3IBQA

Crystal structure of pyridoxal kinase from lactobacillus plantarum in complex with atp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
STMLVAEDLSAVGGISLSSALPVLTAMQYDVAALPTSLLSTHTSGYGTPAVVDLSTWLPQVFAHWTRAQLHFDQALIGYVGSVALCQQITTYLEQQTLSLLVVDPVLGDLGQLYQGFDQDYVAAMRQLIQQADVILPNTTEAALLTGAPYQVTPDLEVILPALQAQLKTGAHAVITDVQRADQIGCAWLDEAGHVQYCGARRLPGHYNGTGDTLAAVIAGLLGRGYPLAPTLARANQWLNMAVAETIAQNRTDDRQGVALGDLLQAILALNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridoxal kinase from Lactobacillus plantarum in complex with ATP
rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ibqA00
3UQDA 2QCVA 3K9EA 4EUMA 3RTBA 3IH0A 4O1LA 4LC4A 4S1MA 4K93A 3QA2A 3CQDA 3NC9A 3PZSA 3VAQA 4C5JA 1TZ6A 2V78A 3FHYA 4N08A 3NL6A 4N09A 3MBJA 4LBXA 4E69A 2AB8A 3IN1A 4DU5A 3RTGA 3BGKA 2DDWA 4EN4A 3RREA 1GC5A 1RFTA 1ESJA 2PKNA 3B1RA 2VARA 4XDAA 3IE7A 1C3QA 3RSFA 1RKDA 1VM7A 4K8CA 5CM5A 5F0ZA 5F11A 3LOOA 2AA0A 3UQ9A 3FHXA 1GQTA 3RQXA 3RT9A 2A9ZA 2JG1A 2XTBA 1JXIA 3MBHA 3Q92A 5TQIA 3RTCA 4K9CA 3VASA 4C5LA 3UMPA 1UA4A 1RKSA 4JJPA 4XCKA 5EY7A 1LIKA 4YL5A 5BYEA 2PKKA 3RS9A 1LHRA 2PKFA 3RU2A 1LHPA 1RFUA 1EKKA 3I3YA 2AX3A 3NL3A 1RKAA 3NL5A 3RS8A 3B1NA 1LIIA 2Q5RA 2ABSA 4K8TA 2AFBA 3B1OA 2YXUA 1UB0A 3DRWA 3B3LA 3LKIA 3NC2A 3IQ0A 1V1BA 5BYFA 5C3YA 3B1PA 3EWMA 4E8WA 1BX4A 3RRBA 3LJSA 5BYDA 3RTEA 2NWHA 2I6AA 4JKSA 3RQ6A 3RQ2A 3UQ6A 3RQ5A 2DDMA 2C49A 3N1CA 3RT7A 3UBOA 1RK2A 1V19A 2AJPA 3NL2A 3PL2A 2A9YA 1JXHA 2FV7A 4GM6A 4KBEA 4LCAA 4WJMA 4EBUA 4EOHA 1LIJA 3NBVA 3KD6A 2AJRA 5EYNA 3UMOA 3NM1A 4E84A 3HPDA 3RSGA 3H74A 3RQHA 3RO4A 4U7XA 5C41A 5COJA 1U2XA 5CGEA 5CGAA 3RTDA 1ESQA 1VK4A 1YHJA 1WYEA 2C4EA 3NM3A 3HICA 1TD2A 1EKQA 4KAHA 4KALA 2R3BA 3W4SA 3H49A 3JULA 3GO6A 4X8FA 4C5NA 4C5MA 5B6AA 3RSQA 4XF7A 4UBEA 4E8YA 5BYCA 4KADA 1KYHA 1L2LA 3NBWA 3KTNA 1LIOA 4B8RA 2F7KA 3HYOA 1TYYA 3UQEA 4XF6A 2JGVA 1RFVA 3IKHA 2ABQA 4B8SA 1YGKA 3OTXA 4S1IB 3RTAA 3LHXA 3K5WA 3NCAA 5TRWA 4E8ZA 2YXTA 3B1QA 2I5BA 4C5KA 3RPHA 2RBCA 3IBQA 2DCNA 4JKUA 2HLZA 1V1AA 3ZS7A 3RSSA 2PKMA 5C3ZA 3QAIA 2R3EA 3DZVA 3RQQA 2JG5A 4DC3A 1TZ3A 2AWDA 2HW1A 2DDOA 3GBUA 1VI9A 1V1SA 5C40A 4E3AA 3RRFA 3RPZA 4S1IA 4K8PA 3KEUA 1DGMA 3KZHA 3Q1YA 3RRJA 2F02A 2QHPA 3RM5A 3RQ8A 4O1GA 3RY7A 4YWRA 1YGJA 4LBGA 4PVVA 4S1HA 3GO7A 4K9IA 4KANA 2HQQA 2I6BA 3RU3A 3BF5A 4K8KA
