTA 1WXDA 1OMOA 4QOEA 4D98A 3OCJA 4E03A 1TO1E 5JVDF 2I1VB 5J4VA 2UVPB 1T4CA 4S1WA 3VYWA 3OEYA 3DEFA 4E94A 1ABEA 5F23A 2IUSA 4BC0A 3AP1A 4JAVC 2HH9A 2EX0A 4IDNA 2O48X 1HTWA 2G9QA 3AHJA 5FWYB 3NCTA 1C8VB 1N0IA 1WX1A 5EYPB 4MRMA 4A0GA 4PNPA 2IVZA 1F8GA 5E3IA 1OZFA 1GSOA 3NAGA 3B38A 2HFJA 3EUWA 1NMEA 4XPIB 5KTKA 1S2NA 2BGUA 4DC9A 4QBIA 1MX1A 3NEJA 1FZTA 2B9VA 5DN9A 3L8GA 2Q0HA 3KZVA 3QIAA 2RHJA 5SY4A 3EA4A 4CKXA 4PS0A 2BFFB 3HVIA 2FR1A 3HQ4O 3VC3A 4KHPB 1V11A 2H06A 3GRCA 4OSOA 1PEYA 1UFQA 1W78A 3BRWD 2JHPA 5K8IA 1UT6A 5DM1A 1B1CA 1BVRA 3ORFA 5E95A 3WRXC 1P17A 3LO5A 4C29A 2QMZA 3G2KA 4O1MA 2I54A 3AQIA 4GXQA 2IOHA 1Q1BA 1C9MA 2FPIA 3FYCA 5HE8A 3U80A 1AUPA 4YMSA 3RUDA 3V00A 2XXBA 2P1DA 5ECYA 1OFIA 1PBNA 4C2UA 4RK6A 2VUUA 1PDWA 4MP8A 4M0DA 2XBMA 2FSFA 4U9HS 2HEIA 4ETMA 1G21E 1YZLA 3SYLA 3D0RA 4MW4A 1Q17A 4KANA 3M33A 1DADA 2P6UA 3I01A 4I6GA 4MWCA 3NM6B 4A8JB 3D7KA 5ED4A 1UL1X 1SVOA 3FYUC 4WY2A 4BMCA 1KZ9A 4Z2AA 3QVGA 3HZOA 2XWSA 1W0JA 4NMHA 2YV1A 1M2HA 3HVJA 4J1TC 4CCYB 4LF7B 5CEFA 4U2BA 2IHUA 2Q4EA 1SC6A 2H4HA 2V7XA 2JARA 2A1UB 4ZGWA 5CB4A 2XUHA 3SJ7A 5C18A 2H0AA 3G1UA 5L53A 5H16A 2D06A 3W9BA 1PTJA 5I7EA 4C1BA 2ZR7A 4YCBA 1FFBA 3A05A 3B1KA 3LY7A 4GKBA 1U31A 2RAUA 1OWMA 2PZEA 4UBIA 2X77A 1ZC3A 5I7RA 5L45A 2GGSA 3NTQA 4DR3B 4P0QB 4MUJA 4Q1CA 1OPXA 1UQUA 4UDNA 4FHEA 5FV4A 4Y30A 4YPVA 4GMKA 3MN1A 2YJ6A 3D6VA 3Q40A 3TQTA 1NGSA 5M3BA 3WLNA 2JLSA 1D9ZA 2VDJA 3RQ2A 4E22A 3W5UA 5TVGA 3LT5A 4RJ2A 1B73A 5G4KB 3R5JA 1GRQA 2E5WA 3PC8C 4F6RB 4DXAA 2WQZA 1VDMA 3KE9A 3O1HB 1E0SA 3MSCA 2HWXA 1P5FA 3QWBA 5F2KA 4E88A 4EHKA 5L51A 4KADA 3QNUA 2JVJA 4EKEA 1PG0A 4EKNB 4N41A 2E4UA 2ZCUA 3EFHA 2GXUA 3LZCA 2F1OA 3QVOA 3B2QA 3R5SA 3N70A 5JFTA 3L40A 3RHFA 2K6GA 4Z7QB 3P9KA 2WSMA 1SBNE 2XB8A 1K7EB 2H5IA 1EX9A 3I5UA 3AKZA 1GCOA 2YNMD 1YCGA 4PLZA 3Q6NA 3UJHA 3ZKWB 3NBYC 5ITVA 1GG2A 1NVTA 5H0IA 3T5PA 4M1SA 2YOHA 3D2AA 3RARA 4RIEA 1ZSNA 1NHGA 1USGA 5BWNA 1MXFA 5BVHB 4NHEA 2FMKA 3OOWA 3RF7A 5J43A 4RCVA 2R3SA 3BB4A 1TXGA 2XLCA 4DRXA 2FMUA 3GOHA 5KTTA 2PLRA 1EJ0A 4KR6A 1B0UA 3PRKE 3PXUA 1RWXA 3PVSA 1IRXA 1HYHA 1QO9A 2NZ2A 2OHIA 4FZRA 4PRLA 1BXGB 5KKCA 3A1NA 2JNWA 1OIXA 4U0JA 5FO1A 2OCBA 4QPNA 1NX6A 3U7EB 1O7JA 4L28A 1EP2B 3NXSA 1XT6A 2NZ8A 4KW7A 1OH5A 4BU1A 4RQUA 5AH0A 5DK6A 3HPDA 4DUZB 1NNLA 4WCFA 1HYBA 5CNIA 2MSEB 5JXIA 4KLCA 4HEQA 4TL7A 1X1SA 1PV2A 2F3UA 3FE2A 4EQ6B 4ZYWA 3F6EX 2F8TA 3CB2A 3IURA 4IMRA 4DR1B 1PKXA 1OXVA 2V98A 1KJJA 3G2PA 5K0GA 2BV3A 1N25A 1OX5A 2IYZA 1H2AS 2YUIA 3LP6A 3R41A 4PAGA 1QPGA 1XK7A 3LUGA 1BMFD 2X0KA 2I62A 1LWOA 1NJ2A 2I65A 3C15C 4IXDA 4WPGA 1FZQA 3NHFA 2NZWA 2C3UA 3C6KA 4OAQA 3RTAA 1NRJB 3EXHA 5BYKA 5T64A 4AX4A 3AVWA 3V4RA 5GADl 2YH2A 3QLEA 3VR5A 4NE2A 3HCWA 2ZIXB 4BQPA 4WNIA 4GYYA 4CM6A 4CT5A 3HB4X 4K40A 1VL5A 4UU7A 5K2OA 1DBQA 1JDVA 2G7ZA 3GVPA 4GLLA 4RXMA 4UTVA 2JG5A 2VJYA 3AM5A 4XLZA 3WGMA 5KSYA 4Q1EA 1BE1A 2GUGA 2LDXA 3M4JA 3Q41A 4P2BA 1UJ6A 1GV0A 2OZKA 3H3JA 1QZUA 2D3TA 5A3QA 2XADA 3GJ0A 2W2PA 4AROA 5DNDA 4CR7A 3LXRA 4DILA 3GRRA 3RRZA 2WFMA 4IF4A 2VTDA 2HEGA 3OZWA 2VNIA 3ORSA 2VOSA 4RSRA 1KYWA 1SBYA 3D2CA 4I2NA 1UK8A 1EXNA 4F85A 1KIAA 3ND6A 3VOBA 4DY4A 5EQDA 2GVNA 1FJHA 2R84A 3TNYA 1C7FA 1A9TA 2E85A 1SUCA 3WK6A 3L07A 4EG1A 2CMGA 3OTIA 3GGDA 1I01A 3B3JA 4UBJA 1GIAA 3N76A 3AO0B 1YVDA 2G8NA 3KJIA 2QLNA 1N5RA 1F1BA 2JFFA 1V8BA 4FX5A 3BXPA 4QU9A 3VNRA 4XIIA 4EMSA 