3RTDA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadh and adp.
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 179
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rtdA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rtdA02
4E84A 2AB8A 4XCKA 2QHPA 3NL5A 2HW1A 3NL6A 4B8SA 1LIJA 5BYFA 2C4EA 3IE7A 4LCAA 4C5JA 1C3QA 3RY7A 4JKSA 2XTBA 5CM5A 3RQ6A 3W4SA 4C5MA 3B1RA 3RNOA 2C49A 3UQEA 4N08A 1LIKA 2DDMA 4E8ZA 3RU2A 3NCAA 2AFBA 2PKFA 3RTAA 3K5WA 2HQQA 5C3YA 4EUMA 4XF7A 3LJSA 2RBCA 1UA4A 3MBJA 4K9CA 3RSQA 4KADA 1RFVA 2DDWA 1YGKA 3LHXA 4GM6A 5COJA 3H74A 3LOOA 2AJRA 3NC9A 3KZHA 4K93A 3B1QA 3JULA 3ROZA 4C5LA 2DDOA 4B8RA 2JG1A 1VK4A 3UMOA 1V1AA 3UQDA 4U7XA 2DG2A 3LKIA 2R3EA 3KD6A 4JKUA 5C41A 3RS9A 4K9IA 1LIOA 3MBHA 3IKHA 4O1GA 2ABSA 3RQ8A 4E8WA 3Q1YA 5BYEA 4EN4A 4PVVA 3B1NA 1KYHA 4X8FA 2A9YA 3RPZA 4DU5A 2NWHA 3ROEA 3RQXA 1V19A 3QA2A 3UQ6A 3EWMA 3RS8A 3NM3A 1GC5A 2AA0A 3B1OA 3HPDA 5TQIA 2JG5A 3PZSA 3NBWA 4YL5A 3I3YA 4DC3A 2PKMA 4C5NA 4EOHA 5CGAA 2I6BA 4E69A 1RKSA 3DRWA 3RSFA 4JJPA 4E3AA 2YXTA 4KBEA 1LIIA 4LBGA 1LHRA 3RQHA 2R3BA 1JZTA 1VM7A 5EY7A 3BF5A 3RQ5A 3KTNA 3FHYA 3OTXA 2PKKA 4KAHA 5BYDA 3RT9A 3IQ0A 3K9EA 5EYNA 4UBEA 2PKNA 3D3KA 3VASA 2QCVA 2AX3A 3RRBA 3RSSA 3H49A 4E8YA 5B6AA 3GO7A 4K8TA 1JXHA 3RU3A 3RPHA 5F0ZA 3BGKA 2O8NA 3RTEA 4EBUA 3Q92A 1UB0A 2F7KA 2YXUA 2I5BA 4N09A 3UBOA 5F11A 3RREA 2HLZA 3NL3A 1V1SA 3RM5A 3NBVA 2A9ZA 1DGMA 1JXIA 3VAQA 3B3LA 3DZVA 2ABQA 1ESQA 1RFTA 1YHJA 4KANA 4LC4A 2I6AA 3RO7A 4XF6A 5TRWA 1WYEA 2AWDA 2F02A 3GO6A 3RQ2A 1RK2A 4WJMA 3RSGA 2VARA 1GQTA 5BYCA 1TYYA 3HICA 4K8PA 1U2XA 3CQDA 3RTDA 3RT7A 3KEUA 3RO4A 3GBUA 3PL2A 3N1CA 3RQQA 1TZ3A 2JGVA 1TZ6A 3IH0A 3NM1A 3QAIA 2Q5RA 3IBQA 2DCNA 3ROXA 1EKQA 3NC2A 4S1IA 2AJPA 3NL2A 4C5KA 4O1LA 3IN1A 3FHXA 4YWRA 4S1MA 4S1HA 1RKAA 1EKKA 4KALA 1ESJA 3D3JA 3RTCA 4S1IB 1TD2A 3HYOA 2V78A 3RRFA 1V1BA 5CGEA 3RTGA 1RKDA 3ZS7A 4LBXA 4K8CA 3RTBA 4XDAA 5C3ZA 3RRJA 5C40A 4K8KA 1L2LA 3B1PA 1BX4A 3ROGA 3UMPA 3UQ9A 1LHPA 1YGJA 2FV7A 1RFUA 1VI9A
chains in the Genus database with same CATH superfamily
3GIDA 3MJEA 3Q15C 4J2TA 1TJ5A 4FDLA 4B8SA 1CRLA 2WUFA 3M0EA 5BV1A 2VATA 3KCQA 1SELA 2R96A 3ZDEA 1ZL0A 1Q14A 3GGOA 5GOZA 3H4VA 1NXVA 2JAHA 4DCPA 1GEGA 2V45A 1WB6A 2I2FA 2NAFA 2ZIAA 3IUYA 3IR5A 4EP1A 3ER8A 4QFDA 1NDHA 5CB4B 3CRW1 3T9FA 4EG8A 4RLSA 3KLPX 4CL8A 3EXEA 4QUEA 4R2IA 3RS7A 1O6GA 4ASUD 4EW1A 2NU7A 3LBNA 4AYTA 1G1AA 4I4TF 4EYEA 2QTTA 1GKYA 1CIVA 1Z2EA 2I29A 2R8YA 2RGEA 4YI5A 3Q8KA 3L7BA 4XEHA 5D1HA 2IV3A 5HX7A 3A1NA 2GPAA 5C5EA 5L6MB 1WY7A 2XDAA 3K8QA 1VMKA 4FDUA 3GJ6A 3CRVA 3OX4A 3QVXA 4AX4A 2D54A 1BGXT 3W9SA 4HBGA 3I45A 4AURA 5KC9A 2Y6VA 1HQYE 2HJGA 3OLXA 3ELWA 2YZMA 2IYRA 4RULA 1TLTA 2FDXA 3DG9A 1O97C 2Q6VA 4MH0R 4B44A 2MR5A 2V0GA 3WB0A 4QFCA 1E3LA 3ASVA 4IUYA 1WBDA 5LMNB 4UAUA 4DEXA 2OZLA 5F7ZA 3I3YA 3BE4A 3MIIA 1PYDA 5IAJA 5IYZB 2P67A 3MGCA 1UJ2A 1Y5NA 3C3KA 1ABFA 1ZVQA 3N0XA 4EA6A 2YZ2A 5J3JA 1AUPA 1QHXA 3AKEA 3OJEA 3TM4A 1AKMA 4G9BA 2JGDB 2ZR7A 3L6UA 1QYIA 1FPQA 2HQRA 4HD8A 3I5UA 1OASA 1PG5A 5IBRA 3G2LA 3ZY6A 2GILA 3RNLA 3OFNA 1HQKA 2DERA 1Z2DA 1G38A 1EJ2A 1M34B 1ZH4A 2ZIXB 3ZYCA 1V35A 3LHDA 5DSXA 4RPGA 4HDKB 3E3NA 4ER3A 3PDIA 1UKAA 2CHFA 2CEKA 3HCRA 3TRJA 1D7OA 2C2XA 2GEUA 2OBXA 4LZJA 1P72A 1JXIA 2QL9A 4BMXA 3A9RA 4LC4A 2RSLA 2EFHB 2WSYB 3GV0A 3B1ZA 2Y93A 2CGEA 1NVWQ 2BCJQ 4RHFA 3BAZA 4I81A 2HWWA 2CHEA 2CJPA 2TMGA 1FMJA 3EZ9A 2P8JA 1RKQA 3TTXA 1E77A 1CPYA 3QJYA 4KNVA 4NCNA 3UJPA 4YMLA 2X4LA 1NIPA 1T4CA 1TL7C 3UJHA 2X2FA 2A0WA 1QTNA 2IPOA 3O3MB 1XK6A 4HQOA 4Q16A 5GGXA 2B6HA 4B7XA 3TB6A 2C5LA 2D4AA 3OFSA 4UFNA 3WXMA 1TFRA 3KQLA 3IR7A 4MI9A 4RFLA 1DQSA 2A1TR 2Y67A 3E5RA 2JIZD 1Y33E 2CXRA 2D00A 5AYVA 3HTXA 5IANA 3T1YB 3HVIA 1X7WA 2JBAB 121PA 4OXRA 3HDHA 3K20A 1SRQA 3JWGA 1XQXA 2OBLA 3NBZC 2P69A 2ZPUA 1D03A 1UBEA 2IQIA 2V74B 5KNDA 5EWMB 5K3BA 2F3UA 1YBFA 2AQ8A 2P8SA 3B3QA 1KEPA 1JKIA 2NOAA 2YCBA 4BP1A 3L1JA 4GO1A 1Y9EA 2JRCA 521PA 5KOHB 3O03A 4DIUA 4NZNA 1E1CB 3IIKA 5A6SA 3PT9A 2SCUB 4HI0E 3PHHA 3PJDA 4LDZA 3SKXA 5I7OA 2UYYA 1UAYA 2WFZA 2A78A 2PBFA 4JHXA 5MN5A 1ISRA 1R37A 1J25A 1P2VA 2Q99A 2QMZA 2WEKA 2WNHA 3EB9A 2QVZX 3ECSA 2VWGA 3PCRB 4K5QA 5IAGA 3N2NA 3EZFA 9LDTA 2AZXA 3SX0A 1VHTA 4JI0B 3W6UA 3GRRA 3UUWA 1JUDA 5BOSB 4LIPD 3QNUA 4NATA 3FUWA 4CM1A 2PANA 1N4DA 1R4ZA 1XHEA 1QX4A 3OKFA 2GXQA 4I2VA 3EMVA 2Y1LA 5MF6A 2OO5A 4ZT3A 1FP2A 4IEFB 3U6BA 3FOCA 4KFCA 3R0IA 5DRTA 2NUTB 3ORRA 4WLEA 4DKJA 5BRJA 3OD5A 3TW6A 5KNCH 4M9SA 2OUKA 1E8MA 2W2PA 4PC2A 1OGJA 3H1AA 3ZX5A 1RBZA 3ESQA 1E0AA 4Z54A 1N9KA 4H1VA 5FBWB 4NF2A 3KTAB 3ZE1B 4G23A 3LM8A 4OB6A 4S2UA 2P11A 4BP9A 3TQSA 4FTWA 4B7UA 1H0SA 4I3FA 2KS6A 3NVKI 4G9GA 2PQMA 5ESWA 1H2XA 2HU5A 4WVFA 1A5ZA 2IDJA 2HUPA 2QENA 4PO9A 3QWIA 2BD0A 5CXUA 4ZAXA 4UARA 3YASA 5HKAA 5JWOA 1RKSA 1U2RA 3U3JA 5P21A 2W8BA 3VPAA 3LECA 2Q7OE 2W2VA 1CCWA 4PPFA 2ZT5A 2R87A 1GR1A 1L4HA 1RQLA 1BVYF 1O6CA 2WF9A 4R2KA 1XTUA 4RMNA 3RLFA 1KRWA 5LOVA 5BYDA 1MIHA 4OSEA 1NQ5A 1T1SA 2HQBA 3PSAA 1OJ7A 1OF1A 3FROA 4G86A 3S8YA 4UHKA 