chains in the Genus database with same CATH superfamily
2VTEA 3EAGA 3UQDA 2QCVA 3K9EA 4EUMA 2AM2A 3IH0A 4O1LA 4LC4A 4S1MA 3HJ6A 4K93A 4UAGA 3RTBA 3QA2A 3CQDA 3NC9A 1GQYA 3PZSA 3VAQA 4C5JA 1TZ6A 2V78A 3ZM6A 3FHYA 4N08A 3NL6A 3NRSA 3MBJA 4N09A 4CVLA 4LBXA 4E69A 2AB8A 2GC5A 3IN1A 3RTGA 3BGKA 2DDWA 3UAGA 3RREA 1GC5A 1RFTA 1ESJA 2PKNA 3B1RA 2VARA 4XDAA 3IE7A 1C3QA 2JFHA 1E0DA 3RSFA 1RKDA 1VM7A 2UAGA 4K8CA 5CM5A 2Y66A 5F0ZA 3LOOA 5F11A 2UUPA 4HV4A 2AA0A 3UQ9A 3FHXA 1GQTA 3RQXA 3RT9A 2A9ZA 2JG1A 2XTBA 1JXIA 3MBHA 3PYZA 3Q92A 5TQIA 3RTCA 4K9CA 3VASA 4C5LA 3UMPA 3QCZA 1UA4A 2F00A 1RKSA 2Y67A 1O5ZA 4JJPA 4QDIA 4XCKA 1LIKA 4YL5A 5EY7A 4C13A 5BYEA 2PKKA 4EBUA 3RS9A 1LHRA 2PKFA 3RU2A 1LHPA 1RFUA 1EKKA 3I3YA 2AX3A 3NL3A 5A5EA 2X5OA 5B6AA 1RKAA 3NL5A 3RS8A 3B1NA 1LIIA 5A5FA 1W78A 2Q5RA 2ABSA 4K8TA 4C12A 2AFBA 3B1OA 2YXUA 1UB0A 3DRWA 3B3LA 3HN7A 3LKIA 3NC2A 3IQ0A 1V1BA 5BYFA 5C3YA 3B1PA 3EWMA 2GC6A 4E8WA 1BX4A 3LK7A 3LJSA 3RRBA 1GQQA 5BYDA 3RTEA 2NWHA 2I6AA 4JKSA 3RQ6A 3RQ2A 3UQ6A 3RQ5A 1E8CA 2C49A 2DDMA 3N1CA 4CVMA 3RT7A 3UBOA 1JBWA 4WJMA 3N2AA 1RK2A 1V19A 2AJPA 2XPCA 2UUOA 2A9YA 1JXHA 1W7KA 2FV7A 3NL2A 3PL2A 4GM6A 4KBEA 4LCAA 1LIJA 2GCAA 3KD6A 2AJRA 3NBVA 5EYNA 4EN4A 2JFGA 3UMOA 3NM1A 4E84A 3HPDA 3RSGA 3H74A 3RQHA 2XJAA 3RO4A 2WJPA 4U7XA 5C41A 5COJA 1U2XA 5CGEA 5CGAA 3RTDA 4BUBA 1ESQA 1P3DA 1VK4A 1YHJA 1WYEA 2C4EA 3NM3A 3HICA 1TD2A 1EKQA 1FGSA 4KAHA 1UAGA 2R3BA 4KALA 3H49A 3JULA 3GO6A 4X8FA 3W4SA 4BUCA 4C5NA 2AM1A 4XF7A 3RSQA 3ZL8A 4UBEA 4C5MA 4E8YA 2Y1OA 5BYCA 4KADA 4EOHA 1KYHA 3ZM5A 1L2LA 3NBWA 4DU5A 3KTNA 1LIOA 1EEHA 2F7KA 3RU3A 4B8RA 2JFFA 1TYYA 3HYOA 4XF6A 3UQEA 2JGVA 1RFVA 1JBVA 2ABQA 3IKHA 4B8SA 1P31A 1YGKA 3OTXA 2Y68A 2GCBA 3LHXA 3K5WA 3NCAA 4S1IB 5TRWA 3RTAA 2YXTA 3B1QA 4E8ZA 2I5BA 4C5KA 2WTZA 2RBCA 3RPHA 3IBQA 2DCNA 4JKUA 2HLZA 1V1AA 3ZS7A 3RSSA 2PKMA 5C3ZA 3QAIA 2R3EA 3DZVA 3RQQA 2JG5A 2VTDA 4DC3A 1TZ3A 2AWDA 2HW1A 2DDOA 3GBUA 1VI9A 1V1SA 5C40A 4E3AA 2VOSA 3RRFA 3RPZA 4S1IA 4K8PA 1GG4A 3KEUA 4QF5A 1DGMA 3KZHA 3Q1YA 3RRJA 2F02A 2QHPA 3RM5A 3RQ8A 4O1GA 3RY7A 2VORA 1YGJA 4LBGA 4PVVA 4S1HA 3GO7A 4K9IA 4KANA 2HQQA 4YWRA 2I6BA 4ZIYA 4CVKA 1J6UA 3BF5A 4K8KA