4YRKA 2X0JA 1N33B 5D1NA 4YV1A 1K98A 3JAKA 3M34A 1NN3A 1CB0A 3MJCA 2XF8A 1ZU5A 3M4YA 5DIZA 3LIIA 3TCXB 3UWOA 1J8FA 1P1JA 3SBEA 2IGBA 2C5FA 2YIMA 3H11A 4NDAA 4EJSC 3F8SA 3UK0A 2IH5A 4MRSA 4B3MB 2QG4A 4I4CA 3DT6A 1K86A 3FPAA 4DWVA 3FF4A 5AI4A 1Z5ZA 2O6LA 2P7HA 4XW2A 5CT6A 3RROA 2ZM5A 3DLBA 1U0NA 2R1TA 1KBOA 3GJSA 4YT5A 1K6JA 1R6TA 5FPKA 4JFRA 4DB2A 1TOAA 3RSFA 3TQIA 4URWR 3DSRA 1GA6A 3O8OA 2ZR8A 3I9LA 3ZJTA 1ADBA 4C0SA 2C3MA 1Y3AA 4OYRA 1AQUA 3WGOA 3AVPA 2AE1A 4O2LA 3L43A 5DHTA 4X61A 3MRVA 4J94A 1GYRA 3IHKA 1OU0A 4QDXA 3NL3A 4CEIB 4FJ2A 4JU8A 2C8VA 4Y0VA 5D8DA 2Q3MA 2CLSA 5LQSA 2V3VA 3U5ZB 2Q4OA 4URVR 1QF7A 1LTKA 4UUAA 2JGLA 3TR6A 1HMYA 4IM7A 1NWCA 4PC6A 1L8XA 4NOLA 1W5EA 5BT8A 1N78A 1YVEI 4C2BA 1BA3A 4IFEA 1M2VB 3K09C 4QJIA 3KXLA 1CZHA 3DBOB 3EEQA 2FU5C 4NOJA 1NBME 4QXOA 4Q05A 4DGQA 1ZAYA 1ADFA 2FWNA 3OLZA 1ENPA 1RKQA 3GR6A 3GYBA 3LW8A 3NHJA 3QEKA 4TV8A 4DA4A 4DSNA 1E69A 3HKDA 1X1CA 1DTWB 2YICA 2IXEA 2RHMA 4GEKA 1SXJA 4L2IB 4EG6A 3CCCA 1K3TA 4EI8A 3HDYA 3QBDA 3DULA 2YXPX 4G5XA 4QOHA 2R6CA 4ZANA 1KA9H 3O83A 3R9KA 1KR5A 4DIMA 1PYDA 2X13A 4FFSA 1IM2A 3KPUA 2YZ2A 2CXQA 2CHUA 5I7HA 3CTPA 3IRVA 1P2SA 4M46A 2GNAA 1W44A 3RT7A 1P2DA 2ZJZA 3D4LA 4GYKA 4HLCA 3T5TA 1QYRA 2JLZA 5EUQB 1KJZA 1GNTA 4BQNA 2YJNA 1P33A 1LSOA 2P4HX 5AVVA 4HQNA 4NZZA 1R64A 4JBLA 4R2MA 1LPSA 1J0BA 1PFKA 3EC1A 2VO1A 3H04A 4LSZA 4OGKA 6GPBA 4AI6A 2XX3A 3ECSA 3GJ8A 1YZTA 1A8UA 2ECPA 5AJWA 3VR5D 4C22A 3FYDA 4PYLA 4XEHA 3UY4A 1M2OA 421PA 4Z4EA 3PF8A 4KNVA 4Q47A 4LWQA 1TQ2A 3NEYA 4JS0A 3CWZA 3R0ZA 5F4BA 1EWTA 5I3ZA 1ZM4A 2Y92A 3UAOA 1RI5A 4BWVA 3WGJA 4KDCA 1MO2A 2HJWA 2WKSA 1THTA 1M1ZA 2XVAA 4A26A 4ZO6A 3LT4A 4B2PA 2AKYA 2C0PA 3GVCA 2IZOA 3ZZNA 1IN4A 3L82B 4B71A 5JLJA 2VTBA 3SLGA 4JK3A 3S2FA 3WK7A 2Q4RA 5DGXA 2B37A 2QYSA 4R8LA 3O95A 1XCOA 4MYUA 3PHLA 4K9RA 1GL7A 1QNFA 4X3OA 3VKHA 1QM5A 3VKUA 2D4HA 1L4NA 2GMWA 2TYSB 4V0NA 5HKOA 4F91B 1CY6A 1QSGA 2OBMA 4GX1A 3AETA 2DE0X 2J3IA 2GNOA 4QGGA 4YJ2F 1DX9A 2A9FA 3OWHA 5HQ3A 1D2EA 2V5UA 4GQBA 4RJJA 4TKUA 1Y89A 1S01A 4QRIA 4EPXA 4S1MA 2GI4A 3HACA 4PZEA 2PX6A 4RELA 3N2IA 2X8JB 5K0NA 5TDHA 3RS4A 3V2GA 3H8SA 4BMOB 5BMVA 1SOMA 3BZWA 2NYUA 1SH7A 1ZGZA 2QQ0A 1GZ6A 3HY4A 1C30B 4FPXA 3S2UA 3ILVA 1Z6QA 2C4NA 3IQZA 2AV6A 1TRKA 1WB6A 2PGNA 2QM0A 1SUWA 2QW0X 3EFBA 3O47A 1QKJA 2HLDA 1UINA 1ARZA 1W34A 4Q6WA 3DEHA 3O94A 1BROA 4NV0A 4ESEA 4F11A 5JJ5A 2Y1LA 3GCXA 2X8LA 5C5CA 3SBOA 5L95A 1PFQA 3UH0A 1UA4A 2XE8A 1C3QA 1P74A 5LMZA 4FYJA 1KXJA 3NWBA 2RH4A 1KOLA 2IDZA 3AL3A 3TVYA 5L4LA 2P2NA 5DTIA 5IWCA 4WZAE 3LBIA 1NY5A 5ABPA 5J47A 1UEXC 3ST7A 3U49A 1JDBC 1DCKA 3WNQA 4KH1A 2RJ3A 2P7IA 5EXSA 3R40A 1YDGA 5AJHA 3VHLB 3B52X 3MVEA 4BV9A 4LGVA 1VIVA 3AHEA 3DV9A 4RMNA 2E6UX 2BH9A 3LBAA 2GHQA 1L7RA 3D6NB 3B2NA 3O4GA 1DG9A 2Q9CA 5IFLA 1OWLA 4WK6A 3TGWA 4E12A 3PEWA 1OH8A 4P33A 4PYRA 3KKKA 4V0ME 3V7UA 1H0RA 1G0OA 2ZI5A 5J2TB 1V1BA 3E5HA 3CWCA 3SJAA 2AB0A 4V3BA 3S3TA 4Q7EA 3KV3O 3I5XA 3OJEA 2OK8A 5HJ2A 4ED9A 4FGUA 1WUIS 4EL5A 1N8NA 5SY9A 3ANNA 4IH4A 1OB5A 4PONA 1ESMA 1WUKS 2P6OA 2WK1A 3A1UA 3EXG1 1EGHA 1XLTC 4ER5A 4ZI2A 5F3WB 4QRHA 1GRRA 5K1ZA 2O3QA 2OQIA 3EASA 4LAFA 3GQVA 3IJPA 4PC2A 1KMHA 1JJAA 3EPPA 1SXJD 4PAWA 4X3PA 5EQTA 4FR0A 3SN6A 3X0DA 1DZIA 5GIPE 1TYDE 2IYXA 4MCHA 1I4TD 1P1CA 2FH5B 5C51B 4GM6A 3WDMA 2XOEA 1Q19A 2HU7A 3OTQA 1LPBB 3F74A 2EBWA 3X1JA 4CKWA 1DO0A 4D0SA 2AMVA 1UAGA 