4R0MA 2Y0EA 3D4IA 4ZJZA 5ALJA 5GZ1A 1KBZA 2XUKA 2CMFA 4D3YA 5F1YA 4DA0A 1Y37A 3OUUA 4ZYTA 1JWBB 4TV9B 1AQYA 2P2SA 2DVMA 2JARA 1HF3A 1QB7A 3K4PA 2A84A 3J7AC 2ADOA 3RYIA 4UDXX 2QTZA 2BFOA 3PFBA 5LP6C 1B0UA 4FK8A 4BNWA 4BDSA 5I4BA 2C00A 2HIMA 3HR8A 1XDZA 2FJPA 2OGSA 3BHJA 3CM0A 1ZG3A 3NANA 4QA9A 5F73A 4C0HA 5JXJA 1U2PA 4R3UC 3IV7A 1I4WA 1T1GA 5T41A 1J5EB 1TZ3A 1FW8A 3CR7A 3IODA 3IALA 2O5CA 3GJRA 1Z8HA 1KI3A 5A5GA 2B1QA 3T1VA 3K09C 2IPNA 3GA0A 5E6RB 1H2ZA 2RHHA 4DPKA 1L7XA 2X58A 2J0QA 5I7HA 2VZEA 2QORA 4MVJA 2CNLA 1RYDA 4G8DA 4TPKA 3TMKA 3QNWA 4RPKA 2DECA 1S1CA 3OTIA 4H18A 1MQAA 4TKZA 5AVTA 4OMFG 4MYRA 5GJBA 3GRUA 4L8YA 2OC4A 5DN6D 4FLFA 5ALUA 3AI1A 5H81A 4IUBS 5AK3A 2GRJA 1GGVA 3D59A 3E35A 4I5FA 5K0NA 4G97A 4QFMA 4EJ0A 1RHJA 3DHNA 3G89A 2J9YB 1VQ1A 4F3CA 2Y1CA 4II2A 1AK9A 1ONOA 3PNPA 1JIIA 3OWHA 5ELMA 3KQUA 1B93A 1UOPA 3IKLA 5AXCA 1FXWA 3AL2A 3ZHSA 4INAA 4Y2XA 5EA2A 4LF6B 2DDWA 1XEWX 4GDFA 1ZH2A 2QN3A 5LVAA 3H74A 1VYVA 3EA4A 3IAEA 1LF5A 3A0RB 3ENQA 3ZV6A 5I48A 3ITNA 3WJAA 4A10A 1E2JA 2R79A 4E5NA 1AU9A 5D6OA 3AW9A 1C81A 4M6WB 5FTLA 1QQ7A 3N58A 1VYTA 3BMCB 4UBJA 1GPAA 2NWQA 2XB4A 2DH6A 3PKZA 1OB2A 2Q7XA 1P5JA 1P4JA 1UBFA 1TC1A 2I2BA 3AJEA 1PT7A 1DOHA 2JJ8A 2NUPA 1W9HA 1T6YA 4O4LA 1PWYE 1XZDA 3K3PA 4N5DA 1FSSA 3RVPA 2C61A 4B3CA 4O1GA 1CQJB 3PNVA 4RAOA 4GKAA 3A05A 3X2EA 1AQJA 3GT4A 3K73O 5BYBA 4S3MA 4WVLA 4ABTA 4IHJB 1M83A 5C8YF 4LF5B 3IYLW 4WW0A 4F5EA 2PGAA 2GEBA 2QPTA 3AJAA 3FR8A 5DI9A 2H7VA 1YB4A 1G63A 3C3DA 3HCDA 1LKZA 2WJPA 1RAGA 3D9QX 5EJ5A 1QONA 4IGFA 4TQUS 1U3TA 2I6XA 1UBLS 4XCVA 2XVZA 5T4HA 1ZBDA 2JFVA 2BFDA 3R5JA 2IOQA 4NJOA 3A1VA 3NR2A 4ZANA 4DHWA 1A9SA 2OZLB 4Z4QA 4KQWA 5K3AA 1JYFA 4O4IF 2C8VA 4XVRA 1KZHA 4UM5A 3W2TA 4ZGWA 1LLQA 1RRMA 2X7HA 1PF7E 2QB5A 3CLTC 2XQVA 4RBNA 4RVNA 2CDAA 1G98A 3P2MA 3CB4A 3HHPA 4E8YA 3Q2KA 2Q1SA 2R751 1SKQA 3TLZA 1PL7A 5DYIA 3HU3A 3LSTA 2C99A 1PL0A 3DE1X 3VYSB 4Y1FA 4EUNA 2YWFA 3C1AA 1CETA 2FP4B 2XQGA 1T26A 3CT6A 1S4MA 3ORFA 4UAVA 5IT4A 4E46A 4QO7A 1N5RA 1PP4A 3G9ZA 3RSOA 2FMUA 3ESYA 3KKLA 1DKRA 3O91A 4W9NA 4N49A 2OXRA 1HEUA 3GO6A 3IVRA 4DL9A 4DRXB 4P81A 3ZGXA 1MHTA 3WOVA 5DBFA 2QS9A 4DXHA 2HLNA 3CEAA 2PEYA 1SIOA 3NFRA 5EIOA 5ADVA 3RO4A 2BDUA 4YMWA 3BIXA 4JLMA 2XCIA 1A9QA 4JI3B 2IPAB 5C5DA 1GL6A 1R2QA 2E89A 2HSDA 3MOGA 1SY7A 2AMLA 5D3MB 3TDKA 3I62A 1M8GA 3T5BA 3TKLA 2NU9A 1Z0JA 1QYVA 2ANBA 2ODBA 2YV5A 3GRAA 4S1HA 2GRAA 1K8QA 2Q6KA 3DULA 5BNZA 2PMCA 1QBKC 3NHFA 3R5XA 5JBNA 4JI5B 3UNXA 1P91A 2O0JA 1E2KA 3M1AA 4ENQA 4KMRA 1E7QA 3NTRA 1VE9A 4MA5A 4CTJA 4OXYA 1GGNA 2JJ2D 3A10A 1C7IA 4ZWNA 2CE7A 4XGRA 5IAOA 2GF0A 2PWPA 2OCAA 3LGSA 2DFDA 2QMOA 4QDTA 3HNRA 2XXJA 3N8GA 4E4YA 5JEDA 5B37A 2HZ7A 3OX1A 5ETJA 4RIGA 2JAQA 1F1JA 2FMKA 3W6ZA 1DBQA 4B3TB 2YX1A 2Q4OA 1R88A 2OD9A 3IV9A 4B2PA 1KK3A 1U2GC 4OQNA 3ZKWA 2FJUA 1XBTA 3S2SA 4ZZ3A 1EP9A 4MYDA 3N1UA 3QEMA 1ZMTA 3AR9A 3ONDA 3SZRA 1SRRA 1I2DA 2XX3A 1YBHA 2YMLA 3NXKA 4ZAGA 1XZMA 3OEHA 3X43A 4EMUA 1JFVA 1PNOA 4RCVA 3CF6R 4XM2A 8AT1A 2FWRA 3DFMA 2A86A 3D0KA 4PNPA 3ZTTA 2XWBF 3IUPA 4KKXB 3UOGA 3UH1A 2A30A 1NR5A 1V9CA 1EQAA 1WPGA 2JCBA 1WDKA 3NS7A 4NE2A 5KYUB 2ZB8A 2YYZA 2WKPA 1DIGA 1W87A 3NWPA 2E87A 2RI6A 4FSDA 1XRJA 2PUVA 2GDJA 2BY4A 2GM9A 4JODA 2XEDA 1VJGA 3VKWA 1SD2A 5CG1A 2BGLA 4W82A 5L3RA 4EJ2A 3N5CA 4NCIA 3IKTA 1E5QA 2UYHA 1FP1D 3EXIA 4RJLA 5JBQA 4KLCA 3ZU3A 5F51A 2CXUA 3RVJA 1WCYA 4RCYA 3SF8B 4UVHA 3SIWA 4CI0B 1ZP6A 2NACA 1GZ7A 2ATIA 3G1UA 4UKDA 3ZVLA 4C7OA 4LY3A 1KEZA 3K2BA 3IDQA 1MZPA 5HNKA 4EMBA 4MS3B 4H1WA 2IX3A 4EI7A 1WW8A 3C15C 4EB6B 2YY5A 3HGMA 5CBPB 5KOJB 1OPRA 1IN4A 1KZ4A 1G20A 5EZYF 4RD6A 2HSWA 4AKTA 3IPLA 2J7PD 5KQMA 3IVCA 3IBSA 2PRSA 2AZTA 4A3SA 5B7NA 2VCEA 5B1YA 5KWEA 4XWAA 3JRXA 4CM3A 4NYJQ 4JY7A 1QO0A 5BV2P 3AOEA 1TK3A 2HNAA 1KKMA 3REFA 3SK0A 3E4DA 1YD7A 5AM4A 1DAIA 2XE4A 1H1TA 1XTQA 3A6KA 3CUEF 4MJ3A 4RSHA 4AN4A 1M34A 1WBJB 2QIPA 3ESZA 5T4FA 3VPSA 4CV3A 3PTLA 3E9CA 2O6LA 2X4IA 2R86A 1REQA 3OEEA 2WHYA 4RDCA 3FFAA 5TPWB 2FPOA 3O0TA 4RZ2A 4B3HA 1VKZA 4XW2A 4EL0A 4LG1A 3O2NA 1VSTA 3BWEA 1T0JB 2YHIA 4HLDA 3BK1A 4PO3X 1I1HA 3R5SA 4MAAA 1P2SA 1ATZA 1Z75A 1OBOA 2QL6A 2CWDA 2G04A 3UATA 4G0UA 3P32A 4GBMA 1GO2A 2YMMA 4X94A 1ZM7A 3HSYA 2YVLA 4LN1A 5IUKC 5BSEA 5L4SA 2H1RA 1MCZA 5C7IO 4N5NA 1H2BA 3HB7A 4AJ2A 4C78A 4LMAA 5FAXA 3MMSA 3MPUA 4MUXA 3RK4A 5AP9A 1DRUA 2F62A 2Z3VA 1PZEA 3GNSA 2QX4A 3R7BA 4RTRA 2ZTSA 1EIZA 1YTLA 2E85A 3BD8A 1F38A 1PG2A 2OPHA 1TXGA 4DVJA 4ETWA 4LBXA 1OBHA 1P73A 3BA1A 5CXQA 3FYSA 4KPUB 1FVOA 4PFSA 4S0ZA 3SYTA 3QEAZ 4OLFA 4MVWA 5HQTA 2VP0A 4J0DA 3ZI7A 4ER5A 3P0EA 4OI2A 1VMEA 2QW1A 2WTUA 1JDVA 2NTVA 3GVPA 2KJQA 3KQYA 5DN9A 4FVTA 4N76A 1THMA 3NRBA 3MCUA 4N6OA 1V8PA 3KJXA 3DAYA 3K6RA 3OZCA 4LZZA 3VR2D 2RC5A 4IBOA 4N65A 4ZCTA 4B4VA 4BRWA 3OCCA 3PDCA 3ILSA 5DISB 2Q49A 2PL9A 4K6CA 4C6RA 2DFLA 1JDJA 3I1FA 4DWWA 3HDYA 2W2LD 4LSZA 2RBGA 1YAJA 3LE8A 4NBWA 1KKUA 4PZDA 2DQZA 2QDXA 3SEZA 3U7IA 5BORA 3QKTA 4JI4B 2MSNA 2I7CA 1G0NA 3K92A 2IV2X 1EU1A 1SXJC 1S7GA 2NXCA 4ZOLA 2C29D 1GRQA 5DM4A 1Q7CA 4EGJA 