chains in the Genus database with same CATH topology
3UQDA 2QCVA 3K9EA 4EUMA 3RTBA 3IH0A 4O1LA 4LC4A 4S1MA 3HJ6A 4K93A 3QA2A 3CQDA 3NC9A 3PZSA 3VAQA 4C5JA 1TZ6A 2V78A 3FHYA 4N08A 3NL6A 4N09A 3MBJA 4LBXA 4E69A 2AB8A 3IN1A 4DU5A 3RTGA 3BGKA 2DDWA 4EN4A 3RREA 1GC5A 1RFTA 1ESJA 2PKNA 3B1RA 2VARA 4XDAA 3IE7A 1C3QA 3RSFA 1RKDA 1VM7A 4K8CA 5CM5A 5F0ZA 5F11A 3LOOA 2AA0A 3UQ9A 3FHXA 1GQTA 3RQXA 3RT9A 2A9ZA 2JG1A 2XTBA 1JXIA 3MBHA 3Q92A 5TQIA 3RTCA 4K9CA 3VASA 4C5LA 3UMPA 1UA4A 1RKSA 4JJPA 4XCKA 5EY7A 1LIKA 4YL5A 5BYEA 2PKKA 3RS9A 1LHRA 2PKFA 3RU2A 1LHPA 1RFUA 1EKKA 3I3YA 2AX3A 3NL3A 1RKAA 3NL5A 3RS8A 3B1NA 1LIIA 2Q5RA 2ABSA 4K8TA 2AFBA 3B1OA 2YXUA 1UB0A 3DRWA 3B3LA 3LKIA 3NC2A 3IQ0A 1V1BA 5BYFA 5C3YA 3B1PA 3EWMA 4E8WA 1BX4A 3RRBA 3LJSA 5BYDA 3RTEA 2NWHA 2I6AA 4JKSA 3RQ6A 3RQ2A 3UQ6A 3RQ5A 2DDMA 2C49A 3N1CA 3RT7A 3UBOA 1RK2A 1V19A 2AJPA 3NL2A 3PL2A 2A9YA 1JXHA 2FV7A 4GM6A 4KBEA 4LCAA 4WJMA 4EBUA 4EOHA 1LIJA 3NBVA 3KD6A 2AJRA 5EYNA 3UMOA 3NM1A 4E84A 3HPDA 3RSGA 3H74A 3RQHA 3RO4A 4U7XA 5C41A 5COJA 1U2XA 5CGEA 5CGAA 3RTDA 1ESQA 1VK4A 1YHJA 1WYEA 2C4EA 3NM3A 3HICA 1TD2A 1EKQA 4KAHA 4KALA 2R3BA 3W4SA 3H49A 3JULA 3GO6A 4X8FA 4C5NA 4C5MA 5B6AA 3RSQA 4XF7A 4UBEA 4E8YA 5BYCA 4KADA 1KYHA 1L2LA 3NBWA 3KTNA 1LIOA 4B8RA 2F7KA 3HYOA 1TYYA 3UQEA 4XF6A 2JGVA 1RFVA 3IKHA 2ABQA 4B8SA 1YGKA 3OTXA 4S1IB 3RTAA 3LHXA 3K5WA 3NCAA 5TRWA 4E8ZA 2YXTA 3B1QA 2I5BA 4C5KA 3RPHA 2RBCA 3IBQA 2DCNA 4JKUA 2HLZA 1V1AA 3ZS7A 3RSSA 2PKMA 5C3ZA 3QAIA 2R3EA 3DZVA 3RQQA 2JG5A 4DC3A 1TZ3A 2AWDA 2HW1A 2DDOA 3GBUA 1VI9A 1V1SA 5C40A 4E3AA 3RRFA 3RPZA 4S1IA 4K8PA 3KEUA 1DGMA 3KZHA 3Q1YA 3RRJA 2F02A 2QHPA 3RM5A 3RQ8A 4O1GA 3RY7A 4YWRA 1YGJA 4LBGA 4PVVA 4S1HA 3GO7A 4K9IA 4KANA 2HQQA 2I6BA 3RU3A 3BF5A 4K8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQD A;  2QCV