4QQRA 4X8OA 4HDCA 3DHEA 1IBMB 2FR0A 1GFWA 2QIOA 4V02A 3SFTA 1EG7A 5I4BA 4HN4B 4PZDA 4AK9A 4ASUA 1SG6A 4NAVA 3CKYA 2X5OA 3QKWA 4D8WA 3OZDA 4WLOA 5CW2A 1AMNA 1VOTA 2AMLA 2GEBA 1KTVA 2ODAA 2VF8A 3L6OO 3KR2A 1RHQA 3TTVA 2BFBB 2XITA 4FR5A 2IXTA 5FX2A 3EEIA 4I50F 1A5BB 5CM2Z 1P8AA 3WIEA 5ELXA 2C7BA 2X0IA 1Q57A 3T3GA 1P4JA 1PNTA 4MB6A 1VPVA 4RCZA 1B15A 3NBQA 3IFSA 5FTJA 3VR2A 2IEBA 1LH0A 3OUZA 4J07A 3N7TA 4WJKB 1OJLA 5AKYA 1T5BA 1ZVQA 2AFRA 3HVUA 3OIDA 2C9YA 1OYOA 1RI2A 1E1KA 4UDOA 3TW6A 2KPOA 4MV1A 5EIXA 3WMXA 3E9DA 3W2GA 2OO3A 4OHZA 5BQ3A 4N76A 2CL0X 4D9EA 2RMKA 3O91A 3K6SA 2JGNA 2HWWA 2YY7A 4IGKA 1XNJA 3G9UA 1CEQA 5K0SA 3PYXA 1K2VN 1Z5OA 5K99A 2D1TA 3WE7A 5L3SA 1LZKA 1Q1EA 3CCBA 3GDHA 3IEXA 4DJ5X 2PX0A 3T4UA 5H80A 1E2MA 3WGVA 2J9YB 3HBFA 1RDFA 5EL0A 3LDGA 5H9WA 1EUQA 2YW9A 3WBBA 4AWAA 4MB0A 2HWKA 1BMDA 1VG9B 2BFEA 2QEQA 3GW8A 4LI3X 1RHJA 1ZD9A 3N0TA 4GMXA 5AHWA 2QX4A 4AYXA 4O08A 2E1RA 4P93A 4DEVA 5GVSA 3VTFA 4GZMA 3BXEA 1K9VF 4PR3A 5A04A 1SQSA 4IKPA 2HU5A 2V9ZA 5HFJA 1Z5WA 3T1YB 1M2KA 3GAFA 3Q11A 4S35A 4LXXA 2R6GA 5A02A 3LCRA 1L7BA 1U6KA 1H2RS 1H9CA 3CA8A 4UNRA 4R6XA 2C82A 4QDTA 2YYYA 1MOQA 3ISTA 4C6SA 3KM0A 4HNUA 3RGWS 2W2XA 4NNJA 2GN1A 5CYPA 4QTYA 1JT2A 1TTPB 3BE8A 2YHSA 3GI1A 3EPKA 4IDAA 2XDQB 1ADCA 2ZZKA 1GGNA 3PFIA 1NFQA 1RE1A 1SC9A 3B13B 4PGAA 4U6SA 2DSTA 3LY9A 1ZKDA 4ZODA 4ARSA 3S81A 2HW1A 3ZCRA 2WDPA 2QAGA 1F14A 3JQ9A 3QENA 1EWKA 2FEWB 1N6KA 1V4NA 1VYTA 4KCGA 3QAIA 3G8CA 1WY5A 3OFKA 3SD7A 4BP1A 4LF8B 1II9A 1RBZA 2VZ8A 3OHMA 5DRYA 4DQXA 4E1AA 2OHGA 3W05A 3M6VA 4BNKA 3F3KA 1G64A 4MZDA 1JLMA 1YRLA 4KR9A 1RU3A 3SEZA 3WBFA 4E3AA 5DULA 4DRZA 1EIZA 4TMFA 1PS8A 4QFMA 1BCSB 5BYAA 4U6NA 1BEUB 3ENKA 4C5BA 3DH0A 2H4ZA 2O0MA 2FK7A 2X2OA 1FRQA 4J75A 3NGXA 4HDMA 4R7TA 1V1JA 4HWSA 4XOIA 1DXHA 3R0VA 5EQJB 5EZYF 3PNLA 4FYYA 2NTEA 2R5NA 5HRAA 5F64A 3UENA 2XYGA 4RSHA 3UMJA 1E1CB 4BLSA 1SXGA 3LUFA 5SY6A 2HA4A 4G9GA 2AJPA 4FOSA 2GRAA 3OCWA 5LNK6 1ISGA 2GM4A 2IZ6A 3I5MA 4EHBA 4DMGA 2P90A 4LJAA 2WDZA 4IEFB 4DSTA 1TKCA 2VJAA 3AINA 4C0WA 5BUQA 3ETLA 2X42A 3WGUA 2BC9A 2OCAA 2HSZA 4TX1A 3UBOA 3LO8A 2OQVA 3L0BA 1AIPA 4HNHA 1KJ9A 4LCEA 3FCOA 4KGXA 4YJGA 3UPDA 3V8QA 5I7UA 5FAKA 3GRPA 4EN4A 3O8DA 5ALOA 3REGA 2D00A 3IP6A 2VK2A 4EG3A 1G19A 2ADOA 3K2IA 3QP9A 4JJAA 4TKVA 3FUCA 4UNSA 1P7VA 1PJLA 2VTKA 3NUQA 1X7XB 2VRCA 4IQ4A 5GONA 4E5SA 1I3NA 1Z7WA 3KFXA 3WO1A 5F1PA 2A2ZA 3ULKA 3EH1A 2C83A 4LNUB 3AEZA 3RNLA 2J3QA 3EG9B 1S2IA 1U4SA 2GZ1A 2II6A 1DCFA 1I1QB 1S9HA 2V7QD 4I55F 1ODKA 4I6EA 4UMDA 4W1QA 4M8SA 3VR2D 1NY6A 4BKUA 1EDOA 2RIPA 4PIMA 1V4BA 3ZUPA 1GDDA 1NTOA 1U0HC 1Z82A 2O1WA 2BSXA 2WWHA 3L49A 4ENQA 5JZSA 2ZYSA 2PT9A 1NVWQ 2G1AA 3MNFA 4P2GA 3NC4A 4Y6OA 3TX6A 4B34A 2W22A 3FNBA 2BGKA 2BRUA 4K86A 2A94A 3EARA 1RC8A 4IBOA 1SZPA 2H2HA 2GVDC 2DH6A 3V42A 8GPBA 1VPEA 1K6EA 3IT1A 4R31A 4RQAA 1U0FA 1DFGA 1W75A 1IATA 4I99A 3HYOA 1Y8ZA 5CFLA 3II6X 5L7YA 2ZI6A 5DYGA 4I4NA 3DDCA 3PRHA 5CU7A 5ERGB 5BYJA 2CCJA 2IYTA 2QUBA 1X7GA 2WKRA 2OB2A 1VIYA 3AY3A 5EGNA 5PNTA 4ZI3A 2A33A 1D8TA 4E1VA 2ECKA 4Z0PA 3MMZA 3KL4A 4ZC8A 4Z4FA 2IS6A 4PG8A 4EYEA 1D2RA 3H4IA 2HAEA 2FEPA 2IZ0A 5LD2C 1AUQA 1A2QA 3LA8A 2H6EA 3U48A 4RZ3A 4LOJA 5IJZA 1UBGA 2HXSA 3PQFA 2ZRHA 3CVYA 1L1RA 5EY5B 1OGYA 3QFFA 5DI3B 1S3IA 5TF4A 1QR2A 2G0AA 5F7OA 3MPUA 4GP6A 3GD7A 2JGDB 4FLEA 1IN5A 2XCOA 4P5PA 1RCUA 4QUBA 3AW8A 4LYYA 3I9FA 3REFA 