2QXYA 4Y2VA 2IHYA 3UK1A 3VPCA 1G9XA 4OQMA 1G4AE 2DULA 5EIHA 1AHIA 5TARA 4G36A 4WSOA 2C7BA 3HS3A 3QMMA 1KMMA 4MJXA 3ZNNA 2YQZA 3J81k 3M8KA 2VCHA 2QRNA 1HT2E 3EDMA 4A7PA 4UULA 4L5YA 1MEEA 4IRMA 5EMMA 4V1CI 3PIIA 3AEKA 2VP4A 2I2AA 1SC4A 1MRZA 2WIGA 3AF6A 4F6CA 3OOSA 1TVKB 4J03A 5L8VA 3BMNB 3ZM5A 2ZSKA 4QX6A 1JDBC 3FZQA 2CFCA 3LX5A 2QJTA 4OQLA 5CTAA 4DXDA 4FMPA 1MXHA 2XSZA 3ITDA 1TPYA 2ORIA 2P7IA 3OZFA 4GQBA 4LDRA 3T54A 4DJAA 3F74A 2QMQA 3NX4A 1YL5A 1QFXA 3EXFA 4NFSA 4MQLA 3GXBA 4BLVA 3UT5B 2V54A 5ICEA 2VAVA 1XEFA 3HKBB 1I3LA 3GP5A 2H4JA 3O1IC 5ADWA 3GXOA 1K86A 1Q1QA 1SD5A 3C4JA 4RY8A 4CUJA 1T8PA 1UPAA 1WUHS 2PWZA 2RHGB 3K6JA 6ABPA 5K9ZA 4Z3DA 1J9EA 1E3QA 3IQDB 4TLAA 2UXBB 4X1KB 5ENZA 3V7WA 2WHEA 1B00A 3LQYA 4QGBA 4Z0HO 1FNSA 2Y76A 3REQA 2JCGA 1RU3A 1B41A 4MS3A 1RE0A 1P2UA 4GMXA 1JQJC 4C4SA 3KKMA 4CLRB 1XRMA 1GRRA 4W8HA 3GBUA 4WWHA 3QW4B 2HCRA 3OF2A 1ZCFA 3MCVA 1HDYA 1NNI1 4IG9A 3GJ7A 3HJTA 3UZUA 3IH0A 1UQRA 3I6ZA 2OA0A 2XE8A 4X1OA 2Y0CA 2RCNA 1OBCA 4KB5A 2J3LA 3RAJA 2I2DA 3FUVA 1EKKA 5YASA 4BLOA 1JKJB 1W4ZA 3D4LA 3QI7A 3BHNA 4MDYA 2V6BA 1DJNA 3FFBA 2I4OA 4N7BA 5FYDA 1EK1A 1Z34A 2FFHA 3UT6A 4UU1A 2PK3A 2OYRA 3WZLA 2EX4A 1LUAA 3C97A 1C0KA 3JYQA 2VP3A 4MGKR 5H70A 3ZX4A 4G0YA 2ZUTA 1RAAA 3UXHA 1ZH0A 3QU2A 1W0KA 1ZI8A 2JLBA 3HADA 4CF5A 4TXHA 1ZAKA 3PL5A 5CITA 2AFIB 1GQ2A 3MRSA 4MLPA 3PU6A 2IFTA 5FA8A 3W9UA 4RCZA 5JAIA 1GITA 1QO0D 3X2SA 2CJWB 1E9CA 4ML3A 3WOHA 3RVOA 3H75A 3UKJA 3OC6A 5TGZA 5TRTA 3H49A 2G67A 4PX9A 4Z4EA 1O97D 1A9ZA 3K9BA 3WKAA 2Q0XA 3GFRA 5FL7A 1QGOA 3G8CA 2QPLA 3CCCA 3F9RA 3LUPA 3DHWC 4YAEA 5EN4A 4EO9A 5JSFA 5H80A 5FOTA 2GXSA 5BY2A 2F8MA 1PQWA 2VJBA 2XUFA 3UKOA 2HYIC 3A3KA 3QG5A 3LC0A 5H5JA 1ZIDA 4MGEA 5TQ0B 2WFAA 2YVUA 5K01A 1EHYA 2WY2D 2O8VA 2WM8A 2QMYA 4W1PA 2XUPA 4V0SA 3U37A 4A0SA 5LQSA 4IIUA 1JSXA 1A2KC 1U94A 1CRWG 5EJ4A 5K7SA 5KX5F 3OQIA 3QKRA 5FBVB 3UN1A 1PCXA 1O3YA 2VJPA 2ZFUA 3EVGA 3ZIUA 4DDWA 3VNAA 1PUXA 4KO2S 2B4RO 1GL7A 2RGUA 1ORHA 3VMMA 4ADSG 2X9GA 2YL2A 3DL0A 3ZZ1A 3N0WA 4RYDA 4DLBA 3ONWA 4RWEA 3RUEA 4FYKA 1Z5OA 1SUCA 3P97A 4DADA 4E21A 2AA0A 5TC4A 3NHBA 1LDGA 4BB0A 2WB2A 1SQSA 4EUKA 3L40A 4TL7A 2PKYX 3FSEA 4MP8A 4Q93A 1TT5B 3A1TA 3C70A 4QUJA 2YCLA 4O8CA 3UH0A 2JI6A 4D8WA 3IDOA 4U9HS 2WM3A 2XAUA 3T5AA 1V16A 1OWNA 1Q16A 5DE3A 1R4MB 1H9BA 4GEGA 2WHPB 4UMDA 1RI1A 2PV7A 2VF5X 4GRDA 1P7VA 5KSPA 3FPLA 3P2YA 4GQAA 3M1IA 1F8GA 4MK4A 3ZE6A 5JPCA 5E7JA 1FS6A 2GN2A 1DWPA 2X42A 4PNEA 2JLSA 1A71A 1ACMA 1IDN1 1WD7A 5AM1A 2EFDB 5EI5A 1E92A 2CBGA 3H3XA 4X95A 5DBIA 5AW8A 4G9EA 4W5HA 4WZAE 5THXA 1NV9A 1SO8A 2BEUA 2DM6A 4BCBA 4RMHA 4JX8A 5BP7A 2ZIGA 5CR9A 4QOHA 4OPMA 4BE4A 1IOLA 4UREA 4G1FA 4CFZA 1W7AA 2P4HX 3JALA 3HVRA 2ABQA 4R7ZA 4ZEMA 1EFHA 3WK4A 4B82A 5E6UB 4JT4A 3TDMA 2VUUA 3M4ZA 1Z82A 3TQFA 4YAGA 3B6IA 4QDXA 4BO8A 2B78A 3HKDA 4DA9A 4BUBA 3NYQA 3BE8A 1EGMB 4KO1S 1BMQA 1ZINA 4P7FA 1UZUA 1E79A 5KTOA 1DOAA 2I4NA 3F6EX 3CCBA 2LE0A 4KXYA 2I55A 5K6AA 3DXZA 3CQ9A 3CONA 3MTIA 4IZIA 1JXOA 4LHXA 3M3DA 4RMIA 4AG5A 1RZUA 4UMEA 1M5UA 2ZTVA 3PEFA 5AJUA 1PFYA 5TMEA 3RUHA 1SKYE 1II8A 1UKBA 1IEWA 2IUFA 2GHRA 4J9UE 1BDBA 1W5FA 4EM6A 5AD1A 3HB4X 2HA3A 4IJKA 4P53A 1PHRA 1XKQA 2ZKLA 3DPSA 2OMKA 5AVOA 4EVIA 1R9MA 2CLHB 1L0BA 2BEWA 3BL5A 4HJXA 4BNTA 3E3MA 2IP1A 2HWKA 2JFXA 2UUOA 4MVJP 3TNJA 3OMXA 4HGQA 1L4NA 1IPEA 1UBHS 2FEPA 1V3TA 4UAGA 3RKUA 1M1YE 4ESEA 1LS6A 2QLFA 5BSRA 1KJNA 1XIVA 1U7UA 4LCEA 4BWFB 2PGJA 4UUNA 3ZD6A 1QH8A 3I92A 5HQ3B 2EBFX 5TGDA 1L5RA 3LL7A 4KHZA 4H3HB 4JLPA 1EIWA 1VTKA 3KKQA 3OE7D 4PY2A 1SD1A 5HF5A 1E5VA 4X92A 4F21A 4R71A 4XF7A 3L0BA 4F4DA 1K98A 3O9MA 5I4CA 5ES4B 4ZT2A 3ZGVA 4EHFA 4WN3A 4LYGA 3ZK7A 1C8LA 2IWHA 3R7WA 4TRJA 1SVMA 4RSGA 2GN4A 1DAFA 2QX6A 2GA9A 4WN9B 1Y9JA 3U60B 4BX9A 5B2ZA 4AIRA 2H5JA 3C4VA 1CKEA 5BR4A 3G9TA 3OJFA 1UFRA 3EIEA 3U7HB 1Q1BA 4EJSB 1RYBA 3CSSA 5A3VA 2WSBA 5ARDA 3U7GA 1YULA 1QV6A 2CNDA 1TTQB 1AN9A 1ZU5A 2FQ1A 2WF5A 2XUAA 1LPPA 2O50A 3GWZA 4MWCA 3IHWA 4LXYA 1ZMRA 3KQMA 3SVLA 1E2MA 2NUAB 5C8DA 1V5IA 4KQMA 3OZGA 3TRKA 4AUEA 1EESA 4OCZA 3TL2A 4CLHA 4I50F 2IBTA 2H18A 4N18A 1I3CA 1YJQA 1PLKA 5FA5A 2R44A 2H4WA 4P8RA 1TQ8A 4RF3A 5IWCA 3I9V6 5A1TA 5HQJA 2AFIE 3ECAA 3KJGA 1LDMA 1YASA 2RC6A 3R3XA 5ER6A 4NOMA 2WICA 2Z9DA 3KAQA 3OIUA 3P9KA 4MGHA 4LYFA 4CI9A 4R7TA 1S3SA 4I1IA 2IGTA 3AF5A 4HKTA 3GOQA 1SIWA 1YJ8A 4MLDA 3SM3A 4CT5A 4ZVOA 1SWVA 2R85A 1NX6A 1DNPA 2C07A 3EXIB 4MRVA 5CDYA 4W7IA 4BO7A 5DNYB 3DM9B 2QGFA 5CVEA 4Y6GB 2JJQA 3ZJVA 5G40A 5MFZA 1NN1A 2REOA 3FOZA 1KQPA 1M72A 2R6GA 3HJUA 3S44A 1MFZA 1XB2A 2MIIA 2WA2A 3GCXA 4R0VA 2WNIA 2AWDA 2I1VB 2FETA 1MJNA 4ZOEA 5KTTA 1QU2A 4QWMA 1N6OA 1XCMA 3HHEA 1OIVA 1CBUA 2YHBA 3FSJX 3FNGA 3HWRA 1YUMA 3HBNA 2C2ZA 3QU4A 1JI3A 3MJVA 1WOMA 4HDMB 5PNTA 1LTHR 5CEEA 3EARA 2JLWA 1B7GO 2O05A 3AEXA 1J8DA 3OZBA 3URMA 2BGMA 4MEBA 3JW8A 4NBLA 4RD2A 2ZB2A 5FWYA 3OLQA 2C57A 3T94A 1QHHA 2FCRA 4P3XA 3EODA 3U49A 4DPMA 5AHXA 2I99A 4NJEB 2P0AA 4LGVA 4QZVA 4JOBA 5FWAA 1YS6A 3PQCA 5LP6B 1V39A 2AHOA 1QHIA 1A7KA 3A6FA 4E1VA 2O6HA 4I19A 2GAAA 2LWIA 3BORA 