A;  3K9E A;  4EUM A;  3RTB A;  3IH0 A;  4O1L A;  4LC4 A;  4S1M A;  4K93 A;  3QA2 A;  3CQD A;  3NC9 A;  3PZS A;  3VAQ A;  4C5J A;  1TZ6 A;  2V78 A;  3FHY A;  4N08 A;  3NL6 A;  4N09 A;  3MBJ A;  4LBX A;  4E69 A;  2AB8 A;  3IN1 A;  4DU5 A;  3RTG A;  3BGK A;  2DDW A;  4EN4 A;  3RRE A;  1GC5 A;  1RFT A;  1ESJ A;  2PKN A;  3B1R A;  2VAR A;  4XDA A;  3IE7 A;  1C3Q A;  3RSF A;  1RKD A;  1VM7 A;  4K8C A;  5CM5 A;  5F0Z A;  5F11 A;  3LOO A;  2AA0 A;  3UQ9 A;  3FHX A;  1GQT A;  3RQX A;  3RT9 A;  2A9Z A;  2JG1 A;  2XTB A;  1JXI A;  3MBH A;  3Q92 A;  5TQI A;  3RTC A;  4K9C A;  3VAS A;  4C5L A;  3UMP A;  1UA4 A;  1RKS A;  4JJP A;  4XCK A;  5EY7 A;  1LIK A;  4YL5 A;  5BYE A;  2PKK A;  3RS9 A;  1LHR A;  2PKF A;  3RU2 A;  1LHP A;  1RFU A;  1EKK A;  3I3Y A;  2AX3 A;  3NL3 A;  1RKA A;  3NL5 A;  3RS8 A;  3B1N A;  1LII A;  2Q5R A;  2ABS A;  4K8T A;  2AFB A;  3B1O A;  2YXU A;  1UB0 A;  3DRW A;  3B3L A;  3LKI A;  3NC2 A;  3IQ0 A;  1V1B A;  5BYF A;  5C3Y A;  3B1P A;  3EWM A;  4E8W A;  1BX4 A;  3RRB A;  3LJS A;  5BYD A;  3RTE A;  2NWH A;  2I6A A;  4JKS A;  3RQ6 A;  3RQ2 A;  3UQ6 A;  3RQ5 A;  2DDM A;  2C49 A;  3N1C A;  3RT7 A;  3UBO A;  1RK2 A;  1V19 A;  2AJP A;  3NL2 A;  3PL2 A;  2A9Y A;  1JXH A;  2FV7 A;  4GM6 A;  4KBE A;  4LCA A;  4WJM A;  4EBU A;  4EOH A;  1LIJ A;  3NBV A;  3KD6 A;  2AJR A;  5EYN A;  3UMO A;  3NM1 A;  4E84 A;  3HPD A;  3RSG A;  3H74 A;  3RQH A;  3RO4 A;  4U7X A;  5C41 A;  5COJ A;  1U2X A;  5CGE A;  5CGA A;  3RTD A;  1ESQ A;  1VK4 A;  1YHJ A;  1WYE A;  2C4E A;  3NM3 A;  3HIC A;  1TD2 A;  1EKQ A;  4KAH A;  4KAL A;  2R3B A;  3W4S A;  3H49 A;  3JUL A;  3GO6 A;  4X8F A;  4C5N A;  4C5M A;  5B6A A;  3RSQ A;  4XF7 A;  4UBE A;  4E8Y A;  5BYC A;  4KAD A;  1KYH A;  1L2L A;  3NBW A;  3KTN A;  1LIO A;  4B8R A;  2F7K A;  3HYO A;  1TYY A;  3UQE A;  4XF6 A;  2JGV A;  1RFV A;  3IKH A;  2ABQ A;  4B8S A;  1YGK A;  3OTX A;  4S1I B;  3RTA A;  3LHX A;  3K5W A;  3NCA A;  5TRW A;  4E8Z A;  2YXT A;  3B1Q A;  2I5B A;  4C5K A;  3RPH A;  2RBC A;  3IBQ A;  2DCN A;  4JKU A;  2HLZ A;  1V1A A;  3ZS7 A;  3RSS A;  2PKM