4DS3A 1SIOA 1RZVA 3HB1A 3MBIA 2GR9A 2XMRA 2ENUA 1OLXB 4WKOA 4JZYA 3HUDA 1HQCA 4OM7A 1M8KA 1L4GA 4PWZA 1XWWA 5CXUA 4G9EA 1USUA 4O2AF 5IVDA 4B3HA 2MIIA 4S05A 4MPDA 2ZRQA 3KIPA 4HB0A 1C9YA 4GIBA 1E3TA 1SXQA 1E99A 3NOQA 1S0UA 1T3LA 2AOTB 5T7BA 2BM8A 3OICA 2HZBA 1UJMA 3ADKA 1JL3A 4Y2YA 1IJEA 2AJCA 3HA2A 3M7IA 3WLIA 5THXA 3W7BA 3JD3A 2VTVA 1DQPA 2P9EA 2ENWA 1MABA 1Z5GA 1RXWA 2VUTA 4DKXA 1NP6A 4MKHA 3P9ZA 4QGHA 1WW8A 2QTMA 2VRWA 1N3BA 2JEZA 4RTPA 1HT1E 1DB3A 3Q9NA 3HC7A 3UUFA 2LV8A 4QXAA 1VMAA 1YR7A 2CFCA 5EE0A 5JUWA 3MD0A 4R7ZA 3NM4A 3NC0C 4M22A 4JVOA 2OXCA 1LNSA 3GFPA 3DEJA 1I9CA 3V2IA 4UOEA 3Q88A 3TK1A 5I7WA 1AMOA 1FLVA 4Z54A 1YQ9A 3EZFA 3QQPA 2VRCD 3O9ZA 3IAEA 4H2DA 4JBGA 2YCLA 1LC3A 1YB6A 2IKSA 2XDYA 3BMCA 2CJWB 3K1ZA 4NH4A 2ZUWA 3ZD7A 4NENB 3JU3A 3HFJA 2HYIC 4DZTA 4WASA 3ZUGA 1CQIB 3EIOA 1KXZA 1CUUA 1VMDA 4BKMA 1B6GA 4LXUA 3VQTA 1QIGA 4FMCB 3UAVA 1T9KA 1QGDA 1T6YA 2A7XA 2G1JA 3AKDA 4LN1A 3W4JA 1XZIA 5TS2A 1UPAA 4B6GA 2CXPA 2CXTA 2CVOA 4R2IA 3FFXA 4ZWNA 2Q0QA 3W6OA 4A8JC 1TTQB 4GS5A 5HRCA 4FCCA 3FZYA 1O94C 1QYDA 2CGEA 2O4CA 5AJTA 1SQ0A 4HDOB 4Z2YA 1LVHA 2W5UA 2WJPA 3DZGA 2WVJA 4Y1GA 4P3YA 1UKVY 2WG2A 2BT4A 1CY1A 4UUOA 3PQ8A 4YA6A 4EVRA 1I6LA 2SECE 1WSWA 2ZUTA 3GJTA 1Z4KA 4X1IB 3G2LA 3LUAA 5DXJA 1LCIA 2O5RA 5E9JA 3WMWA 1PGOA 4FP9A 5CD1A 1BDJA 3A0RB 2VUSA 3GLFE 3DP9A 3RQ6A 1ZUHA 3HNOA 4FGWA 5TMEA 3DJYA 5MFZA 1ONSA 2QE7A 3BRSA 1HQYE 3KSMA 1IAVA 4PXSA 5BP7A 1GITA 1Y9ZA 3AEKB 4ZKEA 2RHOA 5GJVC 3RPEA 2NIPA 3I30X 1DC4A 2GBLC 2YINC 4PCVA 1UBEA 1UANA 1VCIA 3WQBA 1TZMA 4BNZA 2FW9A 1IL0A 2Q28A 5L3ZA 4DR6B 3M2TA 3R2JA 2GK4A 1NMQA 1L7NA 4KN6A 1YO6A 3QEBZ 2C4MA 1H05A 1RXCA 1TQHA 3QV2A 4Q7LA 4C5CA 1L4UA 4I5GA 1RBMA 2A8YA 3WTCA 1CQJA 3LUDA 1MFPA 1XA4A 2C2BA 2J7PA 2PL3A 1T9HA 5AW8A 4HNTA 1HI9A 3LD9A 1XN1A 1A5TA 4BPBA 2PPLA 1M2GA 2CXHA 3UV3A 4CCWA 5HWSA 3MF4A 1B8UA 2M6RA 3OP1A 4HJXA 5AK5A 1FMFA 1GXSB 2O57A 3HO6A 2ZRKA 5DK4A 2GASA 1HC7A 2GCAA 4RGVA 2B2CA 4OK5A 5IM4F 4J6EA 3KYIB 1MVLA 3LCJA 3F3YA 1ODCA 1ISHA 3C97A 3HA5A 3K0FA 1PKEA 1KKUA 1EFVB 4TGLA 2CFSA 3P96A 4QQKA 2O2IA 1SCQA 4DV7B 3RBZA 3U26A 3L18A 1S89A 2CKMA 1UODA 2J4FA 2PD6A 1NBAA 3M5PA 1O9HA 4YGXB 1WHTB 2RGEA 3E1SA 3B3AA 3PSHA 4I4LA 4XEUA 2PLFA 3IQHX 4N47A 3VH3A 2IHYA 5HF5A 3ZY3A 4NZMA 4TYNA 1WJGA 2B99A 4WY5A 2XGSA 5AM3A 5JJCA 3BHJA 1CY8A 1VCHA 5A4IS 4UQOA 4KO3S 5LP6F 2AR9A 2XQIA 1NIPA 3K9NA 2JI4A 3IP5A 1LDBA 1NU8A 2X4LA 1GG8A 1JBEA 4QQNA 1U5BA 3D0OA 3IIMA 4R9NA 4XASA 1SURA 2QS9A 2XA1A 1IEVA 3SOPA 2WINI 4PSKA 5LXTA 3LWNA 2BE9A 2MYUA 3F7MA 1QYIA 1WY7A 1QHYA 2H63A 2QX9A 4Q1FA 1QG6A 3G85A 2FE4A 3GUVA 5JXJA 3OA2A 2Y1CA 1BN7A 2YZKA 2ZIVB 2AF4C 5L8VA 3ZWAA 1QHSA 2JJQA 5BR8B 2XUIA 5I7SA 4CQJA 5A1JA 2XXAA 5JE8A 1NR5A 1N8KA 3VYRB 3HCCA 4NCXA 3V34A 2IZ7A 3RBVA 4LJ4A 1RMYA 1C8LA 3LL7A 1PT8A 2B69A 2BJWA 4DV1B 3U13A 3WGTA 1GZ4A 3ESBA 1TUBA 2GJ4A 3H17A 4WN9B 1XU7A 4TTVA 2OGZA 1KPHA 1Y1RA 2JLQA 2R48A 3GAZA 4S04A 1B0ZA 4JKUA 1R6DA 1RAIA 2BCEA 4DLTA 4NL4H 4YRQA 3R3UA 1FX0B 1CEYA 3I4CA 1MX9A 4P7KA 1U3WA 2W37A 3O4JA 4NYJQ 1QHFA 1NUQA 3OO1A 1MX3A 1JB9A 1ESQA 1RKAA 1EVJA 2QZPA 4HDSB 4KE7A 4WACA 1SPBS 2ILVA 2JFOA 3KRTA 4MUBA 2ZRAA 3A1WA 1NVFA 3Q7TA 1UBOS 3KAKA 2X8BA 3OEEA 4K3UA 4U9UA 5ALPA 5AW1A 1W35A 1J09A 4NOKA 3ZEIA 4X45A 4BLPA 1BN6A 1ZNYA 2AG0A 7REQA 5IT4A 5HS6A 1LQUA 2ZI3A 3NDPA 1M33A 4HL6A 1NVKA 5SZKB 1U3GA 1H1TA 1EHCA 2BN4A 