3IUSA 3DYIA 3LT0A 2QUKA 3LYLA 1G9TA 3I9OA 3NVAA 4G0PA 2HA5A 1ETHA 5CGQB 2IEIA 5FEMA 3ROGA 2ZYDA 4KAJA 4KYIB 4PTLA 3P94A 3TSCA 4D3ZA 2BHLA 5LXTB 4GRAA 4JQSA 3UWDA 4BIIA 2VP5A 4HXGA 3SPXA 4XCKA 1S4QA 4WT7A 1O9BA 5DHTA 4G3XA 3SYLA 4YCSA 3VUEA 3B3FA 3DE2X 4DLYA 1Z25A 421PA 1YU9A 2JZOA 2Q6LA 5EHNA 4F8YA 1QHFA 2FW7A 1LPBB 2LCFA 1AQUA 3FYUA 5BNFA 4D7AA 4CEJA 2XUJA 3H0KA 1XA4A 3EJWA 3KZKA 4RKRA 5KKNB 3D31A 3WLKX 1XU7A 4YRAA 2IZOA 4E94A 5IKXA 1FFYA 1U1FA 3GAFA 4A5OA 1MNQA 1ZUNA 2P6PA 2RONA 2VSXA 3JD2A 3BT7A 2QPAA 1TCVA 3KL2A 3SYNA 2G5CA 2NQTA 1WU7A 4FI3F 1E4EA 4TSFD 4BQSA 2JJYA 1WSDA 4GYWA 4RKFA 2ODEA 5EQDA 3DKRA 4Y9RA 4ER0A 4TQAA 4HTFA 3WGUA 2GM3A 3AETA 1YSCA 3NYIA 3GCZA 2JLAA 2A9VA 1GU0A 3EDRA 5CH5A 5EVCA 1QLHA 4GRIA 4L73A 3FGPA 4RETA 3K0CC 4C6TB 4QGHA 4C29A 2FEOA 4CIVA 2DKNA 4D6YA 2RGCA 5T57A 2PL5A 3MWLA 4HWPA 2QTHA 2FDRA 4KWEA 4UHFA 3P20A 3ROPA 2VRCD 1W4BA 4BWYA 1DADA 1VC2A 2ZATA 3KHKA 4QU5A 2B92A 1HBJA 1U3VA 4GLJA 1WP4A 3MUEA 3ET5A 3P9IA 4YAUA 2XDYA 1RXWA 4JJGA 5BWNA 1W6UA 1KI9A 2VNHA 4DILA 4PZ0A 5I9SA 2NMVA 1RJFA 1LVUA 1KWKA 4L74A 2X1VA 4DR4B 1T9BA 4RKWA 3EE6A 2WC1A 1TLFA 4DEVA 2BEVA 1F4VA 4Q05A 4F38A 3T5PA 4TV8F 2R1ZA 4M3NA 1FU8A 5DLPA 5I3CA 4ZRMA 3HP7A 5ITVA 1FS5A 3VNVA 1O5ZA 2XCQA 5JANA 3EXG2 3ZWCA 5I7RA 5EJ2A 5B1SA 3ROFA 4FYHA 5J47A 2GJAA 3ORHA 1LWOA 5DASA 1Y4UA 5BWCA 2WUEA 2P5SA 1CDEA 1BS2A 2PLNA 1FVXA 1N5JA 2NV6A 4ALIA 1B26A 4R84A 4UW9A 5F21A 2O2SA 4V3BA 3S28A 3KT3A 1SBYA 3A9UA 3KBBA 5HJ2A 1E6LA 1RM4A 4EUHA 2MYTA 1GN9A 2FUG6 1F2DA 2V6FA 3OEHD 3JQEA 2R6ZA 4O2BB 1WXIA 5CLLA 3RO7A 5AVYA 4Q02A 3UJ7A 1AD2A 3SS8A 4OQDA 4HZIA 3SICE 5E1BA 1Y7IA 1PZMA 3AFOA 1ZRSA 1KDTA 2ZUBA 3JQ6A 4MX8A 3ZTYA 4DCOA 1XCOA 1POXA 2F3TA 3QGMA 4AZSA 1CR6A 2YHUA 2VJDA 4XDZA 3HWX1 3SEFA 3N5KA 3IS3A 1SZCA 5BURA 1YF3A 4MPRA 3NEJA 5DVZA 2F64A 5A9SA 1N2CE 3IIJA 3TN7A 4GM1A 4B8WA 2AOTA 2ZXFA 2YFQA 1JJFA 1FU4A 3LBYA 3R8FA 2V0NA 2WIJA 3HFSA 1CHNA 1IY9A 3CMMA 4LWOA 4NKRA 1Z13A 2AQHA 3B8EA 1JVNA 3DXFA 3OECA 3TE6A 1MV8A 1XELA 4C0JA 5DHAA 4KFSA 2E21A 4DUPA 1N1MA 3H2YA 2IZ1A 3O94A 3OU7A 1ND5A 4D9IA 4MR7A 2J7KA 1C7ZA 3CZAA 4XYEA 2DQSA 2VBFA 4MI6A 3AF0A 2ZR0A 2QY6A 3ND8A 3H7IA 4V38A 3RGWS 3V4OA 4DKXA 5HRAA 1CJMA 1XV5A 1JF8A 2BFNA 1KVTA 1JHXA 4LEIA 1KU0A 1RR6A 2YY7A 4QPPA 1WPRA 3VPFA 5LA6A 4JIGA 1W73A 2J3EA 3VYVA 1SC9A 3LQRA 2Z2XA 3TZKA 4FFNA 2AS0A 1NKVA 2AT1A 4TMVA 3G2NA 2PD4A 3H9QA 4ZA2A 2LVBA 3O4VA 4NMXB 1GZ6A 3NJ4A 4XXHA 5AVQA 4JC5A 4I9UA 5LOVB 3BVPA 3ZDBA 1V8BA 1X2BA 4X20A 5BO5A 3LLSA 2RGNC 1JAXA 5NULA 2SKDA 4OJYA 1D3AA 4H17A 3CW2A 5AK0A 4FR2A 3UVEA 1GUBA 4X97A 5AH0A 3EASA 1JG1A 1SVLA 2JI4A 3BXZA 1C1XB 2H5IA 1MBZA 1XJ5A 2EBHX 2B1GA 2LCIA 4PFKA 4R8VA 4A91A 3K94A 4YJDA 3D6JA 4WRRA 4FIDA 1PD0A 1Q74A 3HN6A 4S04A 3IUNA 5CT8A 1B1AA 2NSJA 2F2TA 1RRKA 1YVDA 2GTIA 2Z98A 1TT7A 2OP0A 1S8NA 2BF7A 2ZJOA 2ZYVX 1NT4A 3EAFA 3I42A 4HSGA 2FKAA 3DVRX 4LHVA 4QOSA 2HDNB 4WBNB 3UG7A 5BN3B 3B9PA 1HNNA 5IPFA 3DZCA 1C3EA 3RS2A 2E4WA 2NX2A 4HJRA 1TTTA 2IS6A 1SXJB 1L4YA 3OPXA 1SQFA 5DEOA 1JTEA 1M66A 3GLIA 5FWXB 1TX4B 1VJDA 3HXTA 3OE5A 4RGQA 4BQEA 1DMRA 1BVUA 3OCVA 1JYSA 4M89A 1SVKA 1V7PC 2L69A 2V7XA 4REQA 5DBHX 3SBDA 1LK0A 4L57A 4B3JA 2VL7A 1P5FA 4TLCA 4F4IA 2F59A 2OO7A 5FJJA 1Z45A 2QTMA 2GZ1A 1UJ4A 3RROA 2IS1A 3F6YA 2CDRA 2HLZA 4GX2A 4YRCA 5J2UB 2AW3A 3CINA 4HLUA 2C9DA 2QE7A 4S1VA 4WQMA 1N2ZA 2VWQA 4EIWA 1TKAA 3AF2A 2QVXX 4AQDA 2XNDA 4H0CA 4N9QA 1Z5GA 3G49A 3QZUA 1H85A 1KS9A 5JDCA 3PUKA 3V8QA 1GQRA 2A8YA 1V5FA 3BZBA 3F49S 5AVWA 4XPZA 2IBSA 3FPEA 3R7DA 5C81A 3K8OE 5CTJA 4BNFA 3RF7A 3F5FA 3L0PA 5F5LA 3PFNA 4YPOA 3ORQA 1Z4OA 1ZN8A 3VGJA 3JAMA 3G7UA 2JAUA 3I37X 4Q9DA 1JSCA 4KALA 4G0NA 5TE9A 1AQIA 1BEZA 1Y5RA 3OZIA 4NH0A 3CTMA 2V78A 3AEUB 3LPNA 2AG1A 4BZWA 5IJZA 2C7VA 4OHCA 3C3YA 2PZGA 3GRPA 3FE2A 3E9ZA 4AU1A 2WMYA 3BJIC 2ZRGA 2QD5A 3C45A 3CHYA 1OAOC 1K88A 3JZFA 3LQ2A 3T0GA 4CEIA 3PYLA 4EHJA 3AETB 2OBMA 3HNPA 4FT4A 4BE7B 1C3LA 1M6HA 1IQRA 1ES9A 3S1SA 3KOWA 2ZRQA 1XMVA 3BRWD 1A8UA 1ZJJA 5E4YA 4RJTA 5FOQA 4RJKA 3W5VA 3ABQB 1I6KA 1TKCA 3KVRA 4CEIB 1WM1A 1T2FA 3KDAA 2JIDA 1W0CA 3M70A 4R2MA 5H7XA 1ZVJA 4W7SA 4OUDA 4TUYB 2OAGA 1IQ0A 4NU5A 3F1LA 1ZUIA 4QQRA 1RRFA 1NVEA 2QYOA 3VNSA 3OT1B 2DY0A 1ZNZA 3I73A 1S1MA 1MUUA 3FYUB 1OT3A 1J1IA 4RXTA 1SJ9A 5ALSA 4RYLA 3ZDCA 4KFUA 4E7OA 3GCDA 2HLDA 5CB8A 2J48A 5JU6A 1BQ3A 4HWOA 2CKMA 1Z5WA 4RD0A 3VV3A 2Q2OA 2P4SA 5JZBA 5T3YA 3LF2A 4UOEA 1G5IA 4Y7DA 1Q84A 4AZ0A 4I8XA 4L4UA 2YXEA 2P35A 4KXNA 3A6PC 3PE3A 2H1SA 3EZLA 4JS0A 1GZ3A 3OEYA 3H3JA 4KXLA 3BJRA 3GRZA 4NI5A 4Q3KA 1DV1A 4DLSA 1BH6A 3RQ8A 3CU5A 3P1JA 4WNCA 5ALFA 2XTNA 4EO7A 1TAQA 4OHKA 1EFDN 2FV8A 2WF8A 1EVIA 4I4TA 4KR0A 5K3CA 2IYAA 4F3KA 3ROKA 3A6HA 5L53A 1ECBA 1V19A 3QA2A 2XNJA 1GC5A 2QPOA 2B98A 2D6FA 1H3FA 4XWWA 5E3JA 1O6BA 4YN3A 5JISA 2PQ2A 3KYCA 4I08A 3NBQA 4HUQB 1HK7A 1H42A 1KJWA 1NUPA 1XLTA 2VQ6A 3HVHA 4B80A 2P77A 4B3IA 2HBYA 2RGNA 5EINA 1CLEA 1W581 1CVRA 1L7EA 2QLTA 2Y0DA 1IMJA 3AG5A 4LWPA 3T5MA 4AJOA 4ZMRA 3IE0A 4D99A 2AMYA 4XX0B 3S6JA 3AH8A 4HFJA 3X1ZA 2EERA 4TYPA 