A;  5C3Z A;  3QAI A;  2R3E A;  3DZV A;  3RQQ A;  2JG5 A;  4DC3 A;  1TZ3 A;  2AWD A;  2HW1 A;  2DDO A;  3GBU A;  1VI9 A;  1V1S A;  5C40 A;  4E3A A;  3RRF A;  3RPZ A;  4S1I A;  4K8P A;  3KEU A;  1DGM A;  3KZH A;  3Q1Y A;  3RRJ A;  2F02 A;  2QHP A;  3RM5 A;  3RQ8 A;  4O1G A;  3RY7 A;  4YWR A;  1YGJ A;  4LBG A;  4PVV A;  4S1H A;  3GO7 A;  4K9I A;  4KAN A;  2HQQ A;  2I6B A;  3RU3 A;  3BF5 A;  4K8K A; 
#chains in the Genus database with same CATH topology
 2VTE A;  3EAG A;  3UQD A;  2QCV A;  3K9E A;  4EUM A;  2AM2 A;  3IH0 A;  4O1L A;  4LC4 A;  4S1M A;  3HJ6 A;  4K93 A;  4UAG A;  3RTB A;  3QA2 A;  3CQD A;  3NC9 A;  1GQY A;  3PZS A;  3VAQ A;  4C5J A;  1TZ6 A;  2V78 A;  3ZM6 A;  3FHY A;  4N08 A;  3NL6 A;  3NRS A;  3MBJ A;  4N09 A;  4CVL A;  4LBX A;  4E69 A;  2AB8 A;  2GC5 A;  3IN1 A;  3RTG A;  3BGK A;  2DDW A;  3UAG A;  3RRE A;  1GC5 A;  1RFT A;  1ESJ A;  2PKN A;  3B1R A;  2VAR A;  4XDA A;  3IE7 A;  1C3Q A;  2JFH A;  1E0D A;  3RSF A;  1RKD A;  1VM7 A;  2UAG A;  4K8C A;  5CM5 A;  2Y66 A;  5F0Z A;  3LOO A;  5F11 A;  2UUP A;  4HV4 A;  2AA0 A;  3UQ9 A;  3FHX A;  1GQT A;  3RQX A;  3RT9 A;  2A9Z A;  2JG1 A;  2XTB A;  1JXI A;  3MBH A;  3PYZ A;  3Q92 A;  5TQI A;  3RTC A;  4K9C A;  3VAS A;  4C5L A;  3UMP A;  3QCZ A;  1UA4 A;  2F00 A;  1RKS A;  2Y67 A;  1O5Z A;  4JJP A;  4QDI A;  4XCK A;  1LIK A;  4YL5 A;  5EY7 A;  4C13 A;  5BYE A;  2PKK A;  4EBU A;  3RS9 A;  1LHR A;  2PKF A;  3RU2 A;  1LHP A;  1RFU A;  1EKK A;  3I3Y A;  2AX3 A;  3NL3 A;  5A5E A;  2X5O A;  5B6A A;  1RKA A;  3NL5 A;  3RS8 A;  3B1N A;  1LII A;  5A5F A;  1W78 A;  2Q5R A;  2ABS A;  4K8T A;  4C12 A;  2AFB A;  3B1O A;  2YXU A;  1UB0 A;  3DRW A;  3B3L A;  3HN7 A;  3LKI A;  3NC2 A;  3IQ0 A;  1V1B A;  5BYF A;  5C3Y A;  3B1P A;  3EWM A;  2GC6 A;  4E8W A;  1BX4 A;  3LK7 A;  3LJS A;  3RRB A;  1GQQ A;  5BYD A;  3RTE A;  2NWH A;  2I6A A;  4JKS A;  3RQ6 A;  3RQ2 A;  3UQ6 A;  3RQ5 A;  1E8C A;  2C49 A;  2DDM A;  3N1C A;  4CVM A;  3RT7 A;  3UBO A;  1JBW A;  4WJM A;  3N2A A;  1RK2 A;  1V19 A;  2AJP A;  2XPC A;  2UUO A;  2A9Y A;  1JXH A;  1W7K A;  