4UZSA 4YXWD 1TADA 1S7CA 2PU5A 5ADHA 2V03A 3I6YA 1XQ9A 2KB0A 3F1KA 3GLHA 1Z0SA 4JGIA 1JI3A 2GFHA 3KUUA 4GI3A 4JQCA 1L7EA 4BP3A 5I01A 1E5XA 1CDDA 4GI1A 3SJZA 3H87A 1A9QA 1RJ9B 2IA5A 5JECA 2UAGA 4LWZA 3VX3A 5T4HA 1GUZA 3LKVA 1EBBA 1GA4A 2AJDA 2JIZA 3ETJA 3V6MA 3K9WA 4N08A 3JVUA 3LUCA 1UIRA 4OBEA 4GWKA 2VP5A 2N1BA 1V41E 1RWQA 4ZMBA 1CDEA 2J46A 2DP4E 4TMZA 4C4SA 1HR0B 1G20E 1TZJA 2JRLA 3HZRA 2HMUA 3IAM6 1BHJA 5HIJA 2O14A 1LW7A 1Z37A 4BFTA 2XD9A 2XMQA 4XJXA 4JQSA 4DANA 2JHAA 1E0KA 1AHPA 2J7PD 3E15A 3H75A 4O0MA 2GO1A 3WA6A 5AJYA 2E18A 5JQWA 4I9NA 3STYA 1FVOA 3IOMA 3T95A 3DFFA 3G0OA 1VHTA 5FFMA 4OYYA 4GEGA 2G9ZA 5KI6A 4EW6A 1D6JA 2Y71A 3OLYA 4IMPA 5ECWA 2GEVA 5EE9A 3BD9A 4MTCA 2DFNA 3HRKA 4HXGA 5IK2A 2VNAA 4UTOA 2I8AA 2XNDA 4ZEVA 4C4AA 3CSSA 3PC2A 3QPAA 4JKIA 5DH9A 1SKYE 3B53X 3UYLA 5B58T 4E5KA 3JAMA 3Q8KA 1Y1QA 3KD3A 1O6ZA 3UGTA 2AFIB 5TPWB 4NS1A 4RZSA 1XAHA 4L0QA 3MWEA 4QUGA 4HUJA 3GT7A 3HJBA 3GFBA 1OHHA 1CJMA 4Y3UA 2QXYA 1AKQA 3Q3HA 1QKIA 4XKJA 4XSGA 2VSQA 4K9PA 1JYFA 2X8WA 3E7FA 4M1EA 1DDGA 1SVNA 4WEQA 3V8MA 4BJ1A 4CG2A 3B3FA 2PX2A 2B35A 3KZMA 1GCIA 2VSXA 1NI4B 1JQEA 4AMZA 5F7JA 4FEYA 4IIGA 4XD2A 4CL3A 5C2JB 4QDOA 4IRMA 5IF3A 3KUKA 5EKXA 4DDTA 2V59A 4R5HA 1OFHA 3SXPA 3EHEA 1R4NB 1N9ZA 1YAHA 2DKFA 3HCAA 4GWLA 3A2KA 2QT0A 3N0RA 3QOXA 1R5OA 3MYYA 1OH7A 5C3ZA 4EBFA 2Z3ZA 3FDXA 1P4RA 1F7UA 1MAUA 3FMIA 3NNNA 5JVDB 3BFVA 3FCUB 3D64A 3KCQA 2Q8QA 1VSTA 1U3UA 1YZFA 4AZSA 2BHNA 1BQ4A 3TNJA 4QO7A 1D09A 5E4JA 2PANA 1M2WA 2E49A 1C1XA 2O7RA 3NHZA 1NF8A 5DBOA 5JNVA 2A9VA 1ESJA 4L4XA 2O2ZA 2FRDA 2DKOA 5TEVA 2Y67A 1F48A 3I83A 2D7JA 1O1YA 2NPIA 2W6JA 1ZRNA 3C7AA 3ZCXA 5BOSB 1K4MA 1B23P 1M2JA 3S99A 3T8YA 1JFVA 2I3DA 3DC7A 3QITA 4DSOA 2VEDA 5LC1A 3ACBA 3U5TA 1PGQA 2OTCA 3CNBA 1KZYC 4OVKA 3DTNA 3I6MA 2CJPA 1OILA 1V1MB 2GBIA 4JL8A 4PLTA 4MV9A 3OEED 4RH0A 5IAGA 4ZYYA 4Q4LA 5HSGA 1SHTX 1O6CA 3QSYA 3AUSA 1ZMTA 1V2GA 3IAUA 3HYRA 2WLSA 3NDBB 2QENA 2AEJA 3QOYA 4IL5A 4NBSA 4PX5A 4YCDA 5D5HA 3KOOA 1XZLA 1Z3CA 2ZIWB 3D3WB 4RTQA 1SUEA 1OXBB 3Q1KA 1WF3A 2IXGA 3EZXA 4QYXA 4UBNA 4W7SA 3PQ7A 1IXYA 4LF4B 2GFIA 5DXAA 1MCZA 1MG0A 1RBQA 3SEQA 4BVAA 3JRXA 3MM4A 4HG2A 1GUYA 4E84A 1RYEA 3V3TA 3FNEA 4COOA 2EJUA 3EUFA 3GNQA 2R6AA 3NHYA 3ZE1B 1SCUB 3U3DA 1USIA 3GCGA 2CSXA 2WV9A 4RK0A 2JIZD 2F8SA 2BZSA 3AIMA 1TEZA 3D8SA 2YV4A 5JAOA 4CTMA 1QLWA 3EXHC 3HU1A 2QRVB 1WHSB 2JHCA 4M8NE 4XGIA 4BDTA 1XMQB 3CEHA 3ICCA 4MGKR 2ZIGA 1C4WA 3CR7A 3R9IA 2BKAA 5DHPA 4QG7A 1N7JA 5ALEA 5COJA 3IDFA 4LVUA 2VK1A 1NVBA 3NVMB 3KT3A 3QVTA 1ZW6A 3EGXB 1XVTA 3D6UA 4YO7A 5HA5A 3RIEA 1A8QA 2Z1NA 1NJ1A 4GAEA 2WI8A 1NQXA 2WBLC 3GRKA 4J0FA 4KQIA 3T9EA 4RK7A 2PUBA 4OHVA 1FTQA 3RK1A 4Y6PA 4UU0A 4HT3B 4PGHA 3TIVA 4CMGA 5DHFA 4NG4A 2C31A 1J9GA 1PTKA 3I64A 3LYLA 4HNQA 5K45A 2BEWA 3BE4A 1W73A 4NEQA 1AURA 2IGTA 1Z34A 2Y0EA 1BDMA 1TW3A 1WXHA 4Z9BA 2WQ7A 3ZDDA 4CDRA 4RNDB 3KWJA 1PJ4A 3ZY6A 4B3BA 2B2NA 1FQKA 3WOHA 4DTIA 3IHTA 2BUBA 1IZZA 4Z0NA 3DNPA 5JC8A 3CX3A 3E58A 1JBKA 1TU3A 3ASYA 3SE0A 4YMLA 2CLDX 1TRHA 2W6IA 7ADHA 5TLSA 1BDIA 1KOFA 4Y1EA 1CUEA 2HUNA 3OX2A 5LCXA 3WWOA 2QD2A 1H4TA 1VLVA 3PVCA 5CA1F 2ZRFA 3LCCA 4FE7A 5FBQB 4Q3KA 2H92A 3WQSB 4BNGA 5DHSA 1ZUD1 5LIRA 2GRJA 4LA4A 4ZOBA 5IXSA 3I2JA 4BJHB 5FTLA 3R5HA 4BRUA 2IHTA 2XCIA 4ARIA 1AOXA 4O4IA 2Q4DA 5C7LO 3AP3A 3FAKA 4JX8A 4JENA 1IK4A 4F86A 1WWKA 4I9UA 1V8ZA 1M0TA 3TQCA 3A6PC 3TOVA 