2G83A 2JFPA 1PS0A 5A9SB 3F71A 2YOFA 1B0PA 1C0LA 4UQOA 5AJZA 2OD2A 4DSNA 5TDHA 4Z7OB 2QX7A 2HM7A 2F17A 4EPYA 4OGWA 4I1RA 3GZNA 4JT8A 4RIIA 2QL7A 3SYKA 4YMHA 1PT9A 4ZYVA 2BZ1A 8LDHA 3D64A 4NMLA 1COWA 1W4AA 5PGMA 5UKDA 1E18A 2ZTMA 1YIOA 2Z8ZA 2EV9A 1JSRA 1UBKS 4JENA 4QNRA 1YNSA 1EFAA 3NCHA 1DJPA 2J3HA 3I8SA 3I9MA 4JC4A 3ICCA 2P9QA 2W48A 2DR0A 3C6MA 3P9RA 4LMRA 3EBPA 3ZU6A 3PQ8A 5E8RA 3QF4A 4RM2A 5JXGA 3AY7A 3C6YA 3QAIA 2VUHB 3NBKA 3L4BC 1P4AA 1XQ1A 1ZMBA 2C9ZA 3GLTA 3FTNA 4L75A 4NSNA 2GXUA 1CERA 3BGWA 3L8CA 1CUHA 4HMQA 4C5BA 3PJEA 3K2EA 2JW5A 4IHJF 4YQFA 5C8YB 7REQA 5CJJA 3TDNA 2WIDA 1JKMA 1R6TA 5G2OA 1EFPA 3ZHOA 3D4NA 4GR5A 4LYJA 2JA2A 3VYTB 1W78A 1NTOA 2WPDA 3GA5A 3MLEA 5B57C 3NASA 2YS7A 1CXZA 3G5UA 3WMWA 4WXRA 3VC2A 2VUSA 1RAFA 4OBBA 5JALA 3I4LA 2WZCA 1DEHA 1XA0A 4RE6A 2GWHA 2NUPB 2PA0A 3S81A 4O02B 1UPTA 3OOHA 1KFJB 1TZKA 2R6AA 2I54A 2PR2A 3NUGA 5EYPA 3QKUA 2W6ID 2C4EA 3IKVA 4HUTA 1FPMA 1PT5A 1NLZA 1PEKE 1WSAA 3OLWA 5DIFA 5KTNA 4C4OA 2DSTA 1I7DA 3IIMA 2RG7A 3ZHBA 2XR1A 3ETGA 5G0VA 1BVRA 3VJRA 3V8MA 3FOAA 4E14A 1G64A 2FWIA 1P1RA 1U0NA 2JH3A 3KXPA 3DZGA 4JJ6A 5JFTA 1GNTA 1H0HA 4W99A 4HTFB 4AZTA 1Z7WA 2OV1A 3W77A 2QW0X 5MGBA 3K0HA 2YN2A 2P6UA 3B1QA 1KO4A 4R1OA 4WTOA 1SU7A 1P0PA 1DJMA 3A06A 1GY8A 1KL7A 2LGJA 2ZUSA 3WZMA 3R20A 4GICA 4DLZA 3Q2OA 1R5JA 2HIAA 4C4XA 3TI9A 4AQYB 1FDIA 3NAQA 4D74A 3NDIA 2DG2A 4YAOA 2BSXA 4JSYA 4D0NA 1OUMA 3KT0A 3QIAA 4D9KA 1NF8A 1Y1RA 4WASA 2DR3A 2XUGA 2WOJA 3PRKE 3DLTA 3QUAA 1P75A 3N0TA 4DMFA 2XD4A 1EVLA 1PFQA 2H4FA 5KEIA 2B5VA 1P1KA 2MTBA 3GYBA 4ENWA 4PQGA 1XRLA 1WHTB 1Y8QA 5K2MA 2HJWA 4TLEA 2ZK7A 5IJXA 3L7YA 1FYVA 1V6SA 2R6FA 3SC2B 2R4TA 4ZU3A 4M55A 1P39A 3IVMA 3VYUB 3H4TA 3BSFA 3ILYA 3WGMA 3OP1A 1IBLB 1E79D 2ON6A 1AS0A 2C03A 5HILA 4RU1A 3DOJA 1DIRA 3QH4A 4RA6B 3HDQA 2MSWA 3H83A 3SZMA 1AB5A 3EMKA 4OXQA 1DUVG 3TJMA 4JKIA 2QW8A 1JDPA 4KAHA 3LBHA 2C4HA 1KE2A 4DJTA 5IF9A 2M1XA 3DHVA 2BN4A 4IV8A 3QVOA 4KN5A 4B6EA 1PGOA 4TS9A 5H8WA 4RSMA 5KNBH 3GD5A 2Q62A 4XDHA 3RVKA 3WXBA 1OHHD 3KELA 1EJ6A 4GG1A 4XGKA 4Y6LA 3SKVA 4MW0A 5K8VA 1W7KA 1RBYA 3I3OA 4MLCA 5I9BA 3V34A 4JN6B 3H6KA 4KFRA 4NAHA 1NLMA 4F2DA 5DM0A 3RVLA 3RBXA 4KYTA 3UMJA 2B20A 2IKSA 3AX6A 4G4SO 4L8GA 1KIMA 3Q3IA 3WLFA 1PFKA 2H92A 3DZFA 3OOYA 2W8ZA 1OTXA 3TD9A 1AKWA 1NBOA 2AG5A 2D0DA 2HDOA 5CVDA 1MGPA 9MHTA 3PHGA 3L3BA 4HRXA 5EZ6B 3PWSA 4RVDA 3UV7A 3HLYA 1QQ5A 3DNPA 3I0NA 1YGYA 3RVRA 4L08A 2W2QA 4NL4H 2MR6A 3VMFA 1B6GA 3QEMB 3P0RA 1WCIA 1IUOA 1S2IA 5B6JA 5EERA 1BC5A 1GTSA 2X23A 5AJXA 1RM3A 5LKAA 4MUKA 2LD4A 3LFHA 4NYMQ 3WIVA 3WNDA 4DA7A 3K5HA 2CYCA 5F1KA 2ERCA 5LQCA 1ZSNA 1VGVA 2JD2A 1N3YA 3HBMA 4PC3A 1W5BA 5KC8A 1OVMA 2FPUA 3CW9A 1EUQA 3P8ZA 4K1LA 4MR7B 3DGEC 3OIVA 4DLUA 4KVZA 2ZSAA 4QPNA 3DVLA 4Z53A 1O54A 2DUJA 1P4RA 1JLKA 4RV9A 1C9EA 4G0XA 1K68A 4K9NA 1K0UA 3RE1A 2X5NA 4QQNA 1RRCA 3CXRA 4Q6BA 4EJMA 1P81A 2RHTA 2IU4A 4D3XA 3IE7A 3I2IA 2O2DA 4PFQA 3H4IA 3QLUC 5EJAA 4GMDA 1BO6A 4I5EA 2BMFA 3AFIA 5JAPA 5K03A 3HN7A 5F33A 1EUZA 3L7DA 3BDAA 5FUWA 4PYNA 2F7SA 2WJIA 1G0OA 3JQ9A 1ECLA 2BKVA 1KYXA 4G81A 5DNUA 5B7GA 5DZSA 1IPFA 3IMEA 5E0OA 4ZCLA 4GWGA 2WWGA 4B8RA 1L4FA 1GTJ1 1I51A 2JFHA 1XCBA 2VDUE 2ZJZA 4AZ3A 2X76A 4RMJA 1D07A 2VHEA 2W2NA 4UMVA 4W9NC 4YX9A 3OQPA 4YGYA 2QN6A 1XDSA 3UMCA 3A36A 2JA1A 2J9ZB 3M2TA 4DA6A 3SMQA 1DP4A 3MRXA 1FFXA 3FTDA 4GZ5A 2BYTA 4WESB 3THYA 3SQXA 3QXJA 4PWZA 3KPWA 3M3PA 1ODKA 2V58A 4EPRA 3ILXA 2X8LA 4B8YA 2PH1A 3FMFA 3RIXA 4W5JA 1RQGA 3RS4A 5C4GB 4XD7D 3PQ3A 5T67A 3TVDA 3M33A 4LV8B 5ALEA 1FRFS 1GYPA 3NALA 3EWIA 3PYXA 4MP6A 2OFPA 1YRWA 1TW2A 3RVMA 1U5AA 3O8CA 3CRRA 2HI0A 2X6TA 4FFVA 3QI2A 4G5RA 4NFLA 3H8WA 3I2GA 4ACBA 4CLRA 2C78A 4W5OA 3PFCA 4TSRA 3TLMA 3LK7A 3VDRA 3OX3A 3WLTA 3F97A 4ZTBA 4ILEA 1EZ1A 3DPIA 2PTHA 3E22A 3TNLA 4KE8A 1XDDA 1DVRA 3TRHA 2FVYA 2LDXA 5EP2A 1YZGA 1T5BA 3ZNQA 2CXXA 4ZU1X 1OKKD 4DSAA 2Q1XA 2BM1A 1U3CA 4GOJA 4JP5A 3EZ2A 5FNZA 2J41A 2F7KA 3VKFA 4K6GA 3K6SB 3V3KA 2YXUA 2BP7B 1GZDA 3GDFA 2FYTA 2BEJA 1P61B 2YZKA 3MS7A 4J1NA 4BMNA 2PS1A 4X1YB 1XMXA 4I4NA 2REQA 4O5AA 5AOCA 1DC4A 1JG6A 4CG1A 1UAGA 2ZIEA 4C1NA 3E7WA 3KZOA 5ULLA 2ZVPX 2GAIA 2NU6A 5BN3A 2DXIA 3NT2A 3TF5A 4HB3A 4AUNA 2C2WA 1DPGA 2ZJBA 4CLEA 3IMCA 4FNOA 1R12A 4WKGA 1JIJA 3OTHA 1YQGA 2QU7A 2GPNA 3W0LB 4ENVA 1KQGA 4CIDA 3E58A 3QBDA 1V37A 3G8BA 4O2RA 4JR0A 1NM5A 3ZK8A 3T6KA 4MQMA 4CCWA 3GEDA 1G19A 4CKWA 4QGSA 3ZI0A 1SEPA 4WZBA 3OE4A 3WG9A 1KIFA 2WRZA 4MIYA 2H16A 2SICE 3JWEA 5C3ZA 3QPWA 1TNDA 1LIKA 1NRXA 2A9OA 4EJ6A 2WIKA 4GX0A 2JF0A 3L0CA 5EUCA 2O8DA 4YFYA 4C89A 4H7KA 2EZTA 4OHMA 4X6UA 4CDGA 3TTVA 4MYTA 4OHFA 1XLWA 5FFMA 3UWKA 3VYWA 1IHDA 1LC0A 1TTHA 3JQRA 5H16A 4C0XA 5H3LA 4MSUA 4RTNA 1MJGM 2IEZA 2EGHA 3LBAA 3HXQA 3A4VA 4WOKA 4M0DA 1ZAYA 2ZBQA 1FYFA 3EG9A 4ZEXA 2XXBA 5TQ2A 4FBMA 1J0EA 4GHWA 5I8PA 3A2MA 1IZ7A 2O0KA 5JPDA 3USZA 1W85B 5DHFA 4CNBA 1UA4A 1GPLA 4ZCRA 4Z9BA 1IB0A 3KAKA 1S8FA 3OAAD 4X00A 2FSPA 3A3YA 3TBKA 5A5VA 3KLNA 1WTCA 4WCVA 4K93A 4OTZA 3ZHRA 3JULA 4LYHA 4WLNA 4IGIA 5IK2A 4C03A 1E0KA 3W7VA 1UH5A 2GVDC 4YJHA 