2FV7 A;  3NL2 A;  3PL2 A;  4GM6 A;  4KBE A;  4LCA A;  1LIJ A;  2GCA A;  3KD6 A;  2AJR A;  3NBV A;  5EYN A;  4EN4 A;  2JFG A;  3UMO A;  3NM1 A;  4E84 A;  3HPD A;  3RSG A;  3H74 A;  3RQH A;  2XJA A;  3RO4 A;  2WJP A;  4U7X A;  5C41 A;  5COJ A;  1U2X A;  5CGE A;  5CGA A;  3RTD A;  4BUB A;  1ESQ A;  1P3D A;  1VK4 A;  1YHJ A;  1WYE A;  2C4E A;  3NM3 A;  3HIC A;  1TD2 A;  1EKQ A;  1FGS A;  4KAH A;  1UAG A;  2R3B A;  4KAL A;  3H49 A;  3JUL A;  3GO6 A;  4X8F A;  3W4S A;  4BUC A;  4C5N A;  2AM1 A;  4XF7 A;  3RSQ A;  3ZL8 A;  4UBE A;  4C5M A;  4E8Y A;  2Y1O A;  5BYC A;  4KAD A;  4EOH A;  1KYH A;  3ZM5 A;  1L2L A;  3NBW A;  4DU5 A;  3KTN A;  1LIO A;  1EEH A;  2F7K A;  3RU3 A;  4B8R A;  2JFF A;  1TYY A;  3HYO A;  4XF6 A;  3UQE A;  2JGV A;  1RFV A;  1JBV A;  2ABQ A;  3IKH A;  4B8S A;  1P31 A;  1YGK A;  3OTX A;  2Y68 A;  2GCB A;  3LHX A;  3K5W A;  3NCA A;  4S1I B;  5TRW A;  3RTA A;  2YXT A;  3B1Q A;  4E8Z A;  2I5B A;  4C5K A;  2WTZ A;  2RBC A;  3RPH A;  3IBQ A;  2DCN A;  4JKU A;  2HLZ A;  1V1A A;  3ZS7 A;  3RSS A;  2PKM A;  5C3Z A;  3QAI A;  2R3E A;  3DZV A;  3RQQ A;  2JG5 A;  2VTD A;  4DC3 A;  1TZ3 A;  2AWD A;  2HW1 A;  2DDO A;  3GBU A;  1VI9 A;  1V1S A;  5C40 A;  4E3A A;  2VOS A;  3RRF A;  3RPZ A;  4S1I A;  4K8P A;  1GG4 A;  3KEU A;  4QF5 A;  1DGM A;  3KZH A;  3Q1Y A;  3RRJ A;  2F02 A;  2QHP A;  3RM5 A;  3RQ8 A;  4O1G A;  3RY7 A;  2VOR A;  1YGJ A;  4LBG A;  4PVV A;  4S1H A;  3GO7 A;  4K9I A;  4KAN A;  2HQQ A;  4YWR A;  2I6B A;  4ZIY A;  4CVK A;  1J6U A;  3BF5 A;  4K8K A; 
#chains in the Genus database with same CATH homology
 3UQD A;  2QCV A;  3K9E A;  4EUM A;  3RTB A;  3IH0 A;  4O1L A;  4LC4 A;  4S1M A;  3HJ6 A;  4K93 A;  3QA2 A;  3CQD A;  3NC9 A;  3PZS A;  3VAQ A;  4C5J A;  1TZ6 A;  2V78 A;  3FHY A;  4N08 A;  3NL6 A;  4N09 A;  3MBJ A;  4LBX A;  4E69 A;  2AB8 A;  3IN1 A;  4DU5 A;  3RTG A;  3BGK A;  2DDW A;  4EN4 A;  3RRE A;  1GC5 A;  1RFT A;  1ESJ A;  2PKN A;  3B1R A;  2VAR A;  4XDA A;  3IE7 A;  1C3Q A;  3RSF A;  1RKD A;  1VM7 A;  4K8C A;  5CM5 A;  5F0Z A;  5F11 A;  3LOO A;  2AA0 A;  3UQ9 