5B3JA 5JCXA 4X7RA 4QG3A 2OP1A 4B09A 3IGFA 2HF9A 1LSUA 3VU8A 2WMOB 2ZYDA 4MRNA 1F5NA 3AF0A 3U4QB 3TO5A 5CBPA 1DIHA 3QE2A 5IT0A 4DBVO 2UXDB 2H00A 1FA9A 1NJGA 1TF7A 3K94A 2QL7A 1YVPA 1OBHA 1XD2A 2P77A 4KPEC 3IQEA 2FEAA 4WKPA 3QXSA 8ATCA 5IS2A 2Z8ZA 1FU7A 1II8B 1O8BA 1RW4A 1SBTA 2D2VA 2X58A 3IBGA 3LVRE 4M9RA 3E8XA 1L4YA 4MV8A 3WKEA 4BAGA 1JQKA 3FW1A 2DBRA 4K7JA 4Q1BA 1VTKA 1H2WA 4JLOA 1J2RA 4BQSA 4HAUA 3T5BA 2AI3A 3C39A 2XWPA 1IQPA 3ACCA 3BH7A 5DTEA 4BFZA 4PHGA 5KSPA 1GPLA 1Z12A 2FUG6 3K8ZA 2HHLA 3LJKA 3F7TA 2OLJA 5E7IA 5K8TA 4OSEA 4LDZA 3NYIA 3QTLA 4V0KA 1E4VA 1H22A 3GK3A 4HR7A 4MVJE 1KQOA 4X60A 3SSMA 4E07A 1YJQA 6Q21A 5K6AC 3WJ2A 3CLRC 3IESA 2A14A 2BMWA 5FUBA 5FH9A 3ZXSA 2ZYVX 1AK2A 3P52A 1PJTA 3CJRA 1X7WB 4R51A 5CX1B 1JPUA 2MMGA 2P6NA 4KGZA 7GPBA 2WHXA 4JVNA 3FPLA 2JL1A 1T36A 1IAQA 3DS8A 5E6SA 2QYHA 2HJGA 4WMLA 1C0IA 4MKGA 3UWPA 3ZDFA 3CVUA 1TA9A 2GKOA 2IZ1A 5G0SA 2BMDA 2XQGA 1MAVA 1SBHA 2NT3A 3L6BA 3PJFA 5JLAA 1GZ7A 1WLYA 4OMCA 4AD8A 1W48A 1ZR2A 3NKVA 1LI7A 1S4MA 2IQ5A 4OYHA 1NQTA 4Q0MA 5I8WA 2X86A 5DOZA 1IG0A 3A3NA 1GNVA 3I4FA 3QXGA 1QNLA 4KXYA 5EWLB 3UA4A 1SNYA 2Q5HA 4LZAA 4BLWA 2WUWE 3FHYA 9ABPA 2O50A 2HA6A 2OLEA 2NWHA 4DFDA 1F2UA 1BXRB 1RWWA 4RULA 1DJOA 3LH5A 4KMSA 2MSWA 3B51X 4UD6A 4HDNB 1P72A 4BZXA 2IS1A 1K7SN 1Z2DA 2Q21A 2VNKA 3ABRB 1WZ2A 4LXIA 1VSUA 4NBWA 3NALA 3FPJA 1Y6JA 2H1CA 3HJCA 4HRYA 1RHUA 2DFDA 4QX6A 3DAFA 2JGFA 3VSBA 2G9NA 3ZKWA 4OHUA 3JWHA 3KKEA 3F9CA 5KWIA 5CFZA 3PTAA 5CUQA 1XRQA 4BU0A 1FNNA 3KQWA 2EBFX 3RSGA 4F9GA 2F7KA 2RAVA 1I2DA 1OLUB 1XAJA 2YHIB 3IUMA 3Q7IA 4TT8A 5AK0A 4MJXA 1TMGE 3B20A 1B8VA 2HJRA 3CY6A 1TC1A 2IPLA 3EXEB 3KE8A 4RDHA 3EQZA 4PSVA 1Z0FA 2QRMA 3OU2A 3U6BA 3EIXA 1ZK1A 1E1NA 3JVDA 3TQOA 1PQ4A 3QBEA 2QLTA 3IHLA 5DTQA 4A8HA 2BHSA 1G6HA 1MC8A 4B4KA 4C0QC 4C03A 5HZKA 1XRLA 1KYHA 1A82A 2DPHA 1ULHA 1F0PA 3V32A 3R7DA 1KKLA 4EHDA 1YR1A 1MB3A 1EVYA 3FTQA 1TIPA 3L1HA 4JP8A 1NFRA 1AF7A 1NMXA 3ND9A 1JFSA 4MLCA 1K7FB 4UNIA 1XWIA 2J0EA 3PDJA 4CR6A 1I9GA 5F4ZA 5JALA 3ONNA 2DFLA 4DSAA 1CS0B 2J45A 3WHLA 1M67A 1H1LB 1VBFA 2FJ0A 2HMSA 3DPIA 4C89A 1EIWA 1MVOA 2LR0A 2Q6IA 2QYTA 4RLHA 3QEMA 5DBGA 2Z43A 4ZGGA 1I2ZA 4D0RA 4K9IA 1E92A 1W0KA 1J5PA 1WQ3A 4D8YA 5B6IA 3CE6A 3Q7EA 1E6CA 1BEEA 3GFFA 4NAUA 3B6KA 1L4BA 1R50A 1ESNA 2HQSA 3BEDA 4GE0A 4OHKA 3EFOA 4Y18A 4JYMA 3SIPA 3PHJA 3JZMA 3PSAA 3D6FA 1MO4A 4XQGA 4OHYA 2QAIA 1SM4A 2QTVA 5IBRA 3VXKA 3WSTA 2ZIXA 4ZJUA 4ZT2A 4CHGA 4ZEWA 4CV3A 4JHLA 4RTLA 4MQFB 3NAZA 2CW5A 1XALA 1T29A 5AJXA 4Q4JB 3ZU6A 3CKKA 1JHXA 4NQRA 3MOIA 3P4YA 5B1EA 2OUKA 3Q12A 1FEZA 1YJCA 2UXCB 2D1RA 2J0VA 3AHFA 3LP8A 4HFJA 4LQDA 4H3KB 2AI2A 5K5EA 2QMOA 2IU3A 1FCJA 2I4NA 3C41J 1IZ9A 4YUXA 4R2WA 3ZNOA 3ZV7A 1W2WB 3N3BC 4CT4B 3HXKA 3N5CA 2HLNA 2OPBA 1W85B 4YRGA 3O3CA 3GP3A 2ZREA 4ESOA 1ZSYA 5IKEA 1WIWA 5KC9A 3BIOA 2ODPA 4JYZA 1GPJA 2KLBA 4HAYA 2BEVB 3DZKA 3T5GA 2XLBA 2I8LA 1RJFA 1L7PA 1O96B 5CMLA 3AHDA 4WINA 1T4BA 2IY9A 2IYAA 3VOAA 2HCFA 4OPMA 1JA9A 1EGAA 4R0VA 3MINA 4MYHA 4B44A 4LJRA 3MXTA 1S96A 1Q50A 2FR8A 4P34A 5JS8A 2W8BA 3VPHA 3D8UA 1J0CA 4LBVA 4Z3DA 1F60A 2QTFA 4P8RA 3PLRA 4JLDA 2QJWA 1MDBA 5T3YA 1M1XB 4QUAA 2IPOA 5HGXA 3B60A 1DTEA 2O06A 3JD2A 4FTWA 2HHAA 1ZCZA 2E4XA 2DLCX 3SX0A 2Z1DA 1WR8A 2HCJB 4IXWA 1LS6A 4HNGA 2R8EA 1FLDA 3NYWA 5AVJA 4KP7A 5C37A 3LC1O 1P4HA 3HADA 3QVSA 5CJ2A 1V7ZA 1E3DA 2WT4A 3PUXA 3JQ8A 1JEOA 2ZSIA 