4C4ZA 2QT9A 3VJLA 4BJ1A 4RLFA 3GZJA 1Z38A 4QRIA 5E9QA 1OFUX 2J3KA 1BS9A 5THKA 2YRXA 3LRTA 3O4JA 3VZPA 2H17A 1CS0A 3BGVA 3ZGYA 1ZJ6A 4CXMA 5T6MA 5LLDA 1F4PA 3T3HA 4PVVA 1T5DX 1C2YA 4TKMA 2JVJA 3F4LA 1WSWA 8ATCA 2EF1A 1PZNA 2AEMA 5IEBA 3S1LA 2O3QA 4IIEA 1B6RA 3ZQ6A 4OHPA 2W22A 4NCBA 1G6OA 5L95A 4B6QA 4HGZA 1IXSB 2FU5C 1E2FA 4GOKA 4MHOA 3MT9A 3DRWA 1PFWA 1TA0A 1JX6A 3ZCQA 4GIBA 3JD3A 2QVCA 5TVKA 2Q9BA 5TS3A 1N2HA 2C0PA 3DUFB 1P7PA 1WHSB 1NVTA 2AIRA 3KB1A 2JFQA 3TLJA 5C8XA 3UUFA 1N2CB 1V3QE 3WKBA 2XIJA 4OI4A 3L8EA 4DC1A 3AM1A 2D13A 2HT6A 3TOXA 4O2BF 3OF3A 3N2LA 4O4HF 2QQEA 2X7JA 4DLRA 3RPHA 2Q4BA 4AKSA 1K9VF 1BW9A 1O0SA 2HNKA 4PINA 3VKVA 5J5VA 3NYWA 4N09A 1PFGA 3NHRA 4NENB 1X8JA 2ILVA 4X1IB 1WNFA 3VOAA 4BVEA 1OA1A 3L8ZA 4POAA 4YO7A 3UJBA 3ND6A 3VH3A 1URPA 4EVQA 4I46A 1BXGA 2W37A 3ZDZB 4AS2A 2VDMB 4IIXA 1USVA 2WP0A 3OA0A 2JBWA 3OZTA 4DR2B 3H42B 4DV6B 2C31A 1RLUA 2IJGX 3GJZA 4ZV4A 1I7QB 3RDPA 1TYEB 3ZM6A 3QELA 1N5LA 5K1ZA 4IJWA 3NC2A 1VG8A 1YQUA 3NL2A 2ODTX 1QQAA 1HKHA 1AC5A 2CUKA 3GT0A 3T3GA 3UT5A 3FCUB 3R3WA 2ZJYA 5FT9A 4EEZA 1KKLA 2IYWA 1QK4A 1DBIA 1XEXA 3FLEA 1WMSA 3EQ9A 5C4MA 3HBLA 4UPEA 1Z12A 4UTZA 4QXQA 1RKDA 1EQUA 2HDWA 2BZ0A 3AI2A 3NIFB 5CA0B 2E5FA 1RIFA 2FFAA 1C9KA 1JE1A 1U6JA 1Q0RA 2ONZA 5CYOA 1ZQ1A 2ZUVA 1FDUA 5EKTA 4CBVA 5I7SA 4JXZA 1K6MA 4EHBA 2PT6A 1P9RA 2QR5A 5H83A 4ASUA 1KQNA 2VJMB 4OP3A 2PZJA 2Q8PA 3COPA 3RR2A 2G77B 2QD3A 4PPNA 3L8MA 3NBXX 3QK7A 3LTEA 1K06A 2D7DA 2LW7A 1B3RA 1I1OA 3V5NA 1WXEA 2PH3A 3I23A 1BU8A 5LCXA 3R7NA 3VU9B 1XSEA 4MPDA 4DPLA 3PXXA 4XKJA 4ZVQA 5JAUA 2CDBA 2YYYA 1XO1A 1C30A 2P3SA 4UNNA 2MINB 1XWIA 1X39A 4N9WA 3EOAI 4G1CA 2Y8EA 1HOTA 2CMHA 2XD9A 2XCUA 4ZOQI 1V5GA 3KKEA 2GPTA 1SCNE 4OK5A 1ZRMA 4UFOA 4XJSA 1WW3A 4HQLA 4MUFA 3EHEA 3NAGA 3ZHCA 1T35A 2ILTA 3EG5A 4PX3A 4BMYA 5K5EA 2RGRA 1KYVA 4PLTA 4KRYA 2WUGA 2HMYB 2M9MA 3GBPA 4JVOA 5CURA 4AP5A 1JAYA 4NFHA 4JKUA 3I28A 1O58A 2ZIXA 3N86A 1P1CA 2CVPA 3DBHA 3PC2A 1P31A 2QL5A 2EG5A 1I2MA 4UM9D 2VDQB 4J91A 3TIIA 1HLDA 1JEQA 2G9ZA 4K28A 1X1SA 3ZE0B 5L7WA 1KQOA 3D1VA 3S8EA 3FPHA 4X7RA 3FHTA 3H99A 3QY9A 1YC5A 5DJ5A 4UD2A 2O1SA 3TR5A 1ORVA 2H8KA 4RTJA 3S55A 3QOWA 5LZ4A 2WZBA 5IDWA 3BTSA 2VYQA 4R83A 3G85A 3ROTA 5F2EA 3WBBA 1QZXA 1FUIA 2WLSA 1G2QA 1XTTA 2XITA 3NKFA 1HQCA 1UL1X 1V11A 3AXTA 3QBTA 4FIZA 4WERA 3VH2A 4ER7A 4GL2A 2GYYA 3WMEA 3AYZB 2QGNA 2F3QA 4L3VA 2UZIR 3IT1A 5EZYB 4DIFA 6REQB 4ZREA 3T4UA 5U9CA 2GUGA 4M38A 3GC6A 5DT2A 2XADA 4DV0B 3ICPA 3HN2A 2J4DA 3ZZUA 4CKWB 4WZAA 2PMBA 2Q7DA 4YV1A 2VBCA 4HOYA 4S1OA 3QVSA 5CVUA 1SC6A 4FGWA 1HT0A 3LH5A 4QTYA 1U1DA 1FK8A 4I9NA 1PT8A 2HLHA 2Z30A 5J9FA 4A8JA 3WGQA 1UFQA 2P2LA 4IF6A 4WBSA 3EXHA 4N8DA 4G5YA 2ZSUA 1K2VN 1KFKB 2XWPA 1GNQA 3OFKA 1QHYA 4IFIA 1NVXQ 5HS4A 5CCBA 4ZJPA 1TT5A 3DSRA 4K9QA 5KTYA 2R11A 4TTJA 4WOBA 4KODA 2B2CA 5EFZA 3VRHA 2BFDB 3MTBA 4KK4A 4OAOA 4RABA 5DNAA 3SBXA 2PXCA 4YR9A 3EW7A 3AEUA 2RGYA 3R3UA 4Q3AA 4XIGS 5K0SA 4LF9B 4C0WA 4HAWA 3WLOA 3PTAA 3EZXA 2D5BA 1U80A 4LZNA 1OX5A 2V9ZA 1T9GS 5AOBA 4ZQBA 1CY4A 4WFQA 5HM8A 1IN6A 1OSNA 2IU3A 3IPXA 5HA5A 3T5GA 2HA6A 2JLVA 1WOYA 2YFYA 3E7XA 1GUAA 3F90A 4IV0A 3OPNA 3QVVA 4LJYA 3GGDA 3GRVA 3GUVA 3AQ4A 1YS1X 5JZMA 2UUAB 1DBRA 1XJCA 5AJHA 4LKOA 4XTRA 1KGDA 4D96A 1UOOA 2R48A 2ODWA 5FWXA 2IIVA 4OAPA 1KF0A 3OQOA 4JITA 2AWOA 5JI2E 4U3JB 3IOBA 5BRAA 2H0QA 1AZTA 2GCOB 3ETEA 4UBIA 4TYWA 1QF9A 4PGGA 1W88B 3DZJA 4IL5A 4JBHA 4KPUA 1P0IA 2BKXA 3ZUGA 2AC7A 4P98A 1A1SA 1UZAA 3C6XA 3W3AH 4MQFA 2Z1NA 2FY8A 3CJQA 3REGA 1P2BA 1UDWA 4LK2A 2J85A 3IC5A 5B4UA 2ATEA 3BFKA 4K40A 1NR1A 4L8LA 1KAGA 4ED9A 3LJSA 4OATA 2ZJ2A 1WG8A 4KGVA 5KINB 2B3DA 1PQYA 3WYCA 3BMNA 4HAIA 3QE2A 2C84A 1HE4A 3ILVA 2ZIWB 4KACA 5ALMA 3BHIA 5B53A 4NMWA 1QFYA 2N46A 5JSZA 1KP2A 2W8BB 5JXWA 4B4UA 3DT9A 5FV4A 3AO0B 1TCUA 2MSDB 3BCHA 5ALRA 2EKLA 4HB4A 4DDMA 1E9FA 1PUJA 3FVWA 3UJ6A 1Z0AA 2TS1A 1RWQA 4LW8A 4PYOA 1FRVA 1ZYUA 5CVJA 2F4NA 4DQXA 1Z2OX 1NZFA 4DMCA 4CEHA 5U4QA 3UV6A 3H04A 1Q7TA 4UTNA 3W5BA 1BIFA 2GX6A 5JNWA 3QYPA 4Q03A 4BEVA 13PKA 4H1HA 1NKTA 2YIJA 4P08A 1PQ4A 4C7VA 3CF4G 2K5UA 4NP6A 1O2DA 3EQ8A 2NO4A 2XMZA 2CLIB 4TRRA 4CUKA 3QBJA 5BN4B 1Y3CE 4U6QA 4XSGA 4JA2A 4Q7KA 3E6AA 3NWBA 2QLLA 5HG0A 3FPJA 4RO0A 4BMZA 1YOVB 3R0VA 4FB4A 3DL4A 5ITZA 3KSBC 2VH5R 2OFWA 2FZ4A 1H6BA 3F7NA 4MV3A 3OZAA 1SU6A 4Y9SA 4LBGA 2CF6A 2OL4A 1NU8A 1T3HA 3RODA 1DKLA 2DTEA 4QDUA 1P7YA 3K0SA 1H2RS 1MAUA 3WP0A 2AD1A 5HWSA 5E6RA 1NY5A 3FKSA 4ZAFA 3V1NA 2J4FA 3FI9A 3NVMB 4TV9A 4KSCA 5H68A 1MX3A 3MUFA 1IY0A 1ZD4A 5GGYA 2OG2A 2BW0A 3NU1A 3LA8A 3EIQA 3IEVA 2WZQA 4KUHA 3SF8A 2JASA 2AJPA 1P2TA 1U0TA 4P3OA 1QR2A 1QSGA 2C3PA 3T7SA 1JPUA 3PNKA 1ULAA 2PRIA 2COUA 3CTPA 2YJ4A 2DB3A 2W70A 3ESXA 2H0AA 3REOA 2OHFA 2WMOB 4ZVNA 4K3UA 3P9ZA 3H2IA 4HNAB 3RV4A 4HAOA 2GJKA 2VLIA 4TVOA 4YYEA 4EHAA 4NICA 1GYRA 4KQHA 1QFZA 4FLMA 5CM8B 2F43B 5D8DA 4TXMA 3DDUA 1MJ5A 3MXTA 2W2TA 1X92A 4RKYA 4F3RA 2VH1A 2CT8A 3R6GA 4FSXA 2XMQA 5FBRB 5FPKA 4ETNA 2ZP1A 3PXAA 5I7FA 1UJNA 4PAOA 2F48A 4UVGA 3JD1A 2B8TA 5G0SA 5T4BA 4A0RA 4ARAA 5KYXA 3ZVKA 