A;  3FHX A;  1GQT A;  3RQX A;  3RT9 A;  2A9Z A;  2JG1 A;  2XTB A;  1JXI A;  3MBH A;  3Q92 A;  5TQI A;  3RTC A;  4K9C A;  3VAS A;  4C5L A;  3UMP A;  1UA4 A;  1RKS A;  4JJP A;  4XCK A;  5EY7 A;  1LIK A;  4YL5 A;  5BYE A;  2PKK A;  3RS9 A;  1LHR A;  2PKF A;  3RU2 A;  1LHP A;  1RFU A;  1EKK A;  3I3Y A;  2AX3 A;  3NL3 A;  1RKA A;  3NL5 A;  3RS8 A;  3B1N A;  1LII A;  2Q5R A;  2ABS A;  4K8T A;  2AFB A;  3B1O A;  2YXU A;  1UB0 A;  3DRW A;  3B3L A;  3LKI A;  3NC2 A;  3IQ0 A;  1V1B A;  5BYF A;  5C3Y A;  3B1P A;  3EWM A;  4E8W A;  1BX4 A;  3RRB A;  3LJS A;  5BYD A;  3RTE A;  2NWH A;  2I6A A;  4JKS A;  3RQ6 A;  3RQ2 A;  3UQ6 A;  3RQ5 A;  2DDM A;  2C49 A;  3N1C A;  3RT7 A;  3UBO A;  1RK2 A;  1V19 A;  2AJP A;  3NL2 A;  3PL2 A;  2A9Y A;  1JXH A;  2FV7 A;  4GM6 A;  4KBE A;  4LCA A;  4WJM A;  4EBU A;  4EOH A;  1LIJ A;  3NBV A;  3KD6 A;  2AJR A;  5EYN A;  3UMO A;  3NM1 A;  4E84 A;  3HPD A;  3RSG A;  3H74 A;  3RQH A;  3RO4 A;  4U7X A;  5C41 A;  5COJ A;  1U2X A;  5CGE A;  5CGA A;  3RTD A;  1ESQ A;  1VK4 A;  1YHJ A;  1WYE A;  2C4E A;  3NM3 A;  3HIC A;  1TD2 A;  1EKQ A;  4KAH A;  4KAL A;  2R3B A;  3W4S A;  3H49 A;  3JUL A;  3GO6 A;  4X8F A;  4C5N A;  4C5M A;  5B6A A;  3RSQ A;  4XF7 A;  4UBE A;  4E8Y A;  5BYC A;  4KAD A;  1KYH A;  1L2L A;  3NBW A;  3KTN A;  1LIO A;  4B8R A;  2F7K A;  3HYO A;  1TYY A;  3UQE A;  4XF6 A;  2JGV A;  1RFV A;  3IKH A;  2ABQ A;  4B8S A;  1YGK A;  3OTX A;  4S1I B;  3RTA A;  3LHX A;  3K5W A;  3NCA A;  5TRW A;  4E8Z A;  2YXT A;  3B1Q A;  2I5B A;  4C5K A;  3RPH A;  2RBC A;  3IBQ A;  2DCN A;  4JKU A;  2HLZ A;  1V1A A;  3ZS7 A;  3RSS A;  2PKM A;  5C3Z A;  3QAI A;  2R3E A;  3DZV A;  3RQQ A;  2JG5 A;  4DC3 A;  1TZ3 A;  2AWD A;  2HW1 A;  2DDO A;  3GBU A;  1VI9 A;  1V1S A;  5C40 A;  4E3A A;  3RRF A;  3RPZ A;  4S1I A;  4K8P A;  3KEU A;  1DGM A;  3KZH A;  3Q1Y A;  3RRJ A;  2F02 A;  2QHP A;  3RM5 A;  3RQ8 A;  4O1G A;  3RY7 A;  4YWR A;  1YGJ A;  4LBG A;  4PVV A;  4S1H A;  3GO7 A;  4K9I A;  4KAN A;  2HQQ A;  2I6B A;  3RU3 A;  3BF5 A;  4K8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...