4YJ2B 3PNVA 1EEHA 3OQMA 1E2KA 4BZQA 3BB3A 2F48A 3UT6A 5CXQA 1QZ3A 2ZU0C 1L6RA 1Y9DA 4BFXA 2EOAA 1I94B 2P62A 4KFRA 3IDQA 4JMPA 4OBWA 4EW2A 1CG6A 1ODFA 3B70A 1SHZA 3BXGA 5CNMA 1H5NA 2QRZA 2QWXA 3LC0A 4KI0A 3AF3A 1QKKA 1YC5A 2I55A 1FF9A 2A5GA 1D0VA 1LC0A 3G5MA 3MCVA 3S55A 3OX3A 3UF0A 1LS1A 2OPHA 2ONKA 5BOVA 3A70A 1LV7A 4FFOA 1HK7A 1Z5NA 1FTSA 1QTQA 5EHQA 1M2VA 2NZYA 2YY5A 2GZ3A 2ZWMA 4JP5A 5T8KA 3RRNA 2RGAA 3JX9A 1Y6GA 3ZS8A 2R7AA 4G2NA 4B3SB 1A50B 3UQ9A 4JYCA 5E1OA 1UF9A 3FB1A 3GFRA 2A9PA 3RVLA 2Y1GA 4GUAA 4C88A 1KHHA 3FGZA 4AP6A 2PIAA 1EH5A 2HK6A 1VL6A 2W2KB 1ZRSA 2I6GA 4L2IA 4ODIA 3MTJA 3KHUA 1I80A 3KDPA 3STVA 1RFUA 1L4EA 4JIMA 1OV4A 2QRLA 5PGMA 3GGSA 3ER8A 2E4AA 4QWMA 1J25A 4IS2A 5COQA 1U9CA 4ARBA 2E5LB 3T3IA 2WIAA 1CR6A 1M1NB 4GICA 2M2IA 2CYCA 1E7RA 3I9MA 3ASZA 3T99A 1Q0TA 2HPVA 3OFJA 5I5GA 3UPUA 1SVIA 5FO0A 2E37A 3E1KA 1AGYA 1RWMA 2VDWB 4JUCA 3D4NA 2JBAA 2CEKA 3HWSA 4M6WA 5BRAA 1TVKA 2R6FA 3UJDA 3K0CA 4M1TA 3U3ZA 3HXOA 2X5JO 2QAGC 2R86A 2ZETA 4D9JA 1YU9A 3JQ9C 3R4CA 4ZT3A 1NM5C 4FX2A 2V0NA 1D0SA 4OSPA 4W7IA 4ZVMA 3RTCA 2TECE 4LRQA 4MCIA 1DUSA 1V39A 1C1DB 2DT5A 2QN1A 2DBYA 3ESCA 3FWKA 1FP7A 5A4JA 3M6IA 3E2PA 4F9TA 3ADDA 2H2FA 4CF7A 3ZU3A 1Q3HA 1WOMA 1BFUA 1VK4A 4XX1A 2ZUCA 3AG5A 3LT1A 2H9YA 4QBKA 3N5KA 4DLYA 5L4SA 1ES9A 3W7AA 1N7IA 2SHKA 4OQFA 1M2EA 1KEVA 2IEAA 2VSFA 2HSJA 4W1PA 4AY3A 4GC5A 4GE3A 1OC2A 4YUYA 1CTQA 2PTHA 2GAIA 3EE6A 3G68A 3U0BA 1J23A 2PO5A 4H59A 1F3LA 4HYYA 1VFNA 1M74A 5HK8A 2PKWA 1ZQ1A 4YP0A 1YUNA 1BOFA 5AM4A 4K28A 3WI7A 1EUZA 5JOQA 2VAPA 3OAAA 3ND5A 1T3ZA 2EVWX 4I50B 4YGYA 3I9V6 2F2TA 2VF5X 3BD7A 4GOMD 5EG5A 5EKTA 4WSOA 2WVHA 2P41A 5ICSA 3DMRA 2BGJA 1DEHA 3GFQA 2G0NA 4ILKA 3UN1A 2DDOA 1A27A 4BP8A 2X8JA 3PUYA 2DQ4A 4NYIQ 4PBRA 4B33A 4K0KB 4PLCA 1KKMA 4QULA 4N3AA 4YRZA 5CB6A 3ZH2A 3RG2A 1O5ZA 2XHZA 1CJSA 4W82A 2X19A 2RHLA 3GPBA 2VYND 5JASA 3RREA 1JW9B 1OBOA 2R5WA 3W4SA 3AHIA 4S0XA 4XD7A 5AKIA 3BXFA 5KNDA 1JP7A 5GGXA 1WXFA 2QZ4A 1I0ZA 3T7IA 121PA 1CETA 5K4HA 1G8HA 1E62A 1JEJA 4RPGA 1G7SA 1EA5A 1T1IA 2QVXX 4YI5A 4OGLA 4NNPA 1XB2A 2DDWA 3DVAB 3QWFA 5MN4A 1SB9A 1UMKA 2GN6A 2I4LA 4OM8A 2FWBA 2NZJA 4S1VA 5CT9A 3R75A 1XXHB 2XI4A 4MGZR 1E1RD 2HADA 1ZVKA 2Q5IA 3RT9A 1SBZA 3V9AA 2QOEA 2P9YA 2QRQA 1GU7A 1XQ1A 2GBGA 2PGOA 4UEKA 2EZ8A 3V4VB 1PQUA 4KTVE 1W1IA 3EDMA 3PWTA 4D3XA 2BRUC 4G5FA 4UVEA 4P4UA 2VG8A 1A9OA 3QU5A 4CMCA 4UPDA 3W8RA 1ZU4A 4JLUA 1CRPA 2V58A 3HB5X 4PYNA 4FGSA 3UVEA 4OL9A 1U9YA 2QZSA 3QUAA 2DCUA 2V7EA 4EEZA 1PT7A 4JUAA 1N5OX 1YK0A 1WPRA 3KO8A 2P9BA 4K26A 3VC7A 3L0IB 2PMEA 3P9IA 3ZBQA 3JATB 4ZTBA 1CUDA 1Z8FA 2YWDA 2OORC 5EVCA 1V1RB 1M1UA 1NJSA 3FNQA 1RRKA 3NM3A 2P3QA 1KJQA 3U44A 3KOXA 3GLGE 1U7PA 1NVAA 5JNWA 1ZZEA 4RF4A 3OJCA 1TD2A 1RXYA 2E6KA 3VV3A 3IO3A 4TS9A 3TSAA 4EY6A 3HR7A 4OHRA 5D3MB 1OWNA 5C4GB 5LU9A 4C01A 4MK4A 3LMKA 5BNFA 2SNIE 1RAGA 3VAAA 1KETA 4Q4HB 5J63A 3S4YA 3SFVA 1KF0A 2NU8B 4D3FA 1G21B 1T9GR 2O3UA 3CT4A 2XSZA 4IIJF 3IPAA 4FOOA 5EZYB 2Q9AA 3HV0A 3FUTA 3Q4GA 5FJJA 4BVEA 4NE7A 4IYRA 4BRZA 2FFAA 1IBCA 2VBIA 5TARA 4K8RB 3OZAA 5KQSA 2FLVA 2XUPA 1L7DA 2VBFA 5FPYA 1NBMA 1WG8A 1GKLA 5K3FA 2P40A 5IAOA 1S6YA 2VSOA 1L5LA 3RU2A 4HGQA 1DO2A 2HC9A 4G1EB 4U7PB 3SVLA 4MQEA 1F0KA 5EEHA 1A9XA 5KSWB 3FNHA 5GIOE 3VC1A 2EJVA 4Y6LA 1LX6A 3MFYA 1PWHA 1WU8A 4I9GA 3PVZA 4GRIA 2A4MA 4D79A 3ZHUA 2X41A 1I6WA 2PAAA 4YDQA 2ZB2A 1YB4A 3QV1A 3ZWDA 1CNFA 2RG7A 3SDZA 3ZHOA 1PQYA 3HU5A 3WB0A 3ADCA 2ZTVA 1TK2A 2F9FA 5COBA 4D5EA 2PXHA 3HS3A 1SQ5A 1WLSA 3JQGB 2HNKA 3NHMA 4YAUA 3U60B 4MPJA 1TEVA 3VZSA 4ENTA 1RIIA 4CLOB 1W5SA 2PDAA 3UJ9A 1ISPA 1EMDA 3W2HA 3G0BA 4I4IA 1A8SA 3H99A 1GZ5A 1BWSA 2D8AA 4M8LA 5TNXA 4BKQA 5A05A 3OAAD 4EDFA 2R00A 2RGNC 5LZ9A 1TZ2A 3ZVKA 3RQ8A 5ADUS 1GO2A 5MGBA 3MTBA 1K5GA 4I55B 4IDFA 1Z15A 3KZNA 1QU2A 4RC9A 1G5QA 1CUYA 3CNOA 3VNVA 1J8DA 4RIIA 3AI1A 2VJOA 4KODA 2L69A 4WK0B 5TR9A 4CV1A 3T3MB 2XDAA 4YAGA 3D8RA 2GO7A 1LJLA 1JPVA 1BGWA 4X0EA 1OLSA 1B93A 5A7HA 1RMQA 2RGXA 1F17A 4MP3A 2ZCJA 4C13A 1V35A 4K9LA 2FF7A 4QYWA 1PFUA 1P2UA 3OZBA 4UBLA 1XL0A 3BWMA 4G4IA 5E6UB 2DFVA 2WHPA 4N5NA 4MV7A 2OL4A 3WLLA 1B26A 4QBHA 3H9GA 3CR8A 1L5QA 4HK4A 4HH3C 2AR7A 3MT8A 2FV8A 4I1OA 3KVVA 2XDQA 2O0HA 2IHVA 3LL4A 2BP7A 2J3HA 3QTTA 2OV8A 4M7OA 2P5YA 1G18A 3JALB 2LTAA 2P9GA 3A3KA 4JLSA 4S3MA 1L3CA 3THRA 4DM7A 1KYQA 2O3RA 2J9FA 3A37A 3EJ6A 3DXFA 5DX8A 4D0NA 4AJ1A 1NXXA 2I67A 2BKVA 1YSCA 1MU0A 3K72B 1W4CA 1QIEA 2AZXA 1URPA 4WX2B 4D3DA 3SZOA 2WWVD 2IUTA 4FD2A 3X43A 2QRHA 2QHPA 2QY9A 1XOIA 3TTXA 3FTNA 4NPCA 1G16A 2VXBA 1DT3A 2WG0A 4ZQCB 4DJAA 2FPGB 2FSSA 1VJRA 1EQAA 5AFSA 5TQ2A 5AIAA 4TOIA 2AA0A 4ID3A 1ZEMA 4TUYF 4OLBA 3TTUA 4EVSA 1J0EA 2NUPB 3QA2A 4BNTA 1YRBA 4DMMA 5E4TA 1UOPA 3S2GA 1DU4A 2XYPA 1DQYA 4Z51A 4WZAA 3QPDA 2IHKA 3EVCA 1GOTA 3K73O 4NS4A 1WMFA 1EWVA 2HN9A 1B4DA 1JZQA 3R6DA 1T9GS 3LY8A 4G84A 3SG0A 3THXB 1OB2A 5IRCD 5BN3B 4DCNA 1KEEB 2GJAA 2XYQA 2ORWA 1PUIA 2PTGA 2QX7A 3PIIA 3KTAA 3PRYA 4WZ6A 5E9QA 1ADJA 1CHNA 2E4ZA 2WIGA 1JG3A 3ESAA 2ZPTX 4KQJA 5DLEA 5EZSA 3AF2A 4N5IX 4O2AB 1DKNA 2VAVA 2D1YA 1DAHA 4IGAA 4MKRA 3OD1A 4V0MA 2WJ3A 3GPCA 3IUBA 1K1EA 2HNBA 2K87A 5HUQA 4RUKA 1SOVA 4KFSA 4RTSA 1KO4A 4EHFA 5K01A 4O4LA 1MW9X 1W9HA 1WU7A 2EEPA 3ITDA 5HKKA 4ZQGA 4E70A 3D5TA 4ZGBA 3CSUA 2PGLA 1KAQA 4P31A 3IT0A 5EJFA 1NBMD 2O59A 1NZDA 2F3PA 3FSGA 3UAWA 2OCPA 2GZSA 4UNQA 2EKBA 2YXNA 4LQ4A 4W7HA 2CF6A 3WL6A 2GUWA 2BAGA 4LNUA 5JPDA 2DHCA 3U4QA 2YHAA 4LCAA 4V1CB 2KW5A 1YFKA 2CFRA 2LE0A 3HYCA 4E5YA 3PFBA 3WMFA 3SQXA 5EWJB 1YE8A 4B79A 4KGVA 2EFDB 1XDGA 3RVKA 3M6UA 2PV7A 3QHAA 3GFOA 3I2GA 3K5HA 3AEQB 2J41A 4MGYR 3LLCA 3EZ2A 3HFSA 3E3MA 3LX4A 5FLYA 2EX1A 1ZXBA 4PHTA 2NG1A 1E2PA 4RORA 3GLIB 3SC2A 1CEXA 1RXVA 2WWWA 1Y8RA 4CKBB 3DWFA 1H4QA 4S1TA 4KXLA 3E4DA 1LB1B 5CVUA 5BWLA 2Q5JA 4G0NA 4D02A 6REQB 5JS6A 1X92A 1RMTA 1JLLA 4K6FA 3V4LA 3SYNA 3EW7A 4ZOCA 3PGA1 4EY7A 1F2DA 1IHUA 2E4VA 2CNDA 2ZLBA 4MMYB 4Q15A 4X6XA 5EUCA 3DEKA 5TVKA 2Y93A 3D6TB 3ESQA 2QX8A 2ZRBA 1A9SA 3KZKA 2CLHB 3P2MA 3AZOA 2C5HA 3WMGA 4JP3A 3PI6A 4ZYTA 3T3EA 3ZCQA 3ABZA 2I2CA 4R1UA 2CEAA 2G67A 4AMVA 2X2FA 2HBZA 1EXWA 3ZIAD 5C1BA 5CNKA 3CUUA 2QL6A 3L01A 2X3FA 4Z0TA 3ROTA 3W2TA 3ZE8A 3FBWA 4L95C 2YFHA 2XCRB 1YUMA 4GH5A 3D8NA 3TZ6A 4ZT6A 4AJIA 5KU7A 3ITKA 1Y8QA 1GZHB 1PD1A 4KQ1A 1CJBA 1WP4A 2YQZA 4M98A 1DC8A 4P92A 1MOZA 3L0OA 3AJDA 1B1AA 1ATIA 3H5AA 4TQ9A 2NU9B 3NV9A 1E3EA 4GUDA 1X7YA 4V2IA 1NW9B 3L8FA 4R9RA 3S40A 4PFKA 4ZAXA 5EPUA 1VB3A 1WW2A 3WIUA 4BN4A 5REQA 3RSSA 4JLMA 3U37A 2Q07A 3VI3B 5DT9A 1Y5MA 4IP0A 3ROKA 3F4KA 5EJMA 4EVIA 4MITA 4R68A 3TUIC 4E11A 2SCUB 4BLTA 3ND7A 1OFVA 2GEDA 3MBOA 2PZLA 1X14A 4U7WA 5KDDA 4LY3A 4OHFA 1ODJA 3G9QA 1RJWA 4I6JA 4YAFA 1YS9A 5DNVA 3RGGA 2GWHA 3X44A 2WU8A 5DXFA 3PQCA 4A82A 2JD1A 4MR7B 4YUWA 2RD2A 2DHRA 2VFAA 3O84A 1LBE<