2O8FA 4NEHB 3FN4A 3K32A 4PC1A 1V1BA 5IVIA 4G8CA 4BNJA 3VXKA 1EE9A 1QPZA 2YWEA 3WL5A 3ZIAA 1U3GA 3KB8A 5A4FS 4Q9IA 1NX9A 5FPQA 3I6IA 2DYKA 3D5TA 3DPUA 2HWUA 4X1YA 3S40A 1RFUA 2BR3A 4GOLD 5HGXA 4KI0A 1WUTA 1XF1A 2CHQA 1EAMA 1SOMA 2W42A 4DT1A 3B1VA 2J5RA 1RWNA 2QTVA 3ZXXA 4IIHA 4K9KA 4JNKA 1GM5A 3WRXC 4BXOB 1DJLA 2E4UA 3IKMB 2WABA 3PNQA 1Z8DA 3U4IA 5K8TA 5HCNA 4J76A 3AJ9A 4C5MA 4XQEA 2Y9PB 3H5NA 2CLOB 3AONB 4FGZA 4IIGA 1T43A 1RXVA 5HUJA 4JWKA 3RYCB 1VCNA 1XTJA 3GEMA 3IAXA 4IVRA 4NYIR 3T1TA 1C8KA 4MVJG 5EQTA 3TKAA 3IA7A 4ZEOA 4D42A 1T2VA 3HSKA 3Q4GA 5DMXA 3IQWA 3P0JA 3W2IA 4B0PA 4GZ6A 4ZYWA 1W30A 3RGGA 1U65A 4G1UC 2QYTA 2DY1A 2JCSA 3QYAA 2W71A 4XWKA 4QBHA 4D4GA 2D1FA 2FEXA 3KIPA 2CK3A 4O08A 5IJ9A 4PHCA 3WGZA 3UMOA 4JBWA 3GLGB 4BO5A 2WPDD 4WKBA 3GDOA 1BVHA 1YE5A 2NO7A 1EI9A 3LCRA 1UT8A 1N9GA 1WCV1 4DREA 2HCJB 2FGKA 3VKGA 1XMQB 2C3MA 3HMQA 1WB5A 4I6JA 4P6VF 4YRPA 2DPYA 4B7ZA 1ISIA 3EULA 3NAZA 3STHA 2H2GA 1Y1SA 4BX0A 2B36A 4YQYA 2PKQP 1CFJA 4TM7A 5EXSA 1N5IA 4NAVA 1FDRA 4CTMA 3HPQA 3GLGA 1Z74A 4X8FA 3N76A 4D4KA 3VTZA 3G6WA 1TECE 2ZYWX 1JHYA 1TZMA 2YYAA 1IJBA 1C9NA 3ABOB 2NIPA 3CLVA 5GMOA 4O4LF 1MOSA 2ICAA 3ZXUB 4AS1A 4OQ4A 4EJFA 1Z6ZA 2FKNA 2WAXA 3IESA 4U2KA 1NBHA 3ER6A 1BXRB 1JT2A 4H60A 3WDKA 2QQ5A 3FB1A 4RQBA 5DSZA 1CW2B 2YV4A 3ZE8A 1CY8A 2QZSA 2PZEA 1QZ3A 2NZ2A 3EA0A 5LZ2A 2WMNB 1OI4A 3GMDA 5I5EA 4BMDA 3EK2A 3FX2A 4OOEA 2AVNA 5FOVA 2HL6A 1GFSA 1OWLA 4YJFB 4EHKA 2IXBA 3HXOA 2B0CA 3Q12A 2OECA 2VLBA 5MGNA 3MIZA 3STTA 5L51A 3AFGA 4K9SA 4E5MA 3DZ8A 4ZO9A 2HIGA 2O0HA 5DCLA 4J7AA 3ZHUA 2ZU0C 1QIFA 4BBAA 1NBMA 2AMJA 2G9RA 4IIJB 4TTRA 3ZY5A 4DY6A 3UMMA 2N0SA 1J8QA 1T8WA 2Q5HA 4Z1OA 1VHJA 3LG2A 3Q7SA 1GTMA 4FKZA 3VNBA 2O7NA 2FP3A 2Z5GA 4WAUA 3S29A 4U2DA 3G6KA 2I67A 5AKXA 2BTQA 3AM3A 1JJ7A 2P2DA 2YXDA 3AIIA 3SEAA 2WU0A 3JYPA 4I4LA 5IN5A 4JA0A 2A67A 2D3WA 10MHA 1T10A 3AU9A 4LF4B 5I9NA 2P5TB 2R1VB 2JVIA 2Q07A 2P30A 2GZRA 1V8FA 1QGUB 3CNNA 1DE0A 4HXFB 4KMMA 3RFFA 2B5WA 2GNPA 1NE7A 2APJA 4QELA 5BQXA 3WQQA 3LL4A 1GKKA 2YWDA 3NEPX 4JLUA 4OL0A 2GHQA 3CLRD 1PAUA 5AKLA 5BW4A 1AUVA 3ZVMA 4IF4A 2AE1A 2L0XA 1WLYA 2YR0A 4NNOA 1RXIA 3WLMA 4B46A 1Z4PX 3KSAC 1V1RB 5DBGA 4ZKEA 1EXVA 4ZTUB 4P2GA 5EHZA 1JYEA 5A1JA 2DFTA 4MP3A 2G36A 2N1BA 4B2IA 1GADO 1Z5UA 2BI8A 4R6WA 3V4ZA 5CA1B 4I0WB 4G89A 2O2CA 2DHQA 1ADJA 3I04M 5AW5A 4QRDA 1RKVA 5C1DA 5DTMA 4KIFA 3I2KA 1C0EA 4UFPA 1R8XA 3EEIA 1RMYA 1CDDA 2C9BA 1TEXA 4GBJA 2BVNA 5ECDA 5IZCA 5HFAA 3EPLA 1RYMA 3TD6A 1DCTA 1T1JA 1RCTE 2CLLB 2E7ZA 3OOWA 4NZMA 5D85A 6PFKA 4OGLA 1NZDA 2BRUC 2DUUA 4HADA 4O1HA 1D9ZA 2C8JA 2WHRA 3KEMA 4B5LA 4BMOB 4HVLA 4WK0B 2PKRA 3H16A 4K8RB 1U2DC 1YHYA 4F9GA 1TUBA 3FKQA 1YR6A 3ACDA 3JATA 5BRNA 4BQPA 2OXEA 4E7PA 2OGWA 3SXUB 3PEUA 3ZHYA 2PBZA 2D5IA 3A1FA 4HEA1 1MC5A 1XZ8A 4HH1A 2BFCB 1NVKA 2HRBA 2VYNA 4PS0A 1JXQA 5AIAA 3D2LA 1HTBA 4HFMA 4CF6A 1GOTA 4IG4A 4RIFA 3HXKA 2JDIA 4JGGA 2R6DA 5DOZA 1DAHA 3WAKA 1P0QA 2FK8A 1MRNA 4BFYA 4CVKA 3PXEA 2X9VA 4FCCA 3OQVA 4M36A 1DLIA 3T1NA 4ZHQB 3KEGA 3ZWOA 1U0LA 3EUWA 1UPXA 2G5GX 3TMAA 4EL5A 4E13A 1CNFA 2PD3A 1NULA 4GDMA 1G41A 1NJ2A 4IICA 5SZIA 4N3GA 3SSNA 1XPUA 1IY8A 4KQKA 1Q77A 1ABEA 2PLAA 3MBIA 2AJLI 4R1PA 5EKXA 3DNFA 4B5KA 2XA9A 4CN8A 4EG5A 1H4QA 4JJFA 2GASA 1P60A 4PLCA 4CIYA 4ZT4A 4PAQA 1NW4A 2J9FB 2Z57A 1WQ3A 4ZOBA 1SCDA 4L28A 1IZZA 1BWRA 4OHYA 2B5OA 3RAEC 1A77A 3MOIA 3O3CA 1FQOA 3QWHA 2ZUEA 2G9VA 4F06A 2AM2A 1ORTA 1JT9A 3FBWA 2ZUCA 4PLWA 2A9JA 2FG6C 3UJDA 3W4KA 1LRLA 4S12A 2CC2A 1V25A 1MH1A 2WJVA 3CSUA 2J87A 3RTEA 4F5DA 3EPKA 3RYHA 1B42A 1QANA 2EFYA 3LT1A 1D6SA 5ABPA 2CK3D 3B2QA 3CNLA 4ALMA 2H00A 2O23A 1K08A 3I09A 2ZQZA 3OBBA 1U3FA 1M2OA 3A14A 3DQZA 2RBEA 4Q9LA 1OV4A 3OCUA 3S8MA 1QK3A 1X80B 3CC8A 1LWNA 1JQDA 2A5JA 3PP8A 1QC5B 4UCWA 2KYRA 2G4LA 1PV2A 4UOZA 2EL7A 1LDYA 4YP9A 4N0QA 3O92A 4QYTA 1OFIA 4D4MA 4CIAA 4DB2A 4ARUA 4EGSA 1L7NA 2XTJA 2EP8A 4B3GA 3X1KA 1X7ZA 3BWBA 3CPHA 4HWGA 2X0FA 1M8JA 4F6RB 2QR2A 2HJVA 4TMXA 4YT8A 3R9IA 2JIZA 4ZCMA 4EGFA 5HOQA 2IEGA 3E03A 2UUBB 4XIFA 2IXEA 2JGRA 1LBSA 2Y9MB 4R5MA 4WZ6A 1ESJA 1XXHA 1X13A 2EWWA 4AJPA 5KMGB 3I2JA 4XZ3A 2F1HA 3EQZA 2IUTA 4IOKA 4LNUB 3RK1A 3Q6NA 5J5AA 2JK1A 3SJZA 5AJTA 5FI3A 1GAQA 4KV9A 2GKOA 4IRXA 1LRKA 1J06A 3SR0A 1KO5A 2PUCA 3CZCA 3PF9A 1IXZA 1RVDA 3OPVA 3SLGA 4TVSA 1KTIA 1HDGO 4B4DA 4DR7B 4CMBA 3LPLA 3SS7X 2QP4A 3R5KA 2XXAA 2JKYA 3R6TA 2NP7A 1SG9A 2BV3A 2NNWB 5CXXA 3B3AA 4UUOA 4UZEA 4GXQA 5A4DA 4EUFA 3OOJA 2D06A 5JNRA 4YT4A 3A1SA 5GV7A 2FG7C 3MS4A 2ZYAA 1NGSA 3K9CA 4FDAA 3TSZA 4BZPA 4G1MB 2X8AA 3MUNA 4K03A 2C9MA 5DX0A 4V1CB 5HDQA 1NJ6A 2D1QA 5JR3A 5KU1A 1DAPA 1F8FA 4V0ME 4AJHA 4M7RA 4HVAA 4GW3A 3AHHA 1ECCA 2W2XA 1TF2A 1P2GA 2WI8A 3K31A 3MS2A 4WLOA 3S0JA 3UC5A 4BFUA 1SKYB 1V47A 5FUQA 1GSOA 4LXIA 4P58A 4YRFA 3EPRA 1C3OB 3IB6A 1RJWA 4RVFA 3W1EA 4K2HA 3SDSA 4YUXA 3ADKA 1HM5A 1CUUA 1T13A 2ZRJA 3KUUA 4B48A 4I4TB 4OHWA 4JYZA 5F2OA 5JS2A 3TCKA 1LPNA 3ND5A 1WXXA 1H23A 2YJGA 3FSGA 1N1GA 4DCGA 2XZPA 4UM7A 5JS6A 3GEBA 2H4HA 2XSZD 1EXMA 1VFNA 1RXYA 3DMGA 3IV6A 1VLHA 5B58T 1S7CA 1EM8A 2IV7A 5ITWA 3GLGE 4Y6RA 4FEEA 2JFGA 2W6QA 4LX8A 2JI8A 1XCPA 3VHXB 1JB1A 3U3OA 1A04A 4B3FX 1ZOSA 5LIRA 3RSCA 5JARA 2O5EA 2NV2B 3HY6A 1AX9A 4IH4A 1RYYA 2IXFA 3JWPA 5KAPA 1SHKA 4J94A 4QC2A 3B36A 1NVMB 3GQVA 3VR5H 5ERXA 4KQXA 4Q9AA 1AKQA 1H2YA 1WLSA 2DBYA 4CNQA 4DYHA 3OC0A 1RQNA 3TWOA 2VJLA 1TYAE 4BFVA 5HIMA 2DU8A 3NONA 4I99A 1GNRA 3NLLA 1MT3A 4EQZA 5KNDH 4UDOA 5CT9A 2DSNA 2HV8A 3VBEA 4M8IA 5H3CA 4ZT5A 1U2ZA 3ZU4A 4F2PA 1CU1A 3PRYA 2PR7A 3DOHA 4P36A 4XQ0A 5JRDS 2VXCA 4HZUB 2WSLA 1RKUA 3OLYA 3PE4A 3U6KA 1Q1EA 3B3GA 3I8XA 4ZPXA 4EDFA 4FYVA 1YCHA 2V3WA 4D41A 3CURA 4J8PA 1EB8A 1OILA 1J5PA 1UBTS 3T7IA 3QA3E 1Z4NA 4HBZA 1MQ8B 2Q8NA 3FWYA 1H5UA 4LZOA 2WVGA 3QOFA 2VJMA 3KXIA 5DHQA 1JRLA 4IXDA 3RRMA 1JEYB 1DCMA 3P45A 1C14A 1QVZA 1ZXLA 4YALA 1LJ8A 4EHLA 1J1UA 2GCBA 3AJ8A 1K4MA 4H27A 3NHAA 2OLJA 4KK3A 4HGRA 5K3FB 5KNCA 1RWXA 2YW2A 5EY5B 2DX7A 4ZV9A 5LD2C 4LHYA 1QBGA 4UQPA 4L0QA 4I3HA 1ZGZA 2P9BA 3HBFA 1R27A 3AHDA 2G0AA 2OWEA 3IPYA 1C41A 4H7IA 1JHMA 4PRLA 5CA0F 1SVOA 5IFKA 3S2FA 1ZW1A 3RVNA 3ESCA 2ZYGA 1DT5A 3IBGA 5HKKA 1V26A 3U44B 1VKHA 1E1MA 1J8MF 3HYSA 5AKJA 5C8YA 2JD1A 2FRXA 7YASA 3KLBA 4E84A 2WF6A 5I3ZA 1PBNA 3EGDB 1VMAA 4DZTA 4A16A 4F4JA 2OSVA 1UMBB 2ZSDA 4PAMA 5BYFA 2F9LA 2GZSA 3QX9A 5A03A 5J4VA 3AR3A 2O57A 3PCXA 1RABA 5EIBD 3SVZA 4QPZA 2NN3C 4E5VA 4N4AA 4XM0A 4E5YA 1YS4A 4IDHA 4AZVA 3BD6A 1V4VA 4F1KA 4B32A 4YFVA 1CUYA 4IKPA 2BR5A 5C7OO 7AT1A 1OLSB 3HYCA 1ISJA 1E7YA 1GT91 3K5PA 1G21E 2XGSA 3HVUA 3RC3A 4DBZA 1J6UA 2EF0A 2OBBA 5JVDB 1GVHA 2Z2ZA 1E1QD 1TA9A 2MSEB 3DA8A 2BHSA 3JQBC 2I4LA 1FY2A 4QG3A 3HU2A 4WY5A 1Q0ZA 4CIBA 2ORWA 2FOIA 1FYDA 1YDHA 2PCJA 1E7WA 3OOEA 4DB4A 1IVSA 2RI0A 5E1DA 3GUZA 4P38A 1SVSA 3MAGA 4BRZA 4UM8B 1OWOA 4XLZA 4BQIA 5EIXA 2BIFA 3EJ6A 1B8UA 4NARA 4ABYA 4BJHB 3PD7A 4F12A 4LVOA 4XYBA 5EE9A 1PJRA 4X64B 5IUNC 3BQNB 4EFKA 4BWGA 5FX2A 3TK1A 4Z0TA 1JEJA 2LUOA 1VL1A 1Y3HA 1LK7A 2C97A 2JIMA 1MIOB 2W83A 3HFRA 3OCWA 4OJMX 3LPCA 4QPJC 3NGMA 1TM5E 2ABWA 3OJLA 2Q3DA 3QLUA 5T3UA 2IDKA 5CDSA 4JLBA 4HQKA 1WNTA 4OI1A 3BE5A 3IKJA 5AT1A 4Z5XA 3PC6A 3F47A 4MYSA 4F71A 3ELYA 3HYLA 1MIOA 2R3BA 5AW1A 1KJIA 2YQ4A 5GJVC 2VQ3A 1WMAA 2I7VA 1XNQB 2CCJA 4UU8A 1MORA 2RGAA 1QGYA 2EQ5A 5JQGB 1YCDA 3PX7A 2EHJA 1Q0HA 4UEJA 3P7MA 3I6MA 3GBSA 4FYXA 2ZB7A 4LSWA 4AMZA 1QU3A 2HSEA 1Q0PA 1ORIA 1Z16A 1ISSA 2AMFA 2ZWIA 3BGKA 3KAJA 3OF5A 3ER9A 2GI4A 4IIYA 4B81A 3C5CA 1VG1A 4PLPA 5A9RA 1OE0A 3E9EA 2IY8A 1KOLA 2XH8A 3HM2A 5LDDC 2OV3A 2HBZA 4U9UA 1TUEA 3O26A 2BLNA 3HXLA 4GOMD 3FVQA 1MG0A 2BE9A 2CE2X 4PGFA 5EXPA 4DMRA 4Y2UA 1CE8B 4LQLA 1PS8A 1PZGA 5JJIA 2WAMA 1C50A 3L7MA 1ONNA 4JEIA 1DQPA 4HDNA 4EMTA 5INTA 3E5MA 3MWEA 4NABA 2AJDA 2M1ZA 1UXJA 2C5SA 2ECKA 5G4LA 1ZC3A 4YRDA 4MUIA 4EG4A 3GG2A 4XD2A 3VKUA 1BYIA 1E2NA 1MQ9A 2J6IA 2YC2C 3I6QA 3R4CA 1KH1A 2D7CA 1KERA 4FXOA 1J2UA 5EL0A 4ZVSA 4D8YA 2I66A 2P1DA 2C7PA 2JJ2A 2C9CA 2NQ2C 2P9JA 2V7QD 3ZHQA 4LRWA 4IKOA 4MWGA 1X8KA 3DE4X 1TFUA 2CF5A 2EIHA 3MT8A 3PHJA 2R0QC 3C5EA 3IFSA 3VVCA 1TAHA 3RJTA 3AI3A 4BKMA 3AB3A 3MD0A 4LQDA 4A0GA 5M04A 3IX7A 3CS3A 3JYLA 3U62A 5LSAA 1XTVA 2WM9B 3D6HA 3LY5A 1GPNA 2I3GA 1RRVA 5LPNA 2X9QA 3T1HB 2I6SA 1KSFX 3ZLTA 1SK9A 2VK4A 3VX3A 2G63A 2ZULA 3IEIA 5EE1A 4ECAA 5ADUS 1ECFA 2PD6A 4MCJA 1QHNA 5IKOA 3K8ZA 1QE3A 4LDNA 1GHTA 4L85A 5JNVA 3R0QA 1V95A 4G07A 5FD8A 3N39C 5AQ1A 1GPDG 1U8TA 2BELA 2H6EA 3EGEA 4L0CA 5M7EA 5C3YA 3BHMA 3PR3A 5CYPA 3PWKA 2J32A 3MK31 2VHVA 2N3ZA 2QHXA 4DEYA 5KOHA 1EUYA 5CMLA 5FPPA 3LOOA 1L9KA 4DARA 4XQCA 1WUKS 1WXQA 1YL7A 4M1QA 2AJRA 4UNRA 4EB6A 4YRGA 4RFSB 1X7HA 1I0ZA 2JFFA 2OCXA 5JWHA 4Q1FA 4QECA 4AMVA 2PO7A 4U63A 3GT3A 1ESDA 1GILA 1A4RA 1HMYA 1NLFA 4AUMA 2W0MA 3KR2A 4BMVA 3SX4A 3UYLA 1AV6A 3DP7A 1QG0A 3QVWA 3IAS1 4Z7JA 1E2QA 4CMIB 2AN4A 2OILA 4JZKA 1U3WA 2IE8A 3UAYA 5DF1A 5FBQB 4M1SA 1KVSA 2VF4X 4MCHA 1QNFA 2WD7B 2IOYA 5H0IA 1K0FA 2NG1A 2ONCA 3CGGA 4QDOA 1XZLA 2P9HA 4TROA 1SCUA 2CD7A 3LP5A 1H0RA 1CUEA 1IHPA 3MZ0A 4UCXA 5C2JB 5CGAA 1Y1PA 4J0IA 3MLBA 3TFOA 5JVDA 1BA3A 1JPNA 4CIWA 2JFBA 3G5MA 4LI0A 5K0FA 2Q6OA 4F46A 4QATA 1IWOA 4HVTA 5BWOA 1ITZA 1JBQA 5ALHA 3WIDA 2NP6A 1SOUA 3HQ4O 2C58A 2PJDA 3TINA 3RQIA 1QE0A 4O25A 1UPUA 3D6VA 3PDIB 3AG6A 4HH0A 4X20B 3RSHA 3U4DA 4D44A 4YMVA 5HMMA 3RRBA 1D2CA 4LDJA 3OQMA 1OZFA 2O7SA 3KE8A 4MV6A 1KJJA 2ZBRA 3JQ8A 5AOVA 3TM5A 3EVBA 4A8HA 5JAHA 1QLWA 5F0ZA 4R4JA 3ISTA 3C24A 3FNFA 3WO1A 3DMDA 1PWHA 1GQFA 3HFJA 4X9XA 4GPZA 4GYJA 5EQFA 4EHIA 1EK0A 2A7XA 1Q11A 2NV0A 3GUUA 4GI1A 3KYIB 5LXTA 2AXPA 1K6JA 3IHKA 3P27A 1OH8A 2J6CA 2O20A 5KBYA 3N8KA 2AYZA 4OREX 1GAJA 3MCAA 3ED1A 5KWVA 1NQTA 1Y82A 1L4MA 1PJBA 2XZDA 3P2JA 5I8ZA 1X19A 3BQ9A 3HICA 1SA0A 3B53X 4XVHA 1FYXA 3I9FA 4IDAA 4CMEA 4D9MA 3WGKA 3LBFA 1NP6A 1CNEA 4HWKA 3ITKA 5TPZD 4QKQA 4TS3A 3ROXA 1R0RE 4UEKA 1RCFA 3I83A 3GLUA 1IUNA 3K1TA 2P90A 3C3AA 1D6JA 5JXIA 4DDVA 2FLWA 5HK9A 2FW9A 4HDMA 4IJUA 1KNXA 2AZMA 3DEIA 2GEDA 4QGGA 3HMKA 4BFLA 4EKNB 4TYQA 4JC8A 3ABSB 4MRAA 5EAIA 2F1IA 4EHHA 1M1YB 3Q5GA 1G7CA 3KSMA 3PUZA 2JAPA 2ZYRA 3F67A 3FNEA 4RPHA